Citrus Sinensis ID: 001670
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1034 | ||||||
| 225454979 | 1057 | PREDICTED: structural maintenance of chr | 0.987 | 0.965 | 0.710 | 0.0 | |
| 255539813 | 1058 | structural maintenance of chromosomes 6 | 0.988 | 0.965 | 0.697 | 0.0 | |
| 297744975 | 1027 | unnamed protein product [Vitis vinifera] | 0.958 | 0.964 | 0.719 | 0.0 | |
| 224071509 | 1046 | predicted protein [Populus trichocarpa] | 0.961 | 0.950 | 0.694 | 0.0 | |
| 449458365 | 1052 | PREDICTED: structural maintenance of chr | 0.975 | 0.959 | 0.688 | 0.0 | |
| 449519372 | 969 | PREDICTED: LOW QUALITY PROTEIN: structur | 0.930 | 0.992 | 0.683 | 0.0 | |
| 15240258 | 1057 | protein MIM [Arabidopsis thaliana] gi|10 | 0.973 | 0.952 | 0.642 | 0.0 | |
| 297797105 | 1057 | hypothetical protein ARALYDRAFT_496305 [ | 0.973 | 0.952 | 0.645 | 0.0 | |
| 15240835 | 1058 | structural maintenance of chromosomes 6A | 0.984 | 0.962 | 0.609 | 0.0 | |
| 5880614 | 1055 | SMC-like protein [Arabidopsis thaliana] | 0.969 | 0.949 | 0.622 | 0.0 |
| >gi|225454979|ref|XP_002278113.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1478 bits (3827), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 728/1024 (71%), Positives = 871/1024 (85%), Gaps = 3/1024 (0%)
Query: 1 MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILT 60
MGD ++ RS AG I ++RLENFMCHSSLQIELGEW+NF+TGQNGSGKSAILT
Sbjct: 1 MGDSTVFTQPLSASHRSSAGIILKIRLENFMCHSSLQIELGEWLNFVTGQNGSGKSAILT 60
Query: 61 ALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRIT 120
ALC+AFG RAK TQRA TLK+FIKTGCSYA+++VE+KN GEDAFKPEI+GD II+ERRI+
Sbjct: 61 ALCVAFGSRAKETQRATTLKEFIKTGCSYAVIQVEIKNEGEDAFKPEIYGDVIIVERRIS 120
Query: 121 ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180
STS+TVLKDHQGKRVASRK++L EL++HFNIDVENPCVIMSQDKSREFLHSGNDKDKFK
Sbjct: 121 VSTSSTVLKDHQGKRVASRKEDLHELVEHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180
Query: 181 FFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEIT 240
FFFKATLLQQVNDLL +I L+ + LV ELE +I+P KEL+ELQ KIRNMEHVEEI+
Sbjct: 181 FFFKATLLQQVNDLLVNIGTRLDSANTLVEELEKSIEPILKELNELQVKIRNMEHVEEIS 240
Query: 241 QDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKK 300
Q +Q+LKKKLAWSWVYDVDRQL+EQ+ KIEKLKDRIP CQA+ID + +E LR+C KK
Sbjct: 241 QQVQQLKKKLAWSWVYDVDRQLQEQSAKIEKLKDRIPTCQARIDRQLGKMEELRECLTKK 300
Query: 301 KAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQV 360
K +IA M+EKT+EVRR K++LQQ +SLATKE+LELE E R T+ +QKMVN V+ L+QQV
Sbjct: 301 KTQIACMMEKTTEVRRMKEDLQQRLSLATKERLELEEEHCRKTNKIQKMVNLVRRLDQQV 360
Query: 361 HDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRI 420
H++ EQ ++NTQAEESEI+ LK LQ E+D N+ LSR+KEE+SALS LS + +EIR+I
Sbjct: 361 HEVHEQDLKNTQAEESEIKEMLKGLQDELDTTNLILSRLKEEESALSASLSIKMDEIRKI 420
Query: 421 SDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIG 480
SDEI+DY++K RE S I ELQQHQTNKVTAFGGDRVI LLRAIERHH +FK PPIGPIG
Sbjct: 421 SDEIDDYERKHRENYSYICELQQHQTNKVTAFGGDRVIQLLRAIERHHQRFKRPPIGPIG 480
Query: 481 SHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPR 540
+H+TLVNGD WA AVE AIG++LNAFIVTDHKD+LLLRGCAREANYNHLQIIIYDFSRPR
Sbjct: 481 AHLTLVNGDIWAIAVEIAIGKMLNAFIVTDHKDSLLLRGCAREANYNHLQIIIYDFSRPR 540
Query: 541 LSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISN 600
L++P+HMLP T+HPT +S L SDNPTV+NVLVDMG+AERQVLVRDY+VGK VAF+QRI N
Sbjct: 541 LNIPYHMLPQTQHPTLISALHSDNPTVMNVLVDMGNAERQVLVRDYEVGKTVAFDQRIPN 600
Query: 601 LKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRK 660
LKEVYT DG++MFSRGSVQTILP N++ RTGRLC S+D +IKDLER AL +QE Q+ ++
Sbjct: 601 LKEVYTSDGYRMFSRGSVQTILPPNKKARTGRLCSSFDSQIKDLERYALDIQEHGQEVKR 660
Query: 661 RKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEIS 720
+KR++EE LQDLQ Q++KRR +AER+ MSK+L QDVKNS+ A++ P AS+VDE+
Sbjct: 661 KKRNAEEELQDLQDKLQSIKRRRLNAERDVMSKKLRLQDVKNSYVAESNPAPASSVDELH 720
Query: 721 QEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELM 780
EIS +Q EI+EKEI+LE Q M++A+AK DLKLSF++LCESAK E+D +EAAE EL+
Sbjct: 721 HEISKVQAEIREKEILLEDFQLRMSKADAKANDLKLSFENLCESAKVEIDAYEAAENELV 780
Query: 781 EIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEA 840
IE+ L ++E+EK HYE +M +V+ IKEAE+QY+ELE R++SCRKAS+ICPESEIEA
Sbjct: 781 VIEQELCSAETEKTHYEGIMNNKVLPDIKEAETQYQELEHNRKESCRKASIICPESEIEA 840
Query: 841 LGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFRE 900
LGG STPEQLSAQ+NRLNQRL+ ES +Y+E IEDLRM+Y++KE +ILRKQQTY+AFRE
Sbjct: 841 LGGCK-STPEQLSAQLNRLNQRLQSESQRYAEPIEDLRMIYDKKERRILRKQQTYEAFRE 899
Query: 901 KVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMP 960
K+ AC+EALD RW KFQRNATLLKRQLTWQFN HL KKGISG I ++YEEKTLS+EVKMP
Sbjct: 900 KLNACKEALDLRWSKFQRNATLLKRQLTWQFNAHLRKKGISGHIKVSYEEKTLSVEVKMP 959
Query: 961 QDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFM--VSFYINYVFS 1018
QDAS++ VRDTRGLSGGERSFSTLCFALALHEMTE+PFRAMDEFDVFM VS I+
Sbjct: 960 QDASNNIVRDTRGLSGGERSFSTLCFALALHEMTESPFRAMDEFDVFMDAVSRKISLDTL 1019
Query: 1019 IDFS 1022
++F+
Sbjct: 1020 VNFA 1023
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255539813|ref|XP_002510971.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] gi|223550086|gb|EEF51573.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297744975|emb|CBI38567.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224071509|ref|XP_002303494.1| predicted protein [Populus trichocarpa] gi|222840926|gb|EEE78473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449458365|ref|XP_004146918.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449519372|ref|XP_004166709.1| PREDICTED: LOW QUALITY PROTEIN: structural maintenance of chromosomes protein 6-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15240258|ref|NP_200954.1| protein MIM [Arabidopsis thaliana] gi|10177176|dbj|BAB10445.1| SMC-like protein [Arabidopsis thaliana] gi|332010088|gb|AED97471.1| protein MIM [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797105|ref|XP_002866437.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] gi|297312272|gb|EFH42696.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15240835|ref|NP_196383.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] gi|9759587|dbj|BAB11444.1| SMC-like protein [Arabidopsis thaliana] gi|332003807|gb|AED91190.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|5880614|gb|AAD54769.1|AF120932_1 SMC-like protein [Arabidopsis thaliana] gi|5880616|gb|AAD54770.1|AF120933_1 SMC-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1034 | ||||||
| TAIR|locus:2161163 | 1057 | MIM "AT5G61460" [Arabidopsis t | 0.972 | 0.951 | 0.619 | 0.0 | |
| TAIR|locus:2160289 | 1058 | SMC6A "structural maintenance | 0.984 | 0.962 | 0.589 | 0.0 | |
| ZFIN|ZDB-GENE-070705-287 | 1090 | si:dkey-119f1.1 "si:dkey-119f1 | 0.924 | 0.877 | 0.289 | 3e-101 | |
| UNIPROTKB|E1BFH7 | 1101 | SMC6 "Uncharacterized protein" | 0.925 | 0.869 | 0.273 | 4.5e-98 | |
| UNIPROTKB|F1SCS4 | 1098 | SMC6 "Uncharacterized protein" | 0.924 | 0.870 | 0.273 | 9.4e-98 | |
| RGD|1311214 | 1097 | Smc6 "structural maintenance o | 0.924 | 0.871 | 0.270 | 2e-97 | |
| UNIPROTKB|Q96SB8 | 1091 | SMC6 "Structural maintenance o | 0.923 | 0.875 | 0.270 | 5.2e-97 | |
| MGI|MGI:1914491 | 1097 | Smc6 "structural maintenance o | 0.924 | 0.871 | 0.270 | 6.6e-97 | |
| UNIPROTKB|E2QUA0 | 1097 | SMC6 "Uncharacterized protein" | 0.925 | 0.872 | 0.269 | 1.1e-96 | |
| UNIPROTKB|Q6P9I7 | 1128 | smc6 "Structural maintenance o | 0.934 | 0.856 | 0.259 | 5.9e-96 |
| TAIR|locus:2161163 MIM "AT5G61460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3187 (1126.9 bits), Expect = 0., P = 0.
Identities = 626/1011 (61%), Positives = 782/1011 (77%)
Query: 15 QRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQ 74
QRSG+G+I R+++ENFMCHS+LQIE GEWVNFITGQNGSGKSAILTALC+AFGCRA+GTQ
Sbjct: 15 QRSGSGSILRIKVENFMCHSNLQIEFGEWVNFITGQNGSGKSAILTALCVAFGCRARGTQ 74
Query: 75 RAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGK 134
RAATLKDFIKTGCSYA+V+VE+KN GEDAFKPEI+G IIIERRITES + TVLKD+ GK
Sbjct: 75 RAATLKDFIKTGCSYAVVQVEMKNSGEDAFKPEIYGGVIIIERRITESATATVLKDYLGK 134
Query: 135 RVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNXXXXXXXXXXATLLQQVNDL 194
+V++++ EL EL++HFNIDVENPCV+MSQDKSREFLHSGN ATLLQQVNDL
Sbjct: 135 KVSNKRDELRELVEHFNIDVENPCVVMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDL 194
Query: 195 LQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSW 254
LQSIY HL K A+V ELE TIKP EKE+SEL+ KI+NME VEEI Q LQ+LKKKLAWSW
Sbjct: 195 LQSIYEHLTKATAIVDELENTIKPIEKEISELRGKIKNMEQVEEIAQRLQQLKKKLAWSW 254
Query: 255 VYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEV 314
VYDVDRQL+EQT KI KLK+RIP CQAKID +ESLRD KKKA++A ++++++ +
Sbjct: 255 VYDVDRQLQEQTEKIVKLKERIPTCQAKIDWELGKVESLRDTLTKKKAQVACLMDESTAM 314
Query: 315 RRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAE 374
+R + QS A +EK+ L+ E +Y+QK+ +RV+ LE+QV DI EQ ++NTQAE
Sbjct: 315 KREIESFHQSAKTAVREKIALQEEFNHKCNYVQKIKDRVRRLERQVGDINEQTMKNTQAE 374
Query: 375 ESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREI 434
+SEIE KLK L+ E++ SR+KEE++ EK + + ++ I D I+++ K+ R I
Sbjct: 375 QSEIEEKLKYLEQEVEKVETLRSRLKEEENCFLEKAFEGRKKMEHIEDMIKNHQKRQRFI 434
Query: 435 RSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPA 494
S I +L++HQTNKVTAFGGDRVI+LL+AIER+H +F+ PPIGPIGSHVTLVNG+ WA +
Sbjct: 435 TSNINDLKKHQTNKVTAFGGDRVINLLQAIERNHRRFRKPPIGPIGSHVTLVNGNKWASS 494
Query: 495 VEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHP 554
VEQA+G LLNAFIVTDHKD+L LRGCA EANY +L+IIIYDFSRPRL++P HM+P T+HP
Sbjct: 495 VEQALGTLLNAFIVTDHKDSLTLRGCANEANYRNLKIIIYDFSRPRLNIPRHMVPQTEHP 554
Query: 555 TTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFS 614
T SV+ SDNPTV+NVLVD ERQVL +Y+ GKAVAF +R+SNLKEVYTLDG+KMF
Sbjct: 555 TIFSVIDSDNPTVLNVLVDQSGVERQVLAENYEEGKAVAFGKRLSNLKEVYTLDGYKMFF 614
Query: 615 RGSVQTILP-LNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQ 673
RG VQT LP L+RR RLC S+D++IKDLE A Q E QC +RKR++EE L++L+
Sbjct: 615 RGPVQTTLPPLSRR--PSRLCASFDDQIKDLEIEASKEQNEINQCMRRKREAEENLEELE 672
