Citrus Sinensis ID: 001553

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050-----

MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMSNCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFHSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQLHEEKVQITH

cccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEEEEEEccccccccccccccccEEEEcccccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccEEccccccccccccccccccccccccEEEEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEcccccccEEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEccccccccccccccccccEEEEcccccccEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccEEEccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccEEccccccHHHHHHHHHccccccc

cccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHEEcHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcHHHEcccccccEEHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccccccccHHHHHHccccEEEEEccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccHHcccccccEEEEccccccEEccHHHHHccccccEEEEEcccccccccccccccccccccHHHHcccHHccccEEEccccccccccccHHHHHHHHHHHcccccccHHHccccccccccccccccHHHHHHHccccccHHHccHHHcccccccHHcccccccccccccccccccccccccEEEEccccccEccccccccccccccccccEEEEccccccEEccccccccccccccEEEEEcccHcHcccccccccccccccEEEEEcccccHcccccccccHHHHcHccccccccccccccHccccccHHHHHccccccccccHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEEcccccccccccHHHcccccccEEEEcccccccEccccccccccccccccccccEEEccccHHHHHccccccccccccccEEEEcccccccccccccccccHHHHEEEEcccccccccccccccHHHcEEcccccccccHcccccccccccccEEEEccccccccccHHccccccccEEEEcccccccccccccccccccEEEEccccccHccccccccccccccccccEEEEcccccHHccccccccccccHccEEEEcccccccEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEEcccccccccccccccccEHHHHHHcccccHcccHHHHHHHHHHHHccEEEcc

MGSEANFSIEILNEEEAWRLFEVKlgnddliprmKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHelrmptennfhRELGKAYTAIKLSYDALKGEQLKKIFQLCslmpksffasDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSClllegyscrefsmhdVVHDVAILIACGEQKEFlvrngdvwewpdedalkkcyaiswidssggelpeglecpqlELLLLssehssvdvnipqrfftgmrelkvvdltnmqlfslpsSIDLLVNLQTLCldystlgditiigklknlEILSLIESDIVEFPEELGKLtklrlldltncfhlkviapnVIASFTRLEELYMSncfvewkvedegssskkskasldelmplprlttLEIAVendnalpegfFVRELERFKIligdrsfeppvilskdwfrisrshFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLvqnnpdllfivdsreivdcdafpLLELLSLQNLINLKRICvdrlstesfselrtmkvencdelSNIFVLsttkclpslQRIAVIKCNKMKEIFaiggeepdvvdnnnaiENIEFAQIRYLslgnlpelksfccevkgpsmppslfngkvvlpnleaLELCEINVKSiwhnqtpccfqrlTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQViiseggpgqeppcfafrrvtnislchlpeltclypglhtsewpelkkleVFSCdklntfasesfsfhsnekkqlhvpkqpffsfekIFPNLEELGLSIKDIMMLLqgdfpqdhlfgslkdlevrdddsasvpigllekfhglenlnlsfcSYKELfsnggqvhlIKKLELICLNdleylwipnskmgdsilQNLEILKVDSCQKlmnlvtpsgakslVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKsldlhhldsltsfssgnytfrfpsleylcvigcpkmkiftagdlrtltesvcygyghgewrsdsnINKIIHQLHEEKVQITH

MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMSNCFVEWKVedegssskkskasldelmplpRLTTLEIAVENDNALPEGFFVRELERFKiligdrsfeppVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVlsttkclpsLQRIAVIKCNKMKEIFAiggeepdvvdNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFHSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQLHEEKVQITH

MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDssggelpeglecpqlellllssehssVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEElgkltklrlldltNCFHLKVIAPNVIASFTRLEELYMSNCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPllellslqnlinlKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFHSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIklksldlhhldslTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQLHEEKVQITH

******FSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMSNCFVEWKV*******************LPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFH*****QLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQL*********

**SEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMP******R**GKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAP**IASFTRLEELYMSNCFVEWKVEDEGSS**********LMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEE***VDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISE*********FAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFS*HSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKEL********LIKKLELICLNDLEYLWI*****GDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVIS*****A*KEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIF*************YGYGHGEWRSDSNINKIIHQLHEE*VQ*T*

MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMSNCFVEWK************ASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFHSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQLHEEKVQITH

******FSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMSNCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMPPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQKLKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFAFRRVTNISLCHLPELTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFHSNEKKQLHVPKQPFFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASVPIGLLEKFHGLENLNLSFCSYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQNLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEEIVFIKLKSLDLHHLDSLTSFSSGNYTFRFPSLEYLCVIGCPKMKIFTAGDLRTLTESVCYGYGHGEWRSDSNINKIIHQLHEEKVQIT*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1055	2.2.26 [Sep-21-2011]
O81825		919	Probable disease resistan	yes	no	0.578	0.663	0.291	4e-49
Q9T048		985	Disease resistance protei	no	no	0.556	0.595	0.269	3e-43
Q42484		909	Disease resistance protei	no	no	0.347	0.403	0.304	6e-34
Q9SH22		884	Probable disease resistan	no	no	0.327	0.390	0.306	5e-25
Q9LVT4		843	Probable disease resistan	no	no	0.343	0.429	0.284	8e-25
Q940K0		889	Probable disease resistan	no	no	0.288	0.341	0.319	1e-24
Q8RXS5		888	Probable disease resistan	no	no	0.307	0.364	0.324	2e-24
Q9SI85		893	Probable disease resistan	no	no	0.309	0.365	0.318	2e-23
O64973		889	Disease resistance protei	no	no	0.327	0.389	0.295	8e-22
O82484		892	Putative disease resistan	no	no	0.312	0.369	0.307	2e-21

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function desciption

 Score =  197 bits (501), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 199/682 (29%), Positives = 313/682 (45%), Gaps = 72/682 (10%)

Query: 1   MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALR 60
           M +  N  +  L E+EAW LF   +G       +K  A  +  EC GLP+AI  I + LR
Sbjct: 261 MMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLR 320

Query: 61  NKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPK-- 118
            K + E WK+ L+ L+    +    E  K +  +KLSYD L+ + +K  F  C+L P+  
Sbjct: 321 GKPQVEVWKHTLNLLKRSAPSIDTEE--KIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDY 377

Query: 119 SFFASDLFKYCIGLGIFRGID-MEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHD 177
           S   S+L  Y +  G+  G    ED  N+  TLV  LKDSCLL +G SC    MHDVV D
Sbjct: 378 SIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRD 437

Query: 178 VAI--LIACGEQKEFLVRNG-DVWEWPDEDALKKCYAISWIDSSGGELP----EGLECPQ 230
            AI  + + GE    LV  G  + E+P +  +     +S + +    LP    EG+E   
Sbjct: 438 FAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVET-- 495

Query: 231 LELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCL-DYS 289
           L LLL  + H      +P  F      L+++DL+ +++ +LP S   L +L++L L +  
Sbjct: 496 LVLLLQGNSHVK---EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCK 552

Query: 290 TLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFT 349
            L ++  +  L  L+ L L ES I E P  L  L+ LR + ++N + L+ I    I   +
Sbjct: 553 KLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLS 612

Query: 350 RLEELYMSNCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGF--FV 407
            LE L M+     W ++ E    ++ +A+LDE+  LP L  L I + +  +    F    
Sbjct: 613 SLEVLDMAGSAYSWGIKGE---EREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLT 669

Query: 408 RELERFKILIGD-RSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQ 466
           + L +F+ L    RS  PP    +    IS           + +    + W       LQ
Sbjct: 670 KRLTKFQFLFSPIRSVSPPGT-GEGCLAIS----------DVNVSNASIGWL------LQ 712

Query: 467 GIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLL 526
            +  ++    +   G+   L       F  +K L +   P L            D FP L
Sbjct: 713 HVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCES--QLDLFPNL 770

Query: 527 ELLSLQNLINLKRIC-VDRLSTESFSELRTMKVENCDELSNIF---VLSTTKCLPSLQRI 582
           E LSL N +NL+ I  ++        +L+ ++V  C +L  +F   +L+ T  LP+LQ I
Sbjct: 771 EELSLDN-VNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGT--LPNLQEI 827

Query: 583 AVIKCNKMKEIFAIGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSMP 642
            V+ C +++E+F       D     + +  +   +++Y     LP+L+S C         
Sbjct: 828 KVVSCLRLEELFNFSSVPVDFC-AESLLPKLTVIKLKY-----LPQLRSLC--------- 872

Query: 643 PSLFNGKVVLPNLEALEL--CE 662
               N +VVL +LE LE+  CE
Sbjct: 873 ----NDRVVLESLEHLEVESCE 890

Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function description

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

>sp\|Q9SH22\|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q9SI85\|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2	Back alignment and function description

>sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2	Back alignment and function description

>sp\|O82484\|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1055
255563252		1603	Disease resistance protein RPS5, putativ	0.908	0.597	0.370	1e-150
255542484		2460	phosphoprotein phosphatase, putative [Ri	0.936	0.401	0.363	1e-149
224143316		1337	cc-nbs-lrr resistance protein [Populus t	0.923	0.728	0.369	1e-146
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.912	0.732	0.361	1e-146
296087872		1152	unnamed protein product [Vitis vinifera]	0.858	0.786	0.357	1e-146
359488108		1436	PREDICTED: disease resistance protein At	0.951	0.699	0.351	1e-146
359488288		1340	PREDICTED: LOW QUALITY PROTEIN: probable	0.878	0.691	0.359	1e-141
224111284		1340	cc-nbs-lrr resistance protein [Populus t	0.925	0.728	0.370	1e-140
224083434		1144	cc-nbs-lrr resistance protein [Populus t	0.725	0.668	0.391	1e-136
147865073		1694	hypothetical protein VITISV_021876 [Viti	0.905	0.563	0.340	1e-128

>gi\|255563252\|ref\|XP_002522629.1\| Disease resistance protein RPS5, putative [Ricinus communis] gi\|223538105\|gb\|EEF39716.1\| Disease resistance protein RPS5, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  540 bits (1392), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 389/1051 (37%), Positives = 561/1051 (53%), Gaps = 93/1051 (8%)

Query: 1    MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALR 60
            MG +  F +E+L EEEA  LFE+ +G D      +S A+ + K+C GLP+ I  IA+AL+
Sbjct: 299  MGVQKVFRLEVLQEEEALSLFEMMVG-DVKGGEFQSAASEVTKKCAGLPVLIVTIARALK 357

Query: 61   NKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSF 120
            NK +   WK+A+ +L             K Y+A++LSY+ L G ++K +F LC L+ KS 
Sbjct: 358  NK-DLYVWKDAVKQLSRCDNEEIQE---KVYSALELSYNHLIGAEVKSLFLLCGLLGKSD 413

Query: 121  FAS-DLFKYCIGLGIFRGID-MEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHDV 178
             A  DL  Y  GLG+F+GID + DARN+++ L+ +LK +CLLL+        +HDVV DV
Sbjct: 414  IAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDV 473

Query: 179  AILIACGEQKEFLVRNGDVW-EWPDEDALKKCYAISWIDSSGGELPEGLECPQLELLLLS 237
            AI IA   Q  F VRNG +  EWP++D  K C  IS   +    LPE LECP+LEL LL 
Sbjct: 474  AISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLF 533

Query: 238  SEHSSVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCLDYSTLGDITII 297
            ++   + + +P   F   + L+V++ T M   SLP S+  L NL TLCLD+  L D+ II
Sbjct: 534  TQ--DISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAII 591

Query: 298  GKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELYMS 357
            G+L  L ILS   SDIVE P E+ +LTKL+ LDL++C  LKVI   +I+  T+LEELYM+
Sbjct: 592  GELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMN 651

Query: 358  NCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILI 417
            N F  W V+  G +++++ ASL EL  LP LTTLEI V +   LP+  F R+LERF+I I
Sbjct: 652  NSFDLWDVQ--GINNQRN-ASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFI 708

Query: 418  GDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNWKTICLRKLQGI--RKVEYLC 475
            GD            W           D+ + R LKLKLN  +I L     I     E L 
Sbjct: 709  GDV-----------WSGTG-------DYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLY 750

Query: 476  LDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLI 535
            L + +G+K++L++LD+QGF+QLKHL VQN+P++ +I+D      C+AFP+LE L L NL+
Sbjct: 751  LAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLM 810

Query: 536  NLKRICVDRLSTESFSELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFA 595
            +L++IC  +L+T SFS+LR++ V  CD L N+F  S  +CL  LQ++ V+ C  ++EI A
Sbjct: 811  SLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVA 870

Query: 596  IGGEEPDVVDNNNAIENIEFAQIRYLSLGNLPELKSFCCEVKGPSM-------------- 641
             G E     D +N  E ++  Q+  L+L  LP  KSFC + K   +              
Sbjct: 871  CGSE-----DTDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVSPISLRVQKQLTTDTGL 925

Query: 642  -----------PPSLFNGKVVLPNLEALELCEINVKSIWHNQTPCCFQRLTRLIVWGCQK 690
                       P  LFN     PNLE LEL  I  + I  +Q       L  LIV  C  
Sbjct: 926  KEIAPKGELGDPLPLFNEMFCFPNLENLELSSIACEKICDDQLSAISSNLMSLIVERCWN 985

Query: 691  LKFMFYASMIKSLEQLQHLEIRNCTGLQVIISEGGPGQEPPCFA--FRRVTNISLCHLPE 748
            LK++F +S++K+L  L+ LE+ +C  ++ II      +E       F  +  + L +LP 
Sbjct: 986  LKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPH 1045

Query: 749  LTCLYPGLHTSEWPELKKLEVFSCDKLNTFASESFSFH---------SNEKKQLHVPKQP 799
            +T    G +  E+  L+KL + +C  LN F S+S S            N +K  H   QP
Sbjct: 1046 ITRFCDG-YPVEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEKNHHTETQP 1104

Query: 800  FFSFEKIFPNLEELGLSIKDIMMLLQGDFPQDHLFGSLKDLEVRDDDSASV--PIGLLEK 857
             F+ +  FP+LEE+ LS  D +  +  +      F  LK + +          P  LLE+
Sbjct: 1105 LFNEKVAFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFPSYLLER 1164

Query: 858  FHGLENLNLSFC-SYKELFSNGGQVHLIKKLELICLNDLEYLWIPNSKMGDSILQ----- 911
            F  LE L+LS C + +E++   G     K+  L+  + L  L+I +     SIL      
Sbjct: 1165 FQCLEKLSLSDCYALEEIYELQGLN--FKEKHLLATSGLRELYIRSLPQLKSILSKDPQG 1222

Query: 912  -----NLEILKVDSCQKLMNLVTPSGAKSLVRLESLTIYGCSAMTQVVISEGDAAAAKEE 966
                 NL ++ +  C  + NL   S A  L++LE L I  C  M ++   E     A   
Sbjct: 1223 NFTFLNLRLVDISYCS-MKNLFPASVATGLLQLEKLVINHCFWMEEIFAKEKGGETAP-S 1280

Query: 967  IVFIKLKSLDLHHLDSLTSFSSGNYTFRFPS 997
             VF++L SL+L  L +      G   F  P+
Sbjct: 1281 FVFLQLTSLELSDLPNFRR-PGGEGQFSVPT 1310

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255542484\|ref\|XP_002512305.1\| phosphoprotein phosphatase, putative [Ricinus communis] gi\|223548266\|gb\|EEF49757.1\| phosphoprotein phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224143316\|ref\|XP_002336027.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222838884\|gb\|EEE77235.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296087872\|emb\|CBI35155.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488108\|ref\|XP_003633701.1\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488288\|ref\|XP_003633735.1\| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224111284\|ref\|XP_002332949.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834261\|gb\|EEE72738.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224083434\|ref\|XP_002307025.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222856474\|gb\|EEE94021.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147865073\|emb\|CAN83232.1\| hypothetical protein VITISV_021876 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1055
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.396	0.454	0.294	8.8e-41
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.539	0.577	0.240	3.6e-30
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.293	0.341	0.270	8.3e-27
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.285	0.334	0.310	5.3e-23
TAIR\|locus:2203881		893	AT1G62630 [Arabidopsis thalian	0.183	0.217	0.339	1.1e-21
TAIR\|locus:2036214		851	AT1G15890 [Arabidopsis thalian	0.327	0.406	0.278	1.8e-21
TAIR\|locus:2197739		762	AT1G61300 [Arabidopsis thalian	0.285	0.395	0.299	2e-21
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.289	0.345	0.285	4.3e-21
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.288	0.341	0.284	6.6e-21
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.178	0.210	0.304	1.8e-20

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 413 (150.4 bits), Expect = 8.8e-41, Sum P(2) = 8.8e-41
 Identities = 128/435 (29%), Positives = 196/435 (45%)

Query:     1 MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALR 60
             M +  N  +  L E+EAW LF   +G       +K  A  +  EC GLP+AI  I + LR
Sbjct:   261 MMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLR 320

Query:    61 NKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSF 120
              K + E WK+ L+ L+    +    E  K +  +KLSYD L+ + +K  F  C+L P+ +
Sbjct:   321 GKPQVEVWKHTLNLLKRSAPSIDTEE--KIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDY 377