Query: 674 QHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDXXXXXXXXXXXXXXXX 733
+ +K+ AE+ +KEL D+KN+ AA+ +S+V+
Sbjct: 673 LKVRQLKKHRSQAEKVLTTKELEMHDLKNTVAAEIEALPSSSVNELQREIMKDLEEIDEK 732
Query: 734 XXXXXXXXFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEK 793
+ EAE K L F+++ ESAK E+D FE AE EL +IEK+LQ++E+EK
Sbjct: 733 EAFLEKLQNCLKEAELKANKLTALFENMRESAKGEIDAFEEAENELKKIEKDLQSAEAEK 792
Query: 794 AHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLS 853
HYE++M+ +V+ IK AE+ Y EL+ R++S +KAS ICPESEIE+LG WDGSTPEQLS
Sbjct: 793 IHYENIMKNKVLPDIKNAEANYEELKNKRKESDQKASEICPESEIESLGPWDGSTPEQLS 852
Query: 854 AQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRW 913
AQ+ R+NQRL E+ Q+SESI+DLRM+YE E KI +K+++YQ REK+ AC+ ALDSRW
Sbjct: 853 AQITRMNQRLHRENQQFSESIDDLRMMYESLERKIAKKRKSYQDHREKLMACKNALDSRW 912
Query: 914 GKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASSSNVRDTRG 973
KFQRNA+LL+RQLTWQFN HLGKKGISG I ++YE KTLSIEVKMPQDA+S+ VRDT+G
Sbjct: 913 AKFQRNASLLRRQLTWQFNAHLGKKGISGHIKVSYENKTLSIEVKMPQDATSNVVRDTKG 972
Query: 974 LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFM--VSFYINYVFSIDFS 1022
LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFM VS I+ +DF+
Sbjct: 973 LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAVSRKISLDALVDFA 1023
|
|
| TAIR|locus:2160289 SMC6A "structural maintenance of chromosomes 6A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-287 si:dkey-119f1.1 "si:dkey-119f1.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BFH7 SMC6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCS4 SMC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1311214 Smc6 "structural maintenance of chromosomes 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96SB8 SMC6 "Structural maintenance of chromosomes protein 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914491 Smc6 "structural maintenance of chromosomes 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUA0 SMC6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P9I7 smc6 "Structural maintenance of chromosomes protein 6" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_III0304 | hypothetical protein (1046 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1034 | |||
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 3e-47 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-36 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-25 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-23 | |
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 4e-22 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-21 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-20 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 3e-19 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-16 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 2e-13 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 4e-13 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 8e-13 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-12 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-11 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 3e-10 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 9e-10 | |
| cd03241 | 276 | cd03241, ABC_RecN, ATP-binding cassette domain of | 2e-09 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 1e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-07 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 1e-07 | |
| COG1195 | 363 | COG1195, RecF, Recombinational DNA repair ATPase ( | 1e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-07 | |
| PRK00064 | 361 | PRK00064, recF, recombination protein F; Reviewed | 6e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 9e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-06 | |
| TIGR00611 | 365 | TIGR00611, recf, recF protein | 8e-06 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 8e-06 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 1e-05 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 1e-05 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| PTZ00491 | 850 | PTZ00491, PTZ00491, major vault protein; Provision | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 4e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-05 | |
| pfam01496 | 707 | pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni | 5e-05 | |
| cd03242 | 270 | cd03242, ABC_RecF, ATP-binding cassette domain of | 8e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| cd03279 | 213 | cd03279, ABC_sbcCD, ATP-binding cassette domain of | 3e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 3e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 5e-04 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 6e-04 | |
| COG3593 | 581 | COG3593, COG3593, Predicted ATP-dependent endonucl | 6e-04 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 9e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 0.001 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.001 | |
| COG1106 | 371 | COG1106, COG1106, Predicted ATPases [General funct | 0.001 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 0.001 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.002 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.002 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 0.004 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.004 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.004 |
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
Score = 167 bits (424), Expect = 3e-47
Identities = 58/155 (37%), Positives = 68/155 (43%), Gaps = 52/155 (33%)
Query: 22 ITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKD 81
I + L+NFMCH LQIE G VNFI G NGSGKSAILTAL I G +A T R ++LKD
Sbjct: 1 IESITLKNFMCHRHLQIEFGPRVNFIVGNNGSGKSAILTALTIGLGGKASDTNRGSSLKD 60
Query: 82 FIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQ 141
IK G S A + V LKN+G DA
Sbjct: 61 LIKDGESSAKITVTLKNQGLDA-------------------------------------- 82
Query: 142 ELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDK 176
NP ++SQD +R FL S
Sbjct: 83 --------------NPLCVLSQDMARSFLTSNKAA 103
|
The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18). Length = 198 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213208 cd03241, ABC_RecN, ATP-binding cassette domain of RecN | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|224116 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234608 PRK00064, recF, recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233051 TIGR00611, recf, recF protein | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240439 PTZ00491, PTZ00491, major vault protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family | Back alignment and domain information |
|---|
| >gnl|CDD|213209 cd03242, ABC_RecF, ATP-binding cassette domain of RecF | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|226121 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|224031 COG1106, COG1106, Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1034 | |||
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 100.0 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 100.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 100.0 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 100.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 99.98 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.96 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 99.96 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 99.94 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.93 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.92 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.92 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.91 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.9 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.89 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.89 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.89 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.86 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.84 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.84 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.84 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.83 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.83 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.8 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.79 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.78 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.75 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.75 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.75 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.75 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.74 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.73 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 99.73 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.71 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.71 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.69 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.68 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.68 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.64 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.63 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.63 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.61 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.59 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 99.58 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 99.58 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.58 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.54 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.51 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.5 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.5 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.47 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.41 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.35 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.34 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.32 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.27 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.23 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.2 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.2 | |