Query:   121 F--ASDLFKYCIGLGIFRGID-MEDARNKLYTLVHELKDSCLLLEGYSCREFSMHDVVHD 177
                 S+L  Y +  G+  G    ED  N+  TLV  LKDSCLL +G SC    MHDVV D
Sbjct:   378 SIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRD 437

Query:   178 VAI--LIACGEQKEFLVRNG-DVWEWPDEDALKKCYAISWIDXXXXXXXXXXXXXXXXXX 234
              AI  + + GE    LV  G  + E+P +  +     +S +                   
Sbjct:   438 FAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLV 497

Query:   235 XXXXXXXXVDVNIPQRFFTGMRELKVVDLTNMQLFSLPSSIDLLVNLQTLCL-DYSTLGD 293
                     V   +P  F      L+++DL+ +++ +LP S   L +L++L L +   L +
Sbjct:   498 LLLQGNSHVK-EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRN 556

Query:   294 ITIIGKLKNLEILSLIESDIVEFPEEXXXXXXXXXXXXXNCFHLKVIAPNVIASFTRLEE 353
             +  +  L  L+ L L ES I E P               N + L+ I    I   + LE 
Sbjct:   557 LPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEV 616

Query:   354 LYMSNCFVEWKVEDEGSSSKKSKASLDELMPLPRLTTLEIAVENDNALPEGF--FVRELE 411
             L M+     W ++ E    ++ +A+LDE+  LP L  L I + +  +    F    + L 
Sbjct:   617 LDMAGSAYSWGIKGE---EREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLT 673

Query:   412 RFKILIGD-RSFEPP 425
             +F+ L    RS  PP
Sbjct:   674 KFQFLFSPIRSVSPP 688

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1055
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	1e-15
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-06
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.002

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score = 78.5 bits (194), Expect = 1e-15
 Identities = 37/132 (28%), Positives = 60/132 (45%), Gaps = 7/132 (5%)

Query: 7   FSIEILNEEEAWRLFEVKLG--NDDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTE 64
             +E L  EE+W LF  K+        P ++  A  IV++C GLP+A++ +   L  K+ 
Sbjct: 151 HEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKST 210

Query: 65  SECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPK--SFFA 122
            + W++ L +L           L +  + + LSYD L    LK+ F   +L P+  +   
Sbjct: 211 VQEWEHVLEQLN-NELAGRD-GLNEVLSILSLSYDNLP-MHLKRCFLYLALFPEDYNIRK 267

Query: 123 SDLFKYCIGLGI 134
             L K  I  G 
Sbjct: 268 EQLIKLWIAEGF 279

Length = 285

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1055
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.87
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.86
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.86
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.86
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.85
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.84
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.8
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.79
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.74
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.59
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.54
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.42
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.42
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.42
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.34
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.34
KOG4341		483	consensus F-box protein containing LRR [General fu	99.3
KOG4341		483	consensus F-box protein containing LRR [General fu	99.29
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.28
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.27
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.96
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.95
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.95
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.88
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.87
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.71
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.63
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.61
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.6
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.59
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.46
PRK15386		426	type III secretion protein GogB; Provisional	98.31
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.26
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.22
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.21
PRK15386		426	type III secretion protein GogB; Provisional	98.19
PLN03150		623	hypothetical protein; Provisional	98.16
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.12
PLN03150		623	hypothetical protein; Provisional	98.12
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.02
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.99
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.99
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.92
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.88
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.86
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.82
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.81
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.7
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.67
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.64
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.64
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.27
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.26
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.25
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.22
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.16
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	96.97
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.93
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.75
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.9
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.89
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.48
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.04
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.01
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.71
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.65
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.43
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.27
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.04
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.4
PRK04841		903	transcriptional regulator MalT; Provisional	92.27
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.98
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.05
KOG0473		326	consensus Leucine-rich repeat protein [Function un	90.96
KOG0473		326	consensus Leucine-rich repeat protein [Function un	89.66
smart00370		26	LRR Leucine-rich repeats, outliers.	85.78
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	85.78
smart00370		26	LRR Leucine-rich repeats, outliers.	83.02
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.02

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.2e-55  Score=521.88  Aligned_cols=329  Identities=31%  Similarity=0.478  Sum_probs=264.3