| PF11398 | 373 | DUF2813: Protein of unknown function (DUF2813); In | 99.1 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 99.08 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.99 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.95 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.86 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.84 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.74 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.73 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.6 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 98.59 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 98.58 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.58 | |
| COG3593 | 581 | Predicted ATP-dependent endonuclease of the OLD fa | 98.57 | |
| PF04310 | 227 | MukB: MukB N-terminal; InterPro: IPR007406 This is | 98.56 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.55 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.55 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.53 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 98.45 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.44 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.43 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.39 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.32 | |
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 98.28 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.24 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.19 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.16 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.15 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.11 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.11 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.09 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.03 | |
| COG4938 | 374 | Uncharacterized conserved protein [Function unknow | 98.03 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.99 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 97.99 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.97 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 97.97 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 97.94 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.93 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.92 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 97.92 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.91 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.9 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.88 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.86 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 97.8 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.8 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.8 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.77 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.77 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.77 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.76 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.74 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.7 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.7 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.69 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.68 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.65 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.65 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.65 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 97.64 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 97.63 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.63 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.63 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.63 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.62 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.61 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.61 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.61 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.6 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.6 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.59 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.58 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.58 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.58 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 97.58 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 97.57 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.57 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.57 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 97.56 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.56 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.56 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.56 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 97.55 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.54 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 97.54 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.53 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.53 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 97.53 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 97.53 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.53 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.52 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 97.52 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.51 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.51 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 97.51 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.51 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.51 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.5 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.5 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.5 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.5 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.5 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 97.5 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.5 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 97.49 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.49 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.49 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.49 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.49 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 97.49 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.48 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.48 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 97.48 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 97.48 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 97.48 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.47 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.47 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.47 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.47 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.47 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.47 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.47 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.47 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 97.46 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 97.46 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 97.46 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.46 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.46 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.45 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.45 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.45 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 97.45 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 97.45 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 97.45 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.45 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.45 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.45 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 97.45 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 97.45 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.44 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.44 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.44 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.44 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.44 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 97.44 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.44 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.44 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 97.44 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.43 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.43 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 97.42 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 97.42 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 97.42 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.42 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 97.42 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 97.41 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 97.41 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.41 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 97.41 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 97.41 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.4 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 97.4 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 97.4 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.4 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 97.4 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 97.39 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.39 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.39 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.39 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 97.39 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 97.39 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 97.39 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.38 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.38 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.38 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 97.38 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.38 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.38 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 97.38 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.37 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.37 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.37 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.37 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.37 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.36 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.36 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 97.36 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 97.36 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.36 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 97.36 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.36 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 97.36 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.36 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.36 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.36 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.36 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.36 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.35 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 97.35 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 97.35 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 97.35 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 97.35 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.35 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 97.35 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 97.34 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 97.34 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 97.34 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 97.34 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 97.34 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 97.34 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.33 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 97.33 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.33 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 97.33 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 97.33 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.33 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.33 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.32 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.32 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 97.32 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.32 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.32 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.32 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 97.31 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.31 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.31 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.31 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 97.31 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 97.3 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.3 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 97.3 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.29 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 97.29 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 97.29 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 97.29 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 97.29 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 97.28 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.28 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 97.28 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 97.28 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.28 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.28 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 97.28 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 97.28 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 97.28 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.27 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.27 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.27 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 97.27 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.27 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 97.27 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 97.27 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 97.26 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 97.25 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 97.25 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 97.25 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.25 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.25 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 97.24 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.24 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.24 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 97.24 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 97.24 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 97.23 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 97.23 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.23 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 97.22 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.22 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 97.22 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 97.21 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.21 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 97.21 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 97.2 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 97.19 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.19 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 97.18 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.17 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 97.17 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.16 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.16 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 97.16 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 97.15 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 97.15 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.14 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.14 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 97.14 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.14 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.13 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.13 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.13 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 97.13 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 97.12 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.12 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 97.11 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.11 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.1 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.1 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.09 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 97.09 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 97.09 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 97.08 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.07 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.07 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 97.07 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.05 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 97.04 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.03 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.03 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.03 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 97.03 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.02 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.01 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 97.01 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.0 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 97.0 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 96.99 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 96.99 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.98 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 96.97 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.96 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.96 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 96.95 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 96.95 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 96.94 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.93 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 96.93 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 96.93 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.93 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 96.92 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.92 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 96.91 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 96.91 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 96.91 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.9 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.9 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.9 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 96.89 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.89 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.89 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 96.88 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 96.87 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.86 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 96.86 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.84 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.84 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.83 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 96.82 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.82 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 96.81 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 96.8 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.8 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 96.79 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 96.79 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 96.77 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.74 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.73 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 96.72 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 96.71 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 96.71 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 96.7 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.69 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 96.67 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.67 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 96.67 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 96.66 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 96.66 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.66 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 96.65 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 96.65 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 96.65 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.63 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 96.62 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 96.62 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.62 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 96.62 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 96.61 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 96.59 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 96.57 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.57 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 96.52 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 96.52 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 96.51 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.51 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 96.5 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.5 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.5 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 96.49 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 96.49 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 96.47 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 96.47 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.47 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 96.46 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 96.45 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 96.44 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.42 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 96.41 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 96.39 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 96.39 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 96.39 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 96.39 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 96.38 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 96.37 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.36 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 96.36 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.35 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.34 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 96.34 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 96.32 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.32 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 96.32 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 96.32 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 96.32 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.31 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 96.31 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 96.31 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 96.31 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.3 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 96.3 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 96.29 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.29 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 96.29 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 96.28 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 96.27 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 96.27 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.26 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 96.25 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 96.25 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.25 |
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.4e-110 Score=898.15 Aligned_cols=1005 Identities=37% Similarity=0.592 Sum_probs=858.6
Q ss_pred CCCCceeEeEEEEEeccccccceeEcCCCeEEEEcCCCCCHHHHHHHHHHHcCCCcCCcccccchhhhhhcCCceEEEEE
Q 001670 15 QRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEV 94 (1034)
Q Consensus 15 ~~~~~~~i~~i~l~nf~~~~~~~i~f~~~~~~I~G~NGsGKSti~~ai~~~Lg~~~~~~~r~~~~~~~i~~g~~~a~v~l 94 (1034)
+....|+|.+|+|.|||||.+..|+|+|.+|+|+|+||||||+||.||+.|||++++.+.||+++++||++|+++|.|.|
T Consensus 35 ~~~~sG~I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsI 114 (1074)
T KOG0250|consen 35 QRAESGKIESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISI 114 (1074)
T ss_pred hhhhcceEEEEEEeeecccccceeccCCCceEeecCCCCcHHHHHHHHHHhhccccccccchhhHHHHHhCCCcceEEEE
Confidence 44456999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEecCCCCCCcccCCCeEEEEEEee-cCcceEEEecCCCCcccccHHHHHHHHhhcCCCcCCCeeeecchhhHHhhhcC
Q 001670 95 ELKNRGEDAFKPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSG 173 (1034)
Q Consensus 95 ~~~~~~~~~~~~~~~~~~~~i~R~~~-~~~~~~~i~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~q~~~~~~l~~~ 173 (1034)
++.|.|.++|.|++||+.|+|.|+|. +++..|..++.+|++|+.+..|+..++.+|||+++||++||+|+.+++||...
T Consensus 115 tL~N~G~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~I~veNP~~~lsQD~aR~FL~~~ 194 (1074)
T KOG0250|consen 115 TLSNSGLDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFNIQVENPMFVLSQDAARSFLANS 194 (1074)
T ss_pred EEecCCcccCChhhcCCeeEEEEeeccccchHHHHhhccCccccccHHHHHHHHHHhCcCCCCcchhhcHHHHHHHHhcC
Confidence 99999999999999999999999999 55554445578999999999999999999999999999999999999999999
Q ss_pred CchhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhH
Q 001670 174 NDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWS 253 (1034)
Q Consensus 174 ~~~~~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 253 (1034)
.|.+.|++|+.++.|+++...+..+.+.+......+...+..+..+++++...++.+..++..+.+...+..+..++.|.
T Consensus 195 ~p~dkYklfmkaT~L~qi~~~~~~~~~~~~~~~~~i~~~~e~i~~l~k~i~e~~e~~~~~~~~e~~~~~l~~Lk~k~~W~ 274 (1074)
T KOG0250|consen 195 NPKDKYKLFMKATQLEQITESYSEIMESLDHAKELIDLKEEEIKNLKKKIKEEEEKLDNLEQLEDLKENLEQLKAKMAWA 274 (1074)
T ss_pred ChHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001670 254 WVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKL 333 (1034)
Q Consensus 254 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 333 (1034)
.+.....++..+...+...+.....+++.++.....+..+...+.+.++++..+.........++..+...+..+..+..
T Consensus 275 ~V~~~~~ql~~~~~~i~~~qek~~~l~~ki~~~~~k~~~~r~k~teiea~i~~~~~e~~~~d~Ei~~~r~~~~~~~re~~ 354 (1074)
T KOG0250|consen 275 WVNEVERQLNNQEEEIKKKQEKVDTLQEKIEEKQGKIEEARQKLTEIEAKIGELKDEVDAQDEEIEEARKDLDDLRREVN 354 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999988888888888899999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHH
Q 001670 334 ELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKE 413 (1034)
Q Consensus 334 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 413 (1034)
+++..+....+.+...+..+..+++.+..+.++.......++.+.+.++..+..+++.++..+..+..+.+.+..++...
T Consensus 355 ~~~~~~~~~~n~i~~~k~~~d~l~k~I~~~~~~~~~~~~~~~~e~e~k~~~L~~evek~e~~~~~L~~e~~~~~~~~~~~ 434 (1074)
T KOG0250|consen 355 DLKEEIREIENSIRKLKKEVDRLEKQIADLEKQTNNELGSELEERENKLEQLKKEVEKLEEQINSLREELNEVKEKAKEE 434 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999988876777788888899999999999999999999999999999999999
Q ss_pred HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhcCCccccCCcccHHHHHHHHHhhccCCCCCCccccccceeccCCCChHH
Q 001670 414 KNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAP 493 (1034)
Q Consensus 414 ~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~g~~~~~i~~~~~~~~~~ 493 (1034)
+.+...+...+..++..+......++.+.....+.+..|+ +.++.++..|......|..+|.||+|.+|.+.+ ++|+.
T Consensus 435 ~ee~~~i~~~i~~l~k~i~~~~~~l~~lk~~k~dkvs~FG-~~m~~lL~~I~r~~~~f~~~P~GPlG~~Vtl~~-~KWa~ 512 (1074)
T KOG0250|consen 435 EEEKEHIEGEILQLRKKIENISEELKDLKKTKTDKVSAFG-PNMPQLLRAIERRKRRFQTPPKGPLGKYVTLKE-PKWAL 512 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhcc-hhhHHHHHHHHHHHhcCCCCCCCCccceeEecC-cHHHH
Confidence 9999999999999999999999999999999999999999 999999999999888888999999999999999 99999
Q ss_pred HHHHHHhccccceeecchhhHHHHHHHHHHhCCCC--ccEEEeecCCCCCCCCCCCCCCCCCCccccceecCcHHHHHHh
Q 001670 494 AVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNH--LQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVL 571 (1034)
Q Consensus 494 aie~~l~~~l~~~vv~~~~~~~~l~~~l~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l 571 (1034)
+|+.+||+.+.+|+|.+..|+..+..+++++.++. +++++..+. +..++.+..|...+|++++.|.+++|.|.++|
T Consensus 513 aIE~~L~n~lnaFiv~sh~D~~~Lr~i~~~~~~~~~~ptIvvs~~~--~~~y~~~~~p~~~~pTil~~le~ddp~V~N~L 590 (1074)
T KOG0250|consen 513 AIERCLGNLLNAFIVTSHKDARILRAIMRRLKIPGNRPTIVVSSFT--PFDYSVGRNPGYEFPTILDALEFDDPEVLNVL 590 (1074)
T ss_pred HHHHHHHHhhhhheeCCHhhHHHHHHHHHHcCCCCCCCcEEEecCC--ccccccccCCCCCCCceeeeeecCChHHHHHh
Confidence 99999999999999999999999999999877653 666666553 33444455555558999999999999999999
Q ss_pred hccCCccEEEEeCChHHHHHHhhhc-CCCCcceEEccCCCeeeecCCcc---cccccccccCCccccCCHHHHHHHHHHH
Q 001670 572 VDMGSAERQVLVRDYDVGKAVAFEQ-RISNLKEVYTLDGHKMFSRGSVQ---TILPLNRRLRTGRLCGSYDEKIKDLERA 647 (1034)
Q Consensus 572 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~i~~l~~~ 647 (1034)
+|..+++..+++.+...|..++... .+.++..++|++|.....+|... ++...... +++.........|..++.+
T Consensus 591 ID~s~iE~~lLiEdk~Ea~~~m~s~~~p~n~~~aytldg~~~~~~g~~~~~ySt~~~~~r-~~~~~~~s~d~~ie~le~e 669 (1074)
T KOG0250|consen 591 IDKSGIEQVLLIEDKKEAREFMQSDKPPANVTKAYTLDGRQIFAGGPNYRVYSTRGTRAR-RPGVDEFSFDDEIEDLERE 669 (1074)
T ss_pred hhhccceeEEEecchHHHHHHHhcCCCCccceeeeccCccccccCCCCcceeccCCCCCC-CccccchhHhHHHHHHHHH
Confidence 9999999999999966666655544 36678899999998776666521 11111111 2345566788899999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCCCCCcchhHHHHHHHHHH
Q 001670 648 ALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEISQEISNIQ 727 (1034)
Q Consensus 648 l~~~~~~l~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~l~ 727 (1034)
+..++.++..+.....+++..++.++..+..+...+.+.+..+.....++.++++.... ...-...++++..++....
T Consensus 670 ~~~l~~~~~~l~~~~~~~e~~l~e~~~~~~~l~~~~~q~~~~~~~~~~em~el~n~~e~--~~~~~~~~~~l~~ei~~~~ 747 (1074)
T KOG0250|consen 670 ASRLQKEILELENQRREAEKNLEELEKKLRELSEHIEQIKRRIRKKRAEMTELKNTAEE--KQVDISKLEDLAREIKKKE 747 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh--hhcchhhhHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999888884111 0001234566666777777
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHhHHHH
Q 001670 728 EEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGA 807 (1034)
Q Consensus 728 ~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 807 (1034)
.+|+.....+.++...+..+..+...+...+......+......+..+..++......+.........++..+ ......
T Consensus 748 ~eIe~~~~~~e~l~~e~e~~~~e~~e~~~~~~~~~~~l~~e~~~l~~l~~el~~r~dk~~s~e~~~~HyE~~~-K~~l~~ 826 (1074)
T KOG0250|consen 748 KEIEEKEAPLEKLKEELEHIELEAQELEEYYAAGREKLQGEISKLDALKEELKLREDKLRSAEDEKRHYEDKL-KSRLEE 826 (1074)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhhhhhhhhHHHHH-HHhhHH
Confidence 7777777778888888888777777777777777766766667777777777766666666555555566555 335556
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhCChh--hhhhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHH
Q 001670 808 IKEAESQYRELELLRQDSCRKASVICPES--EIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKE 885 (1034)
Q Consensus 808 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~e~~~~~~~~~~ 885 (1034)
+...+..+..+...+.+....+...||+. ++..+ +....++...+.++...+..++... .....+...+-...
T Consensus 827 l~~~E~~~~~~e~~~~e~~~ka~~~cp~~~~ei~~~----~~~~~eik~ei~rlk~~i~~~ee~~-~~~~e~~~~~~~~~ 901 (1074)
T KOG0250|consen 827 LKQKEVEKVNLEEPRAEEDQKARTECPEEGIEIEAL----GKTVAEIKREIKRLKRQIQMCEESL-GELEELHRGLHEAR 901 (1074)
T ss_pred HHHHHHHHHhhhcchhhhCchhhhhCccccchhhcc----cchHHHHHHHHHHHHHHHHHHHHhc-chHHHHHHHHHHHh
Confidence 66666677777766666666777777765 33222 3356788888888888888766553 33344444433344
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCceeEEeeccCceeEEEEecCCCCCC
Q 001670 886 HKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASS 965 (1034)
Q Consensus 886 ~~~~~l~~~~~~l~~~i~~l~~~l~~~~~~~~~~~~~i~~~~~~~F~~~~~~~g~~g~~~~~~~~~~l~i~v~~~~~~~~ 965 (1034)
..+.....-+..+.+.+..+...+..+|..|......++......|..+++.+|+.|.+.++|....+++.|++|++...
T Consensus 902 ~~~~k~~~~k~~~~e~L~~l~~~l~~R~~~~qk~r~~~~~~~~~~F~~~l~~R~~sg~l~~~~e~ktl~i~v~~~~~~~~ 981 (1074)
T KOG0250|consen 902 KELKKEDELKVTLDELLKALGEALESREQKYQKFRKLLTRRATEEFDALLGKRGFSGKLEFDHEEKTLSISVKLPTSGNE 981 (1074)
T ss_pred hhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCcceeecccccccchhhccCCCCcc
Confidence 44444444444468888888889999999999999999999999999999999999999999999999999966655545
Q ss_pred CcccCCCCCCcccchHHHHHHHHHhhhhcCCCeeEeehhhhhh--hhHHHHHHHHHHhhcCCCCceEEEe
Q 001670 966 SNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFM--VSFYINYVFSIDFSGYVPCNFFYLV 1033 (1034)
Q Consensus 966 ~~~~~~~~lSGGEks~~~lall~al~~~~~~Pf~vlDEiD~~~--~~~~~~~~~l~~~~~~~~~~q~~~i 1033 (1034)
+++.++..||||||||+|+||++|||.++.|||++|||||||| |||++++++||++|...+ +|||+|
T Consensus 982 ~~v~d~~gLSGGERSFsTv~lllsLW~~me~Pfr~LDEFDVFMD~vNRKi~~dlLv~~a~~~~-~Q~Ifi 1050 (1074)
T KOG0250|consen 982 KAVRDTRGLSGGERSFSTVCLLLSLWEVMECPFRALDEFDVFMDMVNRKISMDLLVDFAKKKG-RQFIFI 1050 (1074)
T ss_pred cccccccccCcccchHHHHHHHHHHhHhhcCchhhhhHHHHHHHHHHHHHHHHHHHHHHHhhc-ceEEEE
Confidence 7799999999999999999999999999999999999999999 999999999999999987 999998
|
|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04310 MukB: MukB N-terminal; InterPro: IPR007406 This is the N-terminal region of MukB | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4938 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1034 | ||||
| 3qku_A | 359 | Mre11 Rad50 Binding Domain In Complex With Rad50 An | 2e-05 | ||
| 1ii8_A | 195 | Crystal Structure Of The P. Furiosus Rad50 Atpase D | 2e-05 | ||
| 3qkt_A | 339 | Rad50 Abc-Atpase With Adjacent Coiled-Coil Region I | 2e-05 | ||
| 3qkr_A | 203 | Mre11 Rad50 Binding Domain Bound To Rad50 Length = | 2e-05 | ||
| 1f2t_A | 149 | Crystal Structure Of Atp-free Rad50 Abc-atpase Leng | 4e-05 | ||
| 1us8_A | 147 | The Rad50 Signature Motif: Essential To Atp Binding | 1e-04 |
| >pdb|3QKU|A Chain A, Mre11 Rad50 Binding Domain In Complex With Rad50 And Amp-Pnp Length = 359 | Back alignment and structure |
|
| >pdb|1II8|A Chain A, Crystal Structure Of The P. Furiosus Rad50 Atpase Domain Length = 195 | Back alignment and structure |
| >pdb|3QKT|A Chain A, Rad50 Abc-Atpase With Adjacent Coiled-Coil Region In Complex With Amp- Pnp Length = 339 | Back alignment and structure |
| >pdb|3QKR|A Chain A, Mre11 Rad50 Binding Domain Bound To Rad50 Length = 203 | Back alignment and structure |
| >pdb|1F2T|A Chain A, Crystal Structure Of Atp-free Rad50 Abc-atpase Length = 149 | Back alignment and structure |
| >pdb|1US8|A Chain A, The Rad50 Signature Motif: Essential To Atp Binding And Biological Function Length = 147 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1034 | |||
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 1e-19 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 5e-04 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 1e-18 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 2e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-15 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 4e-13 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 3e-10 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 1e-09 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 2e-04 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-05 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 8e-06 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 2e-05 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 4e-05 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 5e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-05 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 3e-04 |
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
Score = 91.4 bits (227), Expect = 1e-19
Identities = 50/282 (17%), Positives = 109/282 (38%), Gaps = 22/282 (7%)
Query: 22 ITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKD 81
+ +R+ NF H + +I+ + + I G+NGSGKS+I A+ A G
Sbjct: 5 LKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALF----GAGSNFNYDT 60
Query: 82 FIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQ 141
I G VE++ + G + I R L GK A+
Sbjct: 61 IITKGKKSVYVELDFEVNGNN----------YKIIREYDSGRGGAKLYK-NGKPYATTIS 109
Query: 142 ELLELI-DHFNIDVENP--CVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSI 198
+ + + + +D + + Q + +FL +K + K + + Q +
Sbjct: 110 AVNKAVNEILGVDRNMFLNSIYIKQGEIAKFLSL-KPSEKLETVAKLLGIDEFEKCYQKM 168
Query: 199 YNHLNKGDALVLELEATIKPTEKELSELQRKIRNME-HVEEITQDLQRLKKKLAWSWVYD 257
+ + + + +E + E+ L +++ N+E E++T+ ++ L K
Sbjct: 169 GEIVKEYEKRLERIEGELNYKEESLKARLKEMSNLEKEKEKLTKFVEYLDKVRRIFGRNG 228
Query: 258 VDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMK 299
L+E+ + ++ + ++ D +S +E +D ++
Sbjct: 229 FQAYLREKYV--PLIQKYLNEAFSEFDLPYSFVELTKDFEVR 268
|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Length = 227 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Length = 483 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1034 | ||||
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 1e-18 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 5e-06 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 2e-15 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 8e-14 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 1e-13 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 2e-12 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-08 | |
| d1gxja_ | 161 | d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti | 8e-06 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 87.5 bits (215), Expect = 1e-18
Identities = 34/175 (19%), Positives = 64/175 (36%), Gaps = 16/175 (9%)
Query: 20 GTITRVRLENFMCHSSLQ-IELGEW-VNFITGQNGSGKSAILTALCIAFGCRAKGTQRAA 77
G + + L NF + + + GE I G NGSGKS ++ A+ G R+ R+
Sbjct: 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHL-RSN 59
Query: 78 TLKDFIKTGCSYAMVEVELKNRGEDAFKP---------EIFGDSIIIERRITESTSTTVL 128
LKD I G + N G + P + + + R I+ + T+
Sbjct: 60 ILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYK 119
Query: 129 KDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFF 183
D + ++ +++ NI ++ ++ Q + + F
Sbjct: 120 IDGK----TVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEE 170
|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1034 | |||
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.92 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.83 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.79 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.76 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.64 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.53 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 99.48 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 98.53 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 98.37 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.89 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 97.89 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.74 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.2 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.1 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.0 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.99 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 96.93 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 96.85 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.83 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 96.79 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 96.78 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 96.77 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.73 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.69 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.65 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.63 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.6 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.54 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.35 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.31 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.3 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.11 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.02 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 95.8 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.68 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 95.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.2 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.1 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.79 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.75 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.54 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.53 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.25 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.2 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.03 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 93.82 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 93.62 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.55 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.5 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.48 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.44 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 93.44 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.37 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.04 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 92.99 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.87 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.84 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.81 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.73 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 92.63 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 92.32 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.31 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 92.15 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 92.14 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 92.08 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.03 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.02 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 92.0 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.92 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 91.87 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 91.82 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.69 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.68 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.59 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 91.58 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 91.55 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.54 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 91.34 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 91.29 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.26 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.24 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 91.23 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.17 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 91.15 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 91.05 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 90.79 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 90.61 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.34 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 90.24 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 90.19 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.13 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 89.86 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 89.81 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 89.76 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 89.73 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.57 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 89.46 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 89.41 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 89.4 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 89.31 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.13 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 89.04 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 88.93 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 88.84 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 88.84 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 88.76 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 88.75 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 88.66 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 88.66 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 88.18 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 88.16 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 88.09 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 87.94 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 87.82 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 87.74 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 87.72 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 87.55 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 87.54 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 87.34 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 87.32 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 87.3 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 87.29 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 87.07 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 87.02 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 86.68 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 86.62 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 86.59 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 86.59 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 86.39 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 86.34 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 86.23 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 86.23 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 86.01 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 85.76 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 85.69 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 85.68 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 85.3 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.25 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 84.73 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 84.67 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 84.6 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 84.55 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 84.51 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 84.41 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 84.37 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 84.2 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.15 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 84.12 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 84.04 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 83.92 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 83.82 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 83.58 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 83.52 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 83.46 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 83.42 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 82.99 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 82.99 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 82.87 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 82.78 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 82.58 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 82.51 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 82.44 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 82.42 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 82.28 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.24 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.22 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 82.15 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 82.06 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 81.97 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 81.77 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 81.72 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 81.7 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 81.45 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 81.38 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 81.02 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 80.97 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 80.83 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 80.36 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 80.3 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 80.2 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 80.15 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 80.1 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 80.05 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.92 E-value=2.5e-24 Score=194.46 Aligned_cols=148 Identities=22% Similarity=0.317 Sum_probs=119.1
Q ss_pred EEEEEEEEEECCCCC-CCEEECC-CCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEE
Q ss_conf 167489987122335-6166718-97489985999977899999998707876776654331244441982479999998
Q 001670 20 GTITRVRLENFMCHS-SLQIELG-EWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELK 97 (1034)
Q Consensus 20 ~~i~~i~l~nf~~~~-~~~i~f~-~~~~~I~G~NGsGKSti~~Ai~~~lg~~~~~~~r~~~~~~~i~~g~~~a~v~l~~~ 97 (1034)
|+|++|.|.||+||. .++|+|+ +|+|+|+||||||||||++||+||||.++.. .|+.++.++|+.|...+.+...|.
T Consensus 1 ~ki~~l~l~NFks~~~~~~i~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~-~R~~~~~dli~~g~~~~~~~~~~~ 79 (427)
T d1w1wa_ 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNH-LRSNILKDLIYRGVLNDENSDDYD 79 (427)
T ss_dssp CCEEEEEEESCSSCCSEEEEECTTCSEEEEECSTTSSHHHHHHHHHHHTTC----------CGGGSCCC-----------
T ss_pred CEEEEEEEECEEEECCCEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCHHHEECCCCCCCCEEEEE
T ss_conf 9288999949441079879758999989999999998899999999985778510-023340665246876775128987
Q ss_pred ECCCCCC---------CCCCCCCEEEEEEEEE-CCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEECCHHHH
Q ss_conf 2697777---------7656798089999852-58561898668997100208999999765497767880253213357
Q 001670 98 NRGEDAF---------KPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSR 167 (1034)
Q Consensus 98 ~~~~~~~---------~~~~~~~~~~i~R~~~-~~~~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~ 167 (1034)
+.+.... .....+..+.|.|.+. ++.+.|++ ||+.++ ..++..++..+++...++++++.|+.+.
T Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~~i~i~r~i~~~~~~~~~i---n~~~~~--~~~i~~~~~~~~~~~~~~~~~i~q~~~~ 154 (427)
T d1w1wa_ 80 NEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKI---DGKTVS--YKDYSIFLENENILIKAKNFLVFQGDVE 154 (427)
T ss_dssp --------CCEEEEEEEEEETTEEEEEEEEEETTSCEEEEE---TTEEEC--HHHHHHHHHHTTCCTTTCTTEECTTCTT
T ss_pred EECCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCEEEEC---CCCCCC--HHHHHHHHHHCCCCCCCCCCEECHHHHH
T ss_conf 41233444200011245305892799999972589636702---764442--9999999987087878865242204566
Q ss_pred HHHHCC
Q ss_conf 853059
Q 001670 168 EFLHSG 173 (1034)
Q Consensus 168 ~~l~~~ 173 (1034)
.|+...
T Consensus 155 ~~~~~~ 160 (427)
T d1w1wa_ 155 QIAAQS 160 (427)
T ss_dssp HHHHSC
T ss_pred HHHHCC
T ss_conf 666406
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|