Q ss_pred             CCCcceEecCCCCHHHHHHHHHHHhCC--CCCChhHHHHHHHHHHHhCCCchhHHHHHHHHcCCCChHHHHHHHHHhcCC
Q 001553            1 MGSEANFSIEILNEEEAWRLFEVKLGN--DDLIPRMKSTATHIVKECGGLPIAIEPIAKALRNKTESECWKNALHELRMP   78 (1055)
Q Consensus         1 ~~~~~~~~l~~L~~~~s~~Lf~~~a~~--~~~~~~l~~~~~~i~~~c~GlPLa~~~ig~~L~~~~~~~~W~~~l~~~~~~   78 (1055)
                      ||+...+++++|+++|||+||+++||.  ....+.++++|++||++|+|+|||+++||+.|+.|++.++|+++++.+...
T Consensus       306 m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~  385 (889)
T KOG4658|consen  306 MGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSS  385 (889)
T ss_pred             ccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccc
Confidence            788899999999999999999999963  334455999999999999999999999999999999999999999988633


Q ss_pred             CCCCcccchH-HHHHHHHHHHhcCCchhHHHHHHhhcCCC-CCcchH-HHHHHHHhhccccccc-HHHHHHHHHHHHHHH
Q 001553           79 TENNFHRELG-KAYTAIKLSYDALKGEQLKKIFQLCSLMP-KSFFAS-DLFKYCIGLGIFRGID-MEDARNKLYTLVHEL  154 (1055)
Q Consensus        79 ~~~~~~~~~~-~i~~~L~~Sy~~L~~~~lk~cfly~~~fp-~~~i~~-~li~~wia~g~i~~~~-~e~~~~~~~~~~~~L  154 (1055)
                      .... .++++ .|+++|++|||+||.+ +|.||+|||+|| +|+|.+ +||.+|||||||.+.+ .+.+.+.+++|+.+|
T Consensus       386 ~~~~-~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  386 LAAD-FSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             ccCC-CCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence            2222 23444 4999999999999965 999999999999 599986 9999999999999855 777888899999999


Q ss_pred             HhhcccccCC---CcCeEehhHHHHHHHHHHHc-----ccceEEEEecCCCCCCCCccccCCceEEEeecCCCCCCCCCC
Q 001553          155 KDSCLLLEGY---SCREFSMHDVVHDVAILIAC-----GEQKEFLVRNGDVWEWPDEDALKKCYAISWIDSSGGELPEGL  226 (1055)
Q Consensus       155 ~~~sl~~~~~---~~~~~~mHdl~~dla~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~l~~~~  226 (1055)
                      +.++|++..+   ....|+|||+|||||.++++     +|.+++ ..+.+..+.+....+..+|++++.++.+..++...
T Consensus       464 V~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv-~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~  542 (889)
T KOG4658|consen  464 VRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIV-SDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSS  542 (889)
T ss_pred             HHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEE-ECCcCccccccccchhheeEEEEeccchhhccCCC
Confidence            9999998764   44789999999999999999     666333 22234444555556788999999999999999998


Q ss_pred             CCCCccEEEccCCCCCCCCCcChhhhcCCCCCcEEEccCC-CCCcCCcccccCcCCcEEEccCCCCCCC-cccCCCCCCC
Q 001553          227 ECPQLELLLLSSEHSSVDVNIPQRFFTGMRELKVVDLTNM-QLFSLPSSIDLLVNLQTLCLDYSTLGDI-TIIGKLKNLE  304 (1055)
Q Consensus       227 ~~~~Lr~L~l~~~~~~~~~~l~~~~~~~l~~Lr~L~L~~~-~i~~lp~~i~~L~~Lr~L~L~~~~i~~l-~~i~~L~~L~  304 (1055)
                      .+++|++|.+.+|.. ....++..+|..+++||||||++| .+.++|++|++|.|||||+++++.++.+ .++++|+.|+
T Consensus       543 ~~~~L~tLll~~n~~-~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~  621 (889)
T KOG4658|consen  543 ENPKLRTLLLQRNSD-WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLI  621 (889)
T ss_pred             CCCccceEEEeecch-hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhh
Confidence            899999999999863 112788889999999999999976 5678999999999999988888876655 5555555555


Q ss_pred             EEEeeCCC-CcccchhhcCCCCCcEEeccc
Q 001553          305 ILSLIESD-IVEFPEELGKLTKLRLLDLTN  333 (1055)
Q Consensus       305 ~L~L~~~~-l~~lp~~i~~L~~L~~L~l~~  333 (1055)
                      +|++..+. +..+|..+..|.+||+|.+..
T Consensus       622 ~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~  651 (889)
T KOG4658|consen  622 YLNLEVTGRLESIPGILLELQSLRVLRLPR  651 (889)
T ss_pred             eeccccccccccccchhhhcccccEEEeec
Confidence            55555542 223333334455555555444

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1055
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	1e-24
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	4e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-11
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-10
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-07
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-09
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-09
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	4e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	6e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	8e-08
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	5e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	2e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	3e-05
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	3e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	6e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	4e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	6e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-04

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

 Score =  108 bits (271), Expect = 1e-24
 Identities = 25/200 (12%), Positives = 58/200 (29%), Gaps = 10/200 (5%)

Query: 1   MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALR 60
             +     +  L  +E +   E       +  + +      ++   G P  +    K+  
Sbjct: 282 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 341

Query: 61  NKTESECWKNALHELRMPTENNFHRELGKAY----TAIKLSYDALKGEQLKKIFQLCSLM 116
            KT  +      ++L              +Y     A++   + L  E  +       +M
Sbjct: 342 PKTFEK-MAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDE-DRSALAFAVVM 399

Query: 117 PKSF-FASDLFKYCIGLGIFRGIDMEDARNKLYTLVHELKDSCLLLEG--YSCREFSMHD 173
           P        L+   I + I    + E   +++   +  L     LL G       F +  
Sbjct: 400 PPGVDIPVKLWSCVIPVDIC-SNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDH 458

Query: 174 VVHDVAILIACGEQKEFLVR 193
           ++H     +   +     + 
Sbjct: 459 IIHMFLKHVVDAQTIANGIS 478

PyMOL of 2a5y

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1055
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	7e-12
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	1e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.001
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 64.8 bits (157), Expect = 7e-12
 Identities = 14/112 (12%), Positives = 32/112 (28%), Gaps = 9/112 (8%)

Query: 1   MGSEANFSIEILNEEEAWRLFEVKLGNDDLIPRMKSTATHIVKECGGLPIAIEPIAKALR 60
             +     +  L  +E +   E       +  + +      ++   G P  +    K+  
Sbjct: 174 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 233

Query: 61  NKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQL 112
            KT  E      ++L                     SY +L    L++  ++
Sbjct: 234 PKTF-EKMAQLNNKLESRGLVGVEC-------ITPYSYKSL-AMALQRCVEV 276

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1055
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.95
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.95
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.87
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.87
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.87
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.87
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.85
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.83
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.82
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.82
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.81
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.8
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.8
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.8
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.79
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.78
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.77
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.77
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.73
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.63
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.6
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.59
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.58
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.56
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.55
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.55
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.54
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.52
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.34
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.31
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.3
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.29
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.16
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.11
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.89
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.03
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.92
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.41
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.52

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.95  E-value=8e-25  Score=154.06  Aligned_cols=82  Identities=26%  Similarity=0.304  Sum_probs=41.6

Q ss_pred             CCCCCCCEEECCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCHHHHCCCCCCCEEE
Q ss_conf             06868759982388999974447888888998117989645222139998768841068889974833427999988999
Q 001553          276 DLLVNLQTLCLDYSTLGDITIIGKLKNLEILSLIESDIVEFPEELGKLTKLRLLDLTNCFHLKVIAPNVIASFTRLEELY  355 (1055)
Q Consensus       276 ~~L~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~~~~~l~~L~~L~~L~  355 (1055)
                      ..+.+|++|+++++.+..++++..+++|++|++++|.++.+|. ++++++|++|++++| .+..+++  ++.+++|+.|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~~--l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADITP--LANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCGG--GTTCTTCCEEE
T ss_pred             HHHCCCCEEECCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCCC-CCCCCCC--CCCCCCCCCCC
T ss_conf             8957878998999898776242458999989681881798863-347711010301343-3322221--11233433344


Q ss_pred             CCCCCC
Q ss_conf             215756
Q 001553          356 MSNCFV  361 (1055)
Q Consensus       356 l~~~~~  361 (1055)
                      +.++..
T Consensus       117 ~~~~~~  122 (384)
T d2omza2         117 LFNNQI  122 (384)
T ss_dssp             CCSSCC
T ss_pred             CCCCCC
T ss_conf             332222

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure