Citrus Sinensis ID: 001700


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020-----
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQSKNSRFTKNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTIVLEKDSQGK
ccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcccccEEEEEccccccEEEcccccccccccccEEEccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccccEEEccccccEEcccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccEEEEcccccccccccEEEccccccEEccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccEEcccccccccccccccEEEccccEEEEcccccccccccccEEEccccccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccccHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccccHHHHHcccccEEEEcccccEEEEEEccccEEEEEEEEccccccccHHHHHHHHHccccccccccEEEEEEcccccEEEEEEcccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccccccEEEccccccEEEcccccccEEEEccccccccccccccccccccccccEEHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccEEccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccc
cEEEEEEEEEHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEcccEEEEEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHcccccEEEEEccccccccccHHHccHHHHHcccEEEcccccccccccHHcccccccccEEEEEcccccccccccccccccccEEEEccccccccccHHHccccccEEEEEEcccccccccccccHccccEEEEcccccccccccHHHccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccccHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEcccccccccccHHHcccccEEEEcccccccccccHHHccccHHHHHHHcccccccccccHHHHHHHHHHHHccccHHccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEccccccccHHHHHHccccEEEcccccEEEEEEcccccEEEEEEcccccccccHHHHHHHHHHcccccccHEEEEEEEcccccccEEEEEEccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccEEccccccccEEEccccccHHHHHHcHHHHEcccccccccEEccccccccHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHHHccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccc
MQTVSLIVLLLVVNALGQSDFEALLQLKKgiakdpsgqiidswdtkslssdgcprnwfgitctngYVTSIMLNdmglvgnfsfpTIIGLKMLCNVSVSnnqlmgnitdigsiqslefldlshnlfhglipsGIVSLKNLMLLNissnsfegtfpsgfgglgklkyldlranrFGGDIMHLLSQLGSVVhvdlsnnqfsgsldlglgdssfiSSIQYLNisenslvgelfphdgmpyfdnlevfdasnnhlvgaipsfnFVFSLRILRLgsnqlsgslpVALLQESSMMLSELDLSlnqlegpvgsitsATLKKVNlssnklsgslparvghctivdlsnnrlsgdlsrmqnwgnyvedIHLSsnfltgmvpnqtsqfLRLTsfkvsnnslegdlpavlgtypelKVIDLSLNhlngfllpsfftstkltdlnlsgnnfsgplplqeiqnnpstgstqnlslTSLDLAYNslsgrllpgiskfHNLVYLNlsnnkfegsipdglpnglkEFNVSFNnlsgvvpenlrnfpdsafhpgnslltfpnspsqqdvpdltlrghgnhmkpaTKIALIVGLVCGVTMVALLCMLIYFRALWqrhgrdsfkrdgeqkafsegssslsqrsgvnkkgdpslssftfhqdplpsspmesaydagetssvvtkpkelyhpdsvrkdeglsspvsllsssnpsqsknsrftknsdvlnacspeklagdlhlfdVSLMFTAEelshapaevigrschgtlykatldsgsILAVKRLREGIAKGKKEFAREVKKLgnikhpnlvslqgyywgpkeHEKLVISNYINAQSLAVYLqetdprklpplsidERLRVAVDVARCLNYlhneraiphgnlkstnilleaptmnavlTDYSLHRILTSAGTADQVLNagalgyrppefastskpcpslksdvYAFGIILLELltgkssgeivcvdpgvvdltDWVRLLALENrsgecfdrlimdghdmeqpprILSDMLQVALRCilpaserpdmmSVFEELSTIVLEKDSQGK
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSsnklsgslparvgHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAfsegssslsqrsgVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSllsssnpsqsknsrftkNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKatldsgsilAVKRLREGIAKGKKEFAREVkklgnikhpnlvSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLhneraiphgnlKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTivlekdsqgk
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQfsgsldlglgdssfissiQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVAllqessmmlseldlslNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAFsegssslsqrsGVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETSSVVTKPKELYHPDSVRKDEGlsspvsllsssnpsqsknsRFTKNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTIVLEKDSQGK
***VSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQ*****************************************LPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLS**************************LTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLR*************************************KPATKIALIVGLVCGVTMVALLCMLIYFRALWQRH*************************************************************************************************************ACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPP*F******CPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPA********VF***************
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFH*************************************IVGLVCGVTMVALLCMLIYFRA**************************SQ********DPSLSSFTFHQDPLP**************************DSVRKDEGLSSPVSLLSSSNPSQSKNSRFT****************DLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGT*DQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEE*************
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGR*******************************SLSSFTFHQDPLP***************VVTKPKELYHPDSVRK*************************KNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTIVLEKDSQGK
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQSKNSRFTKNSD******PEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTI*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQSKNSRFTKNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTIVLEKDSQGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1025 2.2.26 [Sep-21-2011]
Q0WR591048 Probable inactive recepto no no 0.965 0.944 0.432 0.0
C0LGQ91037 Probable LRR receptor-lik no no 0.933 0.922 0.397 0.0
Q9SCT4836 Probably inactive leucine no no 0.304 0.373 0.404 9e-56
C0LGP9784 Probable leucine-rich rep no no 0.288 0.377 0.411 6e-54
Q9LVI6647 Probable inactive recepto no no 0.537 0.851 0.281 5e-52
Q94C77757 Receptor protein kinase-l no no 0.598 0.809 0.284 2e-51
Q9LVP01102 Probable leucine-rich rep no no 0.477 0.443 0.319 4e-47
Q8VZG81045 Probable LRR receptor-lik no no 0.481 0.472 0.317 2e-46
O48788658 Probable inactive recepto no no 0.262 0.408 0.365 2e-44
Q9FZ591088 Leucine-rich repeat recep no no 0.483 0.455 0.310 4e-44
>sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 Back     alignment and function desciption
 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1042 (43%), Positives = 632/1042 (60%), Gaps = 52/1042 (4%)

Query: 13   VNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSS-DGCPRNWFGITC--TNGYVTS 69
             NA+ +++  +LL+ +KGI  + S Q I   DT SL+    CP +W GI+C    G + +
Sbjct: 19   ANAVTETELRSLLEFRKGIRDETSHQRISWSDTSSLTDPSTCPNDWPGISCDPETGSIIA 78

Query: 70   IMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNIT-DIGSIQSLEFLDLSHNLFHGL 128
            I L+  GL G   F T+ GL  L N+S+S N   G +   +G I SL+ LDLS N F+G 
Sbjct: 79   INLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFSGRVVPSLGGISSLQHLDLSDNGFYGP 138

Query: 129  IPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVV 188
            IP  I  L +L  LN+SSN FEG FPSGF  L +L+ LDL  N   GD+  + ++L +V 
Sbjct: 139  IPGRISELWSLNHLNLSSNKFEGGFPSGFRNLQQLRSLDLHKNEIWGDVGEIFTELKNVE 198

Query: 189  HVDLSNNQFSGSLDLGLGDSSFIS-SIQYLNISENSLVGELFPHDGMPYFDNLEVFDASN 247
             VDLS N+F+G L L + + S IS ++++LN+S N+L G+ F  + +  F NLE+ D  N
Sbjct: 199  FVDLSCNRFNGGLSLPMENISSISNTLRHLNLSHNALNGKFFSEESIGSFKNLEIVDLEN 258

Query: 248  NHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSIT 307
            N + G +P F    SLRIL+L  N+L G +P  LLQ SS+ L ELDLS N   G +  I 
Sbjct: 259  NQINGELPHFGSQPSLRILKLARNELFGLVPQELLQ-SSIPLLELDLSRNGFTGSISEIN 317

Query: 308  SATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLT 367
            S+TL  +NLSSN LSG LP+    C+++DLS N  SGD+S +Q W    + + LSSN L+
Sbjct: 318  SSTLTMLNLSSNGLSGDLPSSFKSCSVIDLSGNTFSGDVSVVQKWEATPDVLDLSSNNLS 377

Query: 368  GMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTK 427
            G +PN TS F RL+   + NNS+ G LP++ G   +  VIDLS N  +GF+  SFFT   
Sbjct: 378  GSLPNFTSAFSRLSVLSIRNNSVSGSLPSLWGD-SQFSVIDLSSNKFSGFIPVSFFTFAS 436

Query: 428  LTDLNLSGNNFSGPLPLQ-------------------EIQNNPSTGSTQN-----LSLTS 463
            L  LNLS NN  GP+P +                   ++  N  TG           +  
Sbjct: 437  LRSLNLSRNNLEGPIPFRGSRASELLVLNSYPQMELLDLSTNSLTGMLPGDIGTMEKIKV 496

Query: 464  LDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPE 523
            L+LA N LSG L   ++K   L++L+LSNN F+G IP+ LP+ +  FNVS+N+LSG++PE
Sbjct: 497  LNLANNKLSGELPSDLNKLSGLLFLDLSNNTFKGQIPNKLPSQMVGFNVSYNDLSGIIPE 556

Query: 524  NLRNFPDSAFHPGNSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVA 583
            +LR++P S+F+PGNS L+ P         DL+L G  +H K + +IA+IV  V G  ++ 
Sbjct: 557  DLRSYPPSSFYPGNSKLSLPGRIPADSSGDLSLPGKKHHSKLSIRIAIIVASV-GAAIMI 615

Query: 584  LLCMLIYFRA-LWQRHGRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDP 642
            L  +  Y R  L   HGR+ F      +    G SS       +   +   SS +F  D 
Sbjct: 616  LFVLFAYHRTQLKDFHGRNRFTDQATTRDTKFGRSSRPSLFNFSSNVEQQSSSLSFSNDH 675

Query: 643  LPSS--------PMESAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQS 694
            L ++        P   A  + + +   + P  L        D+  ++     SS     S
Sbjct: 676  LLTANSRSLSGIPGCEAEISEQGAPATSAPTNLL-------DDYPAASGRKSSSGGSPLS 728

Query: 695  KNSRFTKNSDVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLD 754
             + RF+    +L+  SP++LAG+L   DVSL  TAEELS APAEV+GRS HGTLYKATLD
Sbjct: 729  SSPRFSDQPVMLDVYSPDRLAGELFFLDVSLKLTAEELSRAPAEVLGRSSHGTLYKATLD 788

Query: 755  SGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINA 814
            +G +L VK LR G+ + KK+FARE KK+G++KHPN+V L+ YYWGP+E E+L++S+Y+  
Sbjct: 789  NGHMLTVKWLRVGLVRHKKDFAREAKKIGSLKHPNIVPLRAYYWGPREQERLLLSDYLRG 848

Query: 815  QSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTM 874
            +SLA++L ET PR+  P+S  +RL+VAV+VA+CL YLH +RA+PHGNLK TNI+L +P  
Sbjct: 849  ESLAMHLYETTPRRYSPMSFSQRLKVAVEVAQCLLYLH-DRAMPHGNLKPTNIILSSPDN 907

Query: 875  NAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELL 934
               +TDY +HR++T +G A+Q+LN  ALGY  PE +S SKP P+LKSDVYAFG+IL+ELL
Sbjct: 908  TVRITDYCVHRLMTPSGVAEQILNMSALGYSAPELSSASKPIPTLKSDVYAFGVILMELL 967

Query: 935  TGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVAL 994
            T +S+G+I+    G VDLTDWVRL   E R  +C DR I  G   E+  + + D L VA+
Sbjct: 968  TRRSAGDIISGQTGAVDLTDWVRLCDQEGRRMDCIDRDIAGG---EEFSKGMEDALAVAI 1024

Query: 995  RCILPASERPDMMSVFEELSTI 1016
            RCIL  +ERP++  V + L++I
Sbjct: 1025 RCILSVNERPNIRQVLDHLTSI 1046





Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1 Back     alignment and function description
>sp|Q94C77|RPKL_ARATH Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1025
3594793171020 PREDICTED: probable inactive receptor ki 0.992 0.997 0.714 0.0
1477988211020 hypothetical protein VITISV_007077 [Viti 0.992 0.997 0.713 0.0
224131750966 predicted protein [Populus trichocarpa] 0.937 0.994 0.680 0.0
4495160951017 PREDICTED: probable inactive receptor ki 0.989 0.997 0.641 0.0
4494526661017 PREDICTED: probable inactive receptor ki 0.989 0.997 0.641 0.0
3565536681055 PREDICTED: probable inactive receptor ki 0.977 0.949 0.617 0.0
3574935931022 Receptor-like protein kinase BRI1-like p 0.966 0.969 0.609 0.0
3564992711003 PREDICTED: probable inactive receptor ki 0.975 0.997 0.619 0.0
2978223191022 ATP binding protein [Arabidopsis lyrata 0.983 0.986 0.593 0.0
1453603751020 Leucine-rich repeat protein kinase-like 0.974 0.979 0.583 0.0
>gi|359479317|ref|XP_002270284.2| PREDICTED: probable inactive receptor kinase At5g10020-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1404 bits (3633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1021 (71%), Positives = 843/1021 (82%), Gaps = 4/1021 (0%)

Query: 1    MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGI 60
            M +  LI LLLV  A+GQSDF AL++LKKGI KDPSG ++DSWD+KSL+SDGCP NWFGI
Sbjct: 1    MHSTCLIFLLLVELAVGQSDFGALIELKKGIQKDPSG-VLDSWDSKSLASDGCPENWFGI 59

Query: 61   TCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDL 120
             C+ G+V SI LND+G+VG+F F  I GLKML N+SVSNN   G I D+GSI+SL +LDL
Sbjct: 60   ICSEGHVISITLNDLGIVGDFHFTAITGLKMLQNLSVSNNLFTGTIEDVGSIESLAYLDL 119

Query: 121  SHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDIMHL 180
            SHN FHGLIPS +  L+NL+LLN+SSN+FEG  P+GFG L KLKY+D RAN F GDIM L
Sbjct: 120  SHNAFHGLIPSDLTHLENLVLLNLSSNNFEGKGPTGFGDLEKLKYIDFRANGFSGDIMRL 179

Query: 181  LSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNL 240
            LS+LGSVVHVDLS+NQFSGSLDLGLG SSF+SSIQY NIS NSLVG+LF HDGMPYFD+L
Sbjct: 180  LSELGSVVHVDLSSNQFSGSLDLGLGKSSFVSSIQYFNISCNSLVGQLFAHDGMPYFDSL 239

Query: 241  EVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLE 300
            EVFDASNN LVGAIPSFNFV SL+ILRLG N L+GSLP AL QESSM+LSELDL LNQLE
Sbjct: 240  EVFDASNNQLVGAIPSFNFVVSLQILRLGRNHLTGSLPEALFQESSMILSELDLGLNQLE 299

Query: 301  GPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIH 360
            GPVGSITSATLK +NLSSN+L+G LPARVGHC+I+DLSNN LSG+LSRMQ+WGNYVE I 
Sbjct: 300  GPVGSITSATLKNLNLSSNRLTGLLPARVGHCSIIDLSNNMLSGNLSRMQSWGNYVEIID 359

Query: 361  LSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLP 420
            LSSN LTG +PNQTSQFLRL S K+SNNSL G LP VLGTY ELKVIDLSLN L GFLLP
Sbjct: 360  LSSNKLTGTLPNQTSQFLRLISLKLSNNSLGGSLPPVLGTYQELKVIDLSLNQLTGFLLP 419

Query: 421  SFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGIS 480
            SFF ST+LTDLNLSGNN +G +PLQ I + PS GSTQNLSL SLDL+ NSLSG L   IS
Sbjct: 420  SFFNSTRLTDLNLSGNNLTGSIPLQAIPDIPSIGSTQNLSLVSLDLSGNSLSGHLPQEIS 479

Query: 481  KFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPGNSLL 540
             FH LVYLNLSNN FEGSIPD LP+GLK F+VS+NNLSG+VPENLR FPDSAFHPGNSLL
Sbjct: 480  GFHELVYLNLSNNLFEGSIPDDLPDGLKGFSVSYNNLSGIVPENLRRFPDSAFHPGNSLL 539

Query: 541  TFPNSPSQQD-VPDLTLRGHG-NHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQRH 598
             FP+SPS  +  PDL LRG G +HMKPA + ALI GLV GV+M+ALL ++I + A W   
Sbjct: 540  AFPHSPSSSNAAPDLDLRGQGSSHMKPAVRAALIAGLVGGVSMIALLFVMICYGAHWVEC 599

Query: 599  GRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDPLPSSPMESAYDAGETS 658
             RDS K +G +K   + +SS    S ++K  DPS++S +F QD   SS +   ++ G  S
Sbjct: 600  SRDSLKGNGMKKGTEKETSSDLHTSALHKILDPSITSSSFPQDNTSSSHLGYEHEHGIIS 659

Query: 659  SVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQSKNS-RFTKNSDVLNACSPEKLAGD 717
             V  KP +   P+ +R+DEG+SSP+SLLS SNPS SK+  R  +N DVL  CSP+KLAGD
Sbjct: 660  LVTKKPSDGSPPEPIREDEGISSPISLLSPSNPSPSKSPYRPDENPDVLKVCSPDKLAGD 719

Query: 718  LHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAR 777
            LHLFD SL+ T+EELSHAPAEVIGRSCHGTLYKATLDSG +LAVK LREGIAKG+KEF+R
Sbjct: 720  LHLFDGSLVVTSEELSHAPAEVIGRSCHGTLYKATLDSGHVLAVKWLREGIAKGRKEFSR 779

Query: 778  EVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDER 837
            E KKLGNIKHPNLVSLQGYYWG +EHEKL+ISN+INA  LA+YL + +PRK PPLS+ ER
Sbjct: 780  EAKKLGNIKHPNLVSLQGYYWGLREHEKLIISNFINAPCLALYLHQMEPRKFPPLSLVER 839

Query: 838  LRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVL 897
            L++A DVA CLN+LHNERAIPHGNLKSTNILLE   +NA+LTDYSLHRI+T AGTA+QVL
Sbjct: 840  LKIARDVACCLNFLHNERAIPHGNLKSTNILLETRKLNALLTDYSLHRIMTPAGTAEQVL 899

Query: 898  NAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVR 957
            NAGALGYRPPEFAS+SKPCPSLKSDVYA+G+ILLELLTGKSSGEIV  + GVVDLT+WVR
Sbjct: 900  NAGALGYRPPEFASSSKPCPSLKSDVYAYGVILLELLTGKSSGEIVSGNTGVVDLTEWVR 959

Query: 958  LLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDMMSVFEELSTIV 1017
             LA ENR GECFDRLI     ++ PPR L +MLQVAL+CILPASERPDM +V+E++S++V
Sbjct: 960  WLAAENRWGECFDRLIPGMQSVDHPPRCLHEMLQVALKCILPASERPDMRTVYEDISSVV 1019

Query: 1018 L 1018
            L
Sbjct: 1020 L 1020




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147798821|emb|CAN67610.1| hypothetical protein VITISV_007077 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131750|ref|XP_002328099.1| predicted protein [Populus trichocarpa] gi|222837614|gb|EEE75979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449516095|ref|XP_004165083.1| PREDICTED: probable inactive receptor kinase At5g10020-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449452666|ref|XP_004144080.1| PREDICTED: probable inactive receptor kinase At5g10020-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553668|ref|XP_003545175.1| PREDICTED: probable inactive receptor kinase At5g10020-like [Glycine max] Back     alignment and taxonomy information
>gi|357493593|ref|XP_003617085.1| Receptor-like protein kinase BRI1-like protein [Medicago truncatula] gi|355518420|gb|AET00044.1| Receptor-like protein kinase BRI1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356499271|ref|XP_003518465.1| PREDICTED: probable inactive receptor kinase At5g10020-like [Glycine max] Back     alignment and taxonomy information
>gi|297822319|ref|XP_002879042.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324881|gb|EFH55301.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145360375|ref|NP_180274.2| Leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|330252837|gb|AEC07931.1| Leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1025
TAIR|locus:20592531020 AT2G27060 [Arabidopsis thalian 0.978 0.983 0.560 2e-292
TAIR|locus:21840581048 AT5G10020 [Arabidopsis thalian 0.932 0.912 0.358 1.3e-148
TAIR|locus:2098267836 IMK2 "inflorescence meristem r 0.284 0.349 0.416 4.5e-86
TAIR|locus:21607911102 AT5G63930 [Arabidopsis thalian 0.467 0.434 0.305 9.2e-74
TAIR|locus:20204171101 AT1G17230 [Arabidopsis thalian 0.484 0.451 0.318 3.5e-73
UNIPROTKB|P931941109 INRPK1 "Receptor-like protein 0.474 0.438 0.298 4e-73
TAIR|locus:2182855967 ERL2 "ERECTA-like 2" [Arabidop 0.541 0.573 0.284 1.2e-72
TAIR|locus:2167948966 ERL1 "ERECTA-like 1" [Arabidop 0.540 0.573 0.301 3.5e-72
TAIR|locus:20913531016 AT3G28040 [Arabidopsis thalian 0.475 0.479 0.297 4.6e-71
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.490 0.442 0.299 6.7e-71
TAIR|locus:2059253 AT2G27060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2808 (993.5 bits), Expect = 2.0e-292, P = 2.0e-292
 Identities = 580/1034 (56%), Positives = 723/1034 (69%)

Query:     1 MQTV-SLIVLL--LVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNW 57
             MQ + S+I LL  +V+   G SDFEALL+LKKG   DPS +++ SWD K+LSSD CP NW
Sbjct:     1 MQIICSMIFLLVMMVMKVSGFSDFEALLELKKGFQGDPSRKVLTSWDAKALSSDRCPLNW 60

Query:    58 FGITCTNGYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEF 117
             +G+TC++G VTSI LN  GL+G+FSFP I+GL+ML N+S++NNQ  G +++IGS+ SL++
Sbjct:    61 YGVTCSSGGVTSIDLNGFGLLGSFSFPVIVGLRMLQNLSIANNQFSGTLSNIGSLTSLKY 120

Query:   118 LDLSHNLFHGLIPSGIVSLKNLMLLNIS-SNSFEGTFPSGFGGLGKLKYLDLRANRFGGD 176
             LD+S NLFHG +PSGI +L+NL  +N+S +N+  G  PSGFG L KLKYLDL+ N F G+
Sbjct:   121 LDVSGNLFHGALPSGIENLRNLEFVNLSGNNNLGGVIPSGFGSLAKLKYLDLQGNSFSGE 180

Query:   177 IMHLLSQLGSVVHVDLSNNQXXXXXXXXXXXXXXXXXXQYLNISENSLVGELFPHDGMPY 236
             +M L SQL SV +VD+S N                   ++LN+S NSLVGELF HDG+P+
Sbjct:   181 VMSLFSQLISVEYVDISRNNFSGSLDLGLAKSSFVSSIRHLNVSGNSLVGELFAHDGIPF 240

Query:   237 FDNLEVFDASNNHLVGAIPSFNFVFSLRILRLGSNQLSGSLPVAXXXXXXXXXXXXXXXX 296
             FD+LEVFDAS+N L G++P F+FV SL+ILRL  NQLS SLP                  
Sbjct:   241 FDSLEVFDASSNQLSGSVPVFSFVVSLKILRLQDNQLSASLPPGLLQESSTILTDLDLSL 300

Query:   297 NQLEGPVGSITSATLKKVNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYV 356
             NQLEGP+GSITS+TL+K+NLSSN+LSGSLP +VGHC I+DLSNN++SG+LSR+QNWG+ V
Sbjct:   301 NQLEGPIGSITSSTLEKLNLSSNRLSGSLPLKVGHCAIIDLSNNKISGELSRIQNWGDSV 360

Query:   357 EDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNG 416
             E I LSSN LTG +P QTSQFLRLTS K +NNSL+G LP +LGTYPELK IDLS N L+G
Sbjct:   361 EIIRLSSNSLTGTLPGQTSQFLRLTSLKAANNSLQGVLPFILGTYPELKEIDLSHNQLSG 420

Query:   417 FLLPSFFTSTKLTDLNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLL 476
              +  + F S KLT+LNLS NNFSG LPLQ+     + G   NLSLT++ L++NSL G L 
Sbjct:   421 VIPSNLFISAKLTELNLSNNNFSGSLPLQDAS---TVG---NLSLTNIGLSHNSLGGVLS 474

Query:   477 PGISKFHNLVYLNLSNNKFEGSIPDGLPNGLKEFNVSFNNLSGVVPENLRNFPDSAFHPG 536
               +++FHNL+ L+LS N FEG+IPDGLP+ LK F VS NNLSG VPENLR FPDSAFHPG
Sbjct:   475 EELTRFHNLISLDLSYNNFEGNIPDGLPDSLKMFTVSANNLSGNVPENLRRFPDSAFHPG 534

Query:   537 NSLLTFPNSPSQQDVPDLTLRGHGNHMKPATKIALIVGLVCGVTMVALLCMLIYFRALWQ 596
             N+LL  P S   +D  D+TLR HG HMK + K ALI+GLV G  ++AL+C++ +F  L +
Sbjct:   535 NALLNVPIS-LPKDKTDITLRKHGYHMKTSVKAALIIGLVVGTALLALVCVMFHFM-LRK 592

Query:   597 RHGRDSFKRDGEQKAFXXXXXXXXXXXGVNKKGDPSLSSFTFHQDP-----LP-SSPMES 650
             +H  +     GE+                      + SS +    P     LP SS   S
Sbjct:   593 QHDEEKSDVTGEKSIVPKTEPSSSNVIAAKNSVQENESSSSTTSTPSIKAKLPVSSSRFS 652

Query:   651 AYDAGETSSVVTK-PKELYHPDSVRKDEGXXXXXXXXXXXXXXXXXXXRFTKNSDVLNAC 709
              Y   E SS   K P E  H +S RKDE                    +   + D  N  
Sbjct:   653 QYSDSENSSPFLKEPNEELHSES-RKDE------ILSSQVSSSTPSLPKIQNSPD--NPT 703

Query:   710 SPE---KLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKRLRE 766
             S +   +L G+L++FD SL  TAEELS APAE IGRSCHGTLY+A L+S S+LAVK LRE
Sbjct:   704 SRQTSMRLDGNLYIFDSSLKLTAEELSRAPAEAIGRSCHGTLYRAVLNSDSVLAVKWLRE 763

Query:   767 GIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQETDP 826
             G AKGKKEFARE+KKLGNI HPNLVSLQ YYWGPKEHEKL+IS Y++A  LA YLQE   
Sbjct:   764 GTAKGKKEFAREIKKLGNINHPNLVSLQAYYWGPKEHEKLIISRYMDAPCLAFYLQEAGQ 823

Query:   827 RKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRI 886
               LPPL ++ RL++ +D+A CL+YLHN  AIPHGNLKSTN+LL+ P + A LTDYSLHR+
Sbjct:   824 LNLPPLLLENRLKITLDIASCLSYLHNGEAIPHGNLKSTNVLLKPPELTAHLTDYSLHRL 883

Query:   887 LTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVD 946
             +T   T++QVLNA ALGY PPEFAS+SKP PSLKSDVYAFG+ILLELLTGK SG+IVC D
Sbjct:   884 ITPEATSEQVLNAAALGYCPPEFASSSKPYPSLKSDVYAFGVILLELLTGKVSGDIVCSD 943

Query:   947 PGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPASERPDM 1006
             PGVV+LT+WV LL  +NR+ ECFD  I+       P  +L+D+LQVAL CI PA ERPDM
Sbjct:   944 PGVVELTEWVLLLVGQNRATECFDPSIVGSQGSRNPFGVLTDVLQVALSCISPAPERPDM 1003

Query:  1007 MSVFEELSTIVLEK 1020
               V +ELS IVL++
Sbjct:  1004 KLVSQELSRIVLKR 1017




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2184058 AT5G10020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098267 IMK2 "inflorescence meristem receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091353 AT3G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017368001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (1020 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1025
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-52
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-36
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-33
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-22
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-21
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 4e-21
pfam00069260 pfam00069, Pkinase, Protein kinase domain 9e-21
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-19
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-18
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-17
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 8e-17
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 9e-17
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-16
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-16
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-14
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-12
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 5e-12
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-11
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-11
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-11
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-11
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-11
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 5e-11
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 5e-11
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 6e-11
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 1e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-10
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-10
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-10
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-10
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 3e-10
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 4e-10
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-10
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 6e-10
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 7e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-10
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-09
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-09
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-09
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 3e-09
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 5e-09
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 6e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 6e-09
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 6e-09
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 7e-09
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 8e-09
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-08
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-08
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-08
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 4e-08
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 4e-08
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 5e-08
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 5e-08
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-08
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 9e-08
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 9e-08
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 1e-07
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-07
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-07
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 2e-07
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-07
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-07
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-07
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-07
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-07
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 3e-07
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 5e-07
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 5e-07
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 5e-07
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 7e-07
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 8e-07
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 9e-07
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 9e-07
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 1e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-06
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-06
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-06
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 1e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-06
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 1e-06
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-06
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-06
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-06
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 3e-06
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 3e-06
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-06
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 3e-06
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 3e-06
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 4e-06
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-06
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 4e-06
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 4e-06
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-06
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 4e-06
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 4e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 6e-06
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 7e-06
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 7e-06
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 9e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 1e-05
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 1e-05
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-05
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-05
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-05
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-05
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 1e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 2e-05
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-05
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 2e-05
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 2e-05
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 3e-05
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 3e-05
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 3e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-05
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-05
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-05
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 5e-05
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 5e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 6e-05
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 6e-05
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 7e-05
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 8e-05
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 9e-05
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-04
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 1e-04
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-04
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-04
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-04
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-04
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 2e-04
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-04
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 3e-04
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-04
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-04
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 3e-04
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-04
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 3e-04
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-04
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-04
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 3e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 4e-04
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 4e-04
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 5e-04
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 5e-04
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 5e-04
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 5e-04
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 6e-04
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 6e-04
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 6e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 7e-04
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-04
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 8e-04
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 9e-04
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 0.002
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 0.002
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.002
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 0.003
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.003
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 0.003
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 0.003
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 0.003
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 0.003
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 0.003
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 0.004
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 0.004
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  199 bits (507), Expect = 2e-52
 Identities = 175/537 (32%), Positives = 259/537 (48%), Gaps = 40/537 (7%)

Query: 1   MQTVSLIVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGI 60
                L  L L  + L   + E LL  K  I  DP  + + +W++   S+D C   W GI
Sbjct: 11  YLIFMLFFLFLNFSMLHAEELELLLSFKSSI-NDPL-KYLSNWNS---SADVC--LWQGI 63

Query: 61  TCTN-GYVTSIMLNDMGLVGNFSFPTIIGLKMLCNVSVSNNQLMGNITD--IGSIQSLEF 117
           TC N   V SI L+   + G  S   I  L  +  +++SNNQL G I D    +  SL +
Sbjct: 64  TCNNSSRVVSIDLSGKNISGKIS-SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRY 122

Query: 118 LDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKLKYLDLRANRFGGDI 177
           L+LS+N F G IP G  S+ NL  L++S+N   G  P+  G    LK LDL  N   G I
Sbjct: 123 LNLSNNNFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI 180

Query: 178 MHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYF 237
            + L+ L S+  + L++NQ  G +   LG    + S++++ +  N+L GE+    G    
Sbjct: 181 PNSLTNLTSLEFLTLASNQLVGQIPRELGQ---MKSLKWIYLGYNNLSGEIPYEIGG--L 235

Query: 238 DNLEVFDASNNHLVGAIP-SFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSL 296
            +L   D   N+L G IP S   + +L+ L L  N+LSG +P ++   S   L  LDLS 
Sbjct: 236 TSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF--SLQKLISLDLSD 293

Query: 297 NQLEG--PVGSITSATLKKVNLSSNKLSGSLPARVG---HCTIVDLSNNRLSGDLSRMQN 351
           N L G  P   I    L+ ++L SN  +G +P  +       ++ L +N+ SG++ +   
Sbjct: 294 NSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLG 353

Query: 352 WGNYVEDIHLSSNFLTGMVPNQTSQFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSL 411
             N +  + LS+N LTG +P        L    + +NSLEG++P  LG    L+ + L  
Sbjct: 354 KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQD 413

Query: 412 NHLNGFLLPSFFTSTKLTD-LNLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNS 470
           N  +G  LPS FT   L   L++S NN  G           ++      SL  L LA N 
Sbjct: 414 NSFSG-ELPSEFTKLPLVYFLDISNNNLQG---------RINSRKWDMPSLQMLSLARNK 463

Query: 471 LSGRLLPGISKFHNLVYLNLSNNKFEGSIPDGLPN--GLKEFNVSFNNLSGVVPENL 525
             G  LP       L  L+LS N+F G++P  L +   L +  +S N LSG +P+ L
Sbjct: 464 FFGG-LPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL 519


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1025
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
PHA02988283 hypothetical protein; Provisional 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.98
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.98
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.98
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.98
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.98
KOG0586 596 consensus Serine/threonine protein kinase [General 99.98
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.98
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.98
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.98
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.98
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.98
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.98
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.98
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.98
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.98
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.98
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.98
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.98
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.98
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.98
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.98
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.98
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.98
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.98
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.98
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.97
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.97
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.97
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.97
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.97
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.97
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.97
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.97
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.97
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.97
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
PLN00009294 cyclin-dependent kinase A; Provisional 99.97
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.97
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.97
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.97
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.97
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.97
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.97
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.97
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.97
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.97
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.97
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.97
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.97
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.97
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.97
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.97
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.97
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.97
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.97
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.97
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.97
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.97
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.97
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.97
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.97
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.97
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.97
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.97
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.96
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.96
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.96
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.96
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.96
PLN03224507 probable serine/threonine protein kinase; Provisio 99.96
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.96
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.95
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.95
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.95
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.95
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.95
KOG1152772 consensus Signal transduction serine/threonine kin 99.94
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.94
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.93
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.92
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.92
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.92
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.92
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.92
KOG1167418 consensus Serine/threonine protein kinase of the C 99.91
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PLN00181 793 protein SPA1-RELATED; Provisional 99.89
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.87
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PRK09188365 serine/threonine protein kinase; Provisional 99.86
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.86
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.85
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.85
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.81
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.8
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.8
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.77
PRK12274218 serine/threonine protein kinase; Provisional 99.77
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
PRK10345210 hypothetical protein; Provisional 99.75
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.74
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.73
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.7
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.68
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
smart00090237 RIO RIO-like kinase. 99.65
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.63
PRK14879211 serine/threonine protein kinase; Provisional 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.6
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.6
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.6
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.59
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.59
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.56
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.52
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.5
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.41
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.37
PLN03150623 hypothetical protein; Provisional 99.36
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.34
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.13
KOG1266458 consensus Protein kinase [Signal transduction mech 99.11
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
KOG1243 690 consensus Protein kinase [General function predict 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.92
KOG3087229 consensus Serine/threonine protein kinase [General 98.91
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.91
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.87
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.75
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.73
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 98.7
COG4248 637 Uncharacterized protein with protein kinase and he 98.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.65
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.64
KOG06061205 consensus Microtubule-associated serine/threonine 98.62
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.58
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.52
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.49
COG0478304 RIO-like serine/threonine protein kinase fused to 98.46
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.32
PRK09902216 hypothetical protein; Provisional 98.31
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
COG0661517 AarF Predicted unusual protein kinase [General fun 98.14
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.6e-97  Score=953.58  Aligned_cols=856  Identities=30%  Similarity=0.452  Sum_probs=513.2

Q ss_pred             HHHHHHhhcCChhhHHHHHHHHhhcCCCCCCCcccCCCCCCCCCCCCCCCccceEcCC-CCEEEEEeCCCCcccccCccc
Q 001700            7 IVLLLVVNALGQSDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTN-GYVTSIMLNDMGLVGNFSFPT   85 (1025)
Q Consensus         7 ~~~~~~~~~~~~~~~~aLl~~k~~~~~d~~~~l~~sW~~~~~~~d~C~~~w~gv~C~~-~~v~~l~l~~~~l~g~~~~~~   85 (1025)
                      ++.+++.+...++|+.||++||+++ .||.+.+ ++|+..   .|||.  |.||+|++ ++|+.|+|+++++.|.++ +.
T Consensus        17 ~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~-~~w~~~---~~~c~--w~gv~c~~~~~v~~L~L~~~~i~~~~~-~~   88 (968)
T PLN00113         17 FFLFLNFSMLHAEELELLLSFKSSI-NDPLKYL-SNWNSS---ADVCL--WQGITCNNSSRVVSIDLSGKNISGKIS-SA   88 (968)
T ss_pred             HHHHHHccCCCHHHHHHHHHHHHhC-CCCcccC-CCCCCC---CCCCc--CcceecCCCCcEEEEEecCCCccccCC-hH
Confidence            3333444555789999999999999 6787766 899753   37886  99999984 799999999999999886 77


Q ss_pred             ccCCCCCCEEEccCCcCccCCCC--CCCCCCCCEEeccCCcCcccCcccccCCCCCCEEEccCCccccCCCccccccccc
Q 001700           86 IIGLKMLCNVSVSNNQLMGNITD--IGSIQSLEFLDLSHNLFHGLIPSGIVSLKNLMLLNISSNSFEGTFPSGFGGLGKL  163 (1025)
Q Consensus        86 ~~~L~~L~~L~ls~N~l~~~~~~--~~~l~~L~~LdLs~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  163 (1025)
                      +..+++|+.|+|++|++++.++.  +..+++|++|||++|++++.+|.  +.+++|++|+|++|.+++.+|..|+++++|
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L  166 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSL  166 (968)
T ss_pred             HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCC
Confidence            88899999999999988875553  44677777777777777665553  345555555555555555555555555555


Q ss_pred             cEeecccCCCCCCchhHhhhcccCcEEeCccCccccccCCCCCCCcccccccEEecccccccCccCCC------------
Q 001700          164 KYLDLRANRFGGDIMHLLSQLGSVVHVDLSNNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPH------------  231 (1025)
Q Consensus       164 ~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~------------  231 (1025)
                      ++|+|++|.+.+.+|..+.++++|++|+|++|++++.+|..++.+   ++|+.|+|++|.+++.++..            
T Consensus       167 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l---~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  243 (968)
T PLN00113        167 KVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM---KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDL  243 (968)
T ss_pred             CEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCc---CCccEEECcCCccCCcCChhHhcCCCCCEEEC
Confidence            555555555555555555555555555555555555544444332   44555555555544433322            


Q ss_pred             ----------CCCCCCCCCCEEeccCCcccccCC-cccccccccceecccccccccCChhHHhhcccccCeEEcccccCc
Q 001700          232 ----------DGMPYFDNLEVFDASNNHLVGAIP-SFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLE  300 (1025)
Q Consensus       232 ----------~~~~~l~~L~~L~Ls~N~l~~~~~-~~~~l~~L~~L~L~~N~l~g~~p~~~~~~~~~~L~~L~ls~N~l~  300 (1025)
                                ..+..+++|+.|++++|++++.+| .+..+.+|++|+|++|.+++.+|..+....  +|+.|++++|.+.
T Consensus       244 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~--~L~~L~l~~n~~~  321 (968)
T PLN00113        244 VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ--NLEILHLFSNNFT  321 (968)
T ss_pred             cCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCC--CCcEEECCCCccC
Confidence                      113344444444444444444333 234444444444444444444444443322  2455555555544


Q ss_pred             Ccc--cccCCCCccEEEccCCcccCCCCCCC---CCcceeeccCccCCCcccccccCCCccceEEecCCCCCCCCchhcc
Q 001700          301 GPV--GSITSATLKKVNLSSNKLSGSLPARV---GHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQTS  375 (1025)
Q Consensus       301 ~~~--~~~~~~~L~~L~Ls~N~l~~~~p~~l---~~l~~L~Ls~N~l~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~  375 (1025)
                      +..  ....+++|+.|+|++|++++.+|..+   .+|+.|++++|++++.++..+.....|+.|++++|.+.+.+|..+.
T Consensus       322 ~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~  401 (968)
T PLN00113        322 GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLG  401 (968)
T ss_pred             CcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHh
Confidence            321  12234455555555555555555433   2344555555555554443333333444444444444444444445


Q ss_pred             CCCCCCEEEecCcccCCCcccccCCCCCCCEeecCCCcccccCcccccCCCCCCEEecCCCcC-----------------
Q 001700          376 QFLRLTSFKVSNNSLEGDLPAVLGTYPELKVIDLSLNHLNGFLLPSFFTSTKLTDLNLSGNNF-----------------  438 (1025)
Q Consensus       376 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l-----------------  438 (1025)
                      .+++|+.|++++|.+++.+|..|..+++|+.|+|++|++++.++..+..+++|+.|+|++|++                 
T Consensus       402 ~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~  481 (968)
T PLN00113        402 ACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLD  481 (968)
T ss_pred             CCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEE
Confidence            555555555555555555555454555555555555554444444333344444444443333                 


Q ss_pred             ------cccCCcc----------cccCCCCc-----cccccccccEEEccCCcCcccCChhhhcCCCCCEeeCcCCcCcc
Q 001700          439 ------SGPLPLQ----------EIQNNPST-----GSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLSNNKFEG  497 (1025)
Q Consensus       439 ------~~~~p~~----------~~~~~~~~-----~~~~~~~L~~LdLs~N~l~~~~p~~~~~l~~L~~LdLs~N~l~g  497 (1025)
                            ++.+|..          .+..+...     ......+|++|+|++|.++|.+|..+..+++|+.|||++|+++|
T Consensus       482 ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  561 (968)
T PLN00113        482 LSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSG  561 (968)
T ss_pred             CcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccc
Confidence                  3332211          00000000     00111256666666666666666666666677777777777766


Q ss_pred             ccCCCcCC--CCcEEECCCCcccccCCCC--CCCCCCCCCCCCCCC-CCCCCC---CCCCCCCCccccCCCccccccceE
Q 001700          498 SIPDGLPN--GLKEFNVSFNNLSGVVPEN--LRNFPDSAFHPGNSL-LTFPNS---PSQQDVPDLTLRGHGNHMKPATKI  569 (1025)
Q Consensus       498 ~ip~~l~~--~L~~L~ls~N~l~g~~p~~--l~~~~~~~~~~~n~~-c~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~  569 (1025)
                      .+|..+..  +|+.|++++|+++|.+|..  +..+....|. ||+. |+.+..   .+|.          . ..+.....
T Consensus       562 ~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~-~n~~lc~~~~~~~~~~c~----------~-~~~~~~~~  629 (968)
T PLN00113        562 EIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVA-GNIDLCGGDTTSGLPPCK----------R-VRKTPSWW  629 (968)
T ss_pred             cCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhc-CCccccCCccccCCCCCc----------c-ccccceee
Confidence            66665543  5677777777777766654  3455555666 6664 764321   1111          0 01111112


Q ss_pred             EEEEeeeehhHHhHHHHHHHHHHHHHhhcCCcccccccccccccCCCCCccccCCCCCCCCCCCCcceecCCCCCCCccc
Q 001700          570 ALIVGLVCGVTMVALLCMLIYFRALWQRHGRDSFKRDGEQKAFSEGSSSLSQRSGVNKKGDPSLSSFTFHQDPLPSSPME  649 (1025)
Q Consensus       570 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~k~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  649 (1025)
                      ++++++++++++++++++++++++.  + ++...++      . +..      .+.                        
T Consensus       630 ~~~~~~~~~~~~~~~~~~~~~~~~~--~-~~~~~~~------~-~~~------~~~------------------------  669 (968)
T PLN00113        630 FYITCTLGAFLVLALVAFGFVFIRG--R-NNLELKR------V-ENE------DGT------------------------  669 (968)
T ss_pred             eehhHHHHHHHHHHHHHHHHHHHHh--h-hcccccc------c-ccc------ccc------------------------
Confidence            2222222222222222222222220  0 0000000      0 000      000                        


Q ss_pred             cccccCCccccccCCccccCCCcccCCCCCCCCccccccCCCCCCCCCcccCCccccccCCcccccCCccccccccccCH
Q 001700          650 SAYDAGETSSVVTKPKELYHPDSVRKDEGLSSPVSLLSSSNPSQSKNSRFTKNSDVLNACSPEKLAGDLHLFDVSLMFTA  729 (1025)
Q Consensus       650 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  729 (1025)
                                        +....                  .. ..                           ....++.
T Consensus       670 ------------------~~~~~------------------~~-~~---------------------------~~~~~~~  685 (968)
T PLN00113        670 ------------------WELQF------------------FD-SK---------------------------VSKSITI  685 (968)
T ss_pred             ------------------ccccc------------------cc-cc---------------------------cchhhhH
Confidence                              00000                  00 00                           0001122


Q ss_pred             HHhh--cCCCceeeeecceEEEEEEe-cCCCEEEEEEccccchhcHHHHHHHHHHHhcCCCCccccccceeecCCCCeeE
Q 001700          730 EELS--HAPAEVIGRSCHGTLYKATL-DSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKL  806 (1025)
Q Consensus       730 ~~l~--~~~~~~lG~G~~g~Vy~~~~-~~g~~vavK~~~~~~~~~~~~~~~E~~~l~~l~hpniv~l~~~~~~~~~~~~~  806 (1025)
                      +++.  +...++||+|+||.||+|+. .+|..||||+++.....    ..+|++++++++|||||+++|+|.  .....+
T Consensus       686 ~~~~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~~----~~~~~~~l~~l~HpnIv~~~~~~~--~~~~~~  759 (968)
T PLN00113        686 NDILSSLKEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNSI----PSSEIADMGKLQHPNIVKLIGLCR--SEKGAY  759 (968)
T ss_pred             HHHHhhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccCCccc----cHHHHHHHhhCCCCCcceEEEEEE--cCCCCE
Confidence            2221  12357899999999999996 57999999998754322    235688999999999999999997  445789


Q ss_pred             EEEeccccccHHHHHhhcCCCCCCCCCHHHHHHHHHHHHHHHHHHhcC--CCCcccCCCCCCEEeecCCCCEEEeccccc
Q 001700          807 VISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNE--RAIPHGNLKSTNILLEAPTMNAVLTDYSLH  884 (1025)
Q Consensus       807 lv~e~~~~gsL~~~l~~~~~~~~~~l~~~~~~~i~~~ia~aL~yLH~~--~~ivHrDlkp~NILl~~~~~~~kl~DfGla  884 (1025)
                      +||||+++|+|.++++        .++|.++.+|+.|+|+||+|||+.  ++|+||||||+||+++. +..+++. ||.+
T Consensus       760 lv~Ey~~~g~L~~~l~--------~l~~~~~~~i~~~ia~~L~yLH~~~~~~iiH~dlkp~Nil~~~-~~~~~~~-~~~~  829 (968)
T PLN00113        760 LIHEYIEGKNLSEVLR--------NLSWERRRKIAIGIAKALRFLHCRCSPAVVVGNLSPEKIIIDG-KDEPHLR-LSLP  829 (968)
T ss_pred             EEEeCCCCCcHHHHHh--------cCCHHHHHHHHHHHHHHHHHhccCCCCCeecCCCCHHhEEECC-CCceEEE-eccc
Confidence            9999999999999995        378999999999999999999942  68999999999999987 6677765 6655


Q ss_pred             cccccCCCccccccCcccccCccccccCCCCCCCCchhHHHHHHHHHHHHcCCCCCCccccCCCCcchHHHHHHHHhhcc
Q 001700          885 RILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENR  964 (1025)
Q Consensus       885 ~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~~~DVwSlGvvl~elltG~~P~~~~~~~~~~~~l~~~~~~~~~~~~  964 (1025)
                      ......     ....||+.|||||++.+..  ++.|+|||||||++|||+||+.||+....  ....+++|++.......
T Consensus       830 ~~~~~~-----~~~~~t~~y~aPE~~~~~~--~~~~sDv~S~Gvvl~el~tg~~p~~~~~~--~~~~~~~~~~~~~~~~~  900 (968)
T PLN00113        830 GLLCTD-----TKCFISSAYVAPETRETKD--ITEKSDIYGFGLILIELLTGKSPADAEFG--VHGSIVEWARYCYSDCH  900 (968)
T ss_pred             cccccC-----CCccccccccCcccccCCC--CCcccchhhHHHHHHHHHhCCCCCCcccC--CCCcHHHHHHHhcCccc
Confidence            433221     1125889999999998766  58999999999999999999999964332  34568888876655544


Q ss_pred             ccccchhhhcCCCCCCCchHHHHHHHHHHHHccCCC-CCCCCHHHHHHHHhhccccc
Q 001700          965 SGECFDRLIMDGHDMEQPPRILSDMLQVALRCILPA-SERPDMMSVFEELSTIVLEK 1020 (1025)
Q Consensus       965 ~~~~~d~~~~~~~~~~~~~~~~~~~~~l~~~C~~~~-~~RPs~~evl~~L~~i~~~~ 1020 (1025)
                      ....+|+.+....  +.+.++..++.+++.+||+.+ ++||+|+||++.|+++....
T Consensus       901 ~~~~~~~~~~~~~--~~~~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~~~~~  955 (968)
T PLN00113        901 LDMWIDPSIRGDV--SVNQNEIVEVMNLALHCTATDPTARPCANDVLKTLESASRSS  955 (968)
T ss_pred             hhheeCccccCCC--CccHHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHhhccc
Confidence            5556666554432  234567788999999999999 99999999999999997643



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1025
3uim_A326 Structural Basis For The Impact Of Phosphorylation 3e-29
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-28
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-24
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-23
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-14
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-24
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-22
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-14
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 1e-21
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 8e-21
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 3e-16
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-15
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-14
2nry_A307 Crystal Structure Of Irak-4 Length = 307 7e-14
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 8e-14
2nru_A307 Crystal Structure Of Irak-4 Length = 307 9e-14
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 7e-13
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 1e-12
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 3e-12
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 3e-12
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 3e-12
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-12
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 4e-12
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 4e-12
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 4e-12
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 4e-12
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-12
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-12
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 4e-12
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-12
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 5e-12
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 6e-12
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 7e-12
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-12
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 8e-12
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 9e-12
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 1e-11
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 1e-11
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-11
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 1e-11
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 3e-11
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-11
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-11
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 4e-11
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 6e-11
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 6e-11
4h58_A275 Braf In Complex With Compound 3 Length = 275 6e-11
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 8e-11
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 8e-11
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 8e-11
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 2e-10
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 2e-10
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 2e-10
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 2e-10
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 2e-10
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 2e-10
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-10
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-10
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-10
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 2e-10
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-09
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-10
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 4e-10
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-10
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 4e-10
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 4e-10
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-10
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 4e-10
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 4e-10
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-10
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 5e-10
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-10
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 5e-10
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-10
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 6e-10
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 6e-10
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 7e-10
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 8e-10
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 9e-10
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 9e-10
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-09
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 3e-09
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 3e-09
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 3e-09
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 3e-09
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 4e-09
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 4e-09
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 4e-09
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 4e-09
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 4e-09
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 4e-09
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 4e-09
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 5e-09
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 5e-09
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 5e-09
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 5e-09
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 5e-09
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 6e-09
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 6e-09
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 6e-09
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 6e-09
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 7e-09
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 7e-09
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 7e-09
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 7e-09
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 7e-09
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 7e-09
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 7e-09
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 8e-09
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 8e-09
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 8e-09
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 8e-09
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 9e-09
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-08
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 2e-08
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 2e-08
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-08
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-08
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 2e-08
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 2e-08
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 2e-08
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-08
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-08
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 3e-08
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 3e-08
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 3e-08
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 3e-08
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 3e-08
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-08
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 3e-08
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 3e-08
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 4e-08
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 4e-08
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 5e-08
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 5e-08
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-08
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 5e-08
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 6e-08
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 8e-08
3a4o_X286 Lyn Kinase Domain Length = 286 9e-08
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 9e-08
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-07
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 1e-07
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-07
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-07
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-07
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-07
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-07
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-07
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 1e-07
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 1e-07
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 1e-07
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-07
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-07
2pl0_A289 Lck Bound To Imatinib Length = 289 1e-07
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-07
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 1e-07
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-07
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 2e-07
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 2e-07
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 2e-07
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 2e-07
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 2e-07
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 2e-07
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 2e-07
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-07
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-07
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 2e-07
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-07
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 3e-07
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 3e-07
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-07
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 3e-07
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 4e-07
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 4e-07
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-07
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 4e-07
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 4e-07
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-07
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 4e-07
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 4e-07
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 4e-07
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 4e-07
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 4e-07
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 5e-07
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 5e-07
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-07
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 5e-07
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 6e-07
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 6e-07
2g15_A318 Structural Characterization Of Autoinhibited C-Met 6e-07
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 6e-07
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 7e-07
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 8e-07
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 8e-07
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 8e-07
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 8e-07
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 9e-07
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 1e-06
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-06
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-06
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-06
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-06
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-06
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-06
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-06
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-06
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-06
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-06
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-06
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-06
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-06
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-06
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-06
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-06
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-06
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-06
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-06
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-06
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-06
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-06
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-06
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 2e-06
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 2e-06
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 2e-06
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 2e-06
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-06
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-06
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 2e-06
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 2e-06
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-06
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 2e-06
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-06
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-06
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 2e-06
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 2e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-06
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 2e-06
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 2e-06
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 2e-06
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 2e-06
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 2e-06
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 2e-06
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-06
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 2e-06
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-06
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-06
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-06
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-06
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-06
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 3e-06
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-06
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-06
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-06
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 3e-06
3bhy_A283 Crystal Structure Of Human Death Associated Protein 3e-06
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 4e-06
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 4e-06
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-06
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 5e-06
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 5e-06
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 5e-06
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 5e-06
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 5e-06
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-06
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 5e-06
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 5e-06
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 5e-06
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 5e-06
1fvr_A327 Tie2 Kinase Domain Length = 327 5e-06
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 6e-06
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-06
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 6e-06
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 6e-06
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 6e-06
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 6e-06
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 6e-06
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 7e-06
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 7e-06
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 7e-06
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 7e-06
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 7e-06
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 8e-06
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 8e-06
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 9e-06
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 9e-06
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 9e-06
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-05
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-05
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-05
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 1e-05
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-05
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 1e-05
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 1e-05
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-05
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 1e-05
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 2e-05
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 2e-05
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-05
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 2e-05
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-05
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 2e-05
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 2e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 2e-05
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 3e-05
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 3e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-05
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 3e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-05
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 3e-05
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 3e-05
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 3e-05
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-05
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 3e-05
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 3e-05
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 3e-05
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 3e-05
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-05
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 3e-05
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-05
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 4e-05
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 4e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-05
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 4e-05
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 4e-05
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 4e-05
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 4e-05
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 4e-05
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 4e-05
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 5e-05
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 5e-05
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 6e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 6e-05
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-05
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 6e-05
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 6e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-05
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 7e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-05
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 7e-05
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 7e-05
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 7e-05
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-05
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-05
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 8e-05
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 8e-05
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 9e-05
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 9e-05
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 9e-05
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 9e-05
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 9e-05
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 1e-04
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 1e-04
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 1e-04
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-04
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 1e-04
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-04
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-04
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 1e-04
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-04
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-04
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-04
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 2e-04
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 2e-04
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-04
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 2e-04
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-04
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-04
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-04
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-04
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-04
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-04
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 2e-04
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-04
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-04
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 2e-04
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-04
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 2e-04
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 2e-04
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-04
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-04
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-04
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 3e-04
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 3e-04
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-04
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 3e-04
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 3e-04
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 3e-04
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-04
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 3e-04
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 3e-04
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-04
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-04
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 3e-04
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-04
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-04
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 4e-04
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 5e-04
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-04
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 5e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 5e-04
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 5e-04
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 6e-04
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 6e-04
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 6e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 6e-04
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 6e-04
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 6e-04
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 6e-04
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 7e-04
3b2t_A311 Structure Of Phosphotransferase Length = 311 7e-04
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 7e-04
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-04
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 7e-04
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 7e-04
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 7e-04
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-04
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 7e-04
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 8e-04
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 8e-04
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 8e-04
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-04
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 8e-04
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 8e-04
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 8e-04
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 8e-04
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 9e-04
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 9e-04
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 9e-04
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure

Iteration: 1

Score = 127 bits (319), Expect = 3e-29, Method: Composition-based stats. Identities = 100/315 (31%), Positives = 161/315 (51%), Gaps = 16/315 (5%) Query: 704 DVLNACSPEKLAGDLHLFDVSLMFTAEELSHAPAEVIGRSCHGTLYKATLDSGSILAVKR 763 DV PE G L F + + A + + ++GR G +YK L G ++AVKR Sbjct: 3 DVPAEEDPEVHLGQLKRFSLRELQVASD-NFXNKNILGRGGFGKVYKGRLADGXLVAVKR 61 Query: 764 LREGIAKGKK-EFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNYINAQSLAVYLQ 822 L+E +G + +F EV+ + H NL+ L+G+ P E+L++ Y+ S+A L+ Sbjct: 62 LKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPT--ERLLVYPYMANGSVASCLR 119 Query: 823 ETDPRKLPPLSIDERLRVAVDVARCLNYLHN--ERAIPHGNLKSTNILLEAPTMNAVLTD 880 E P PPL +R R+A+ AR L YLH+ + I H ++K+ NILL+ AV+ D Sbjct: 120 ER-PESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDE-EFEAVVGD 177 Query: 881 YSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLTGKSSG 940 + L +++ G +G+ PE+ ST K S K+DV+ +G++LLEL+TG+ + Sbjct: 178 FGLAKLMDYKDXHVXXAVRGXIGHIAPEYLSTGK--SSEKTDVFGYGVMLLELITGQRAF 235 Query: 941 EIV-CVDPGVVDLTDWVRLLALENRSGECFDRLIMDGHDMEQPPRILSDMLQVALRCILP 999 ++ + V L DWV+ L E + D + + E+ + ++QVAL C Sbjct: 236 DLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEE----VEQLIQVALLCTQS 291 Query: 1000 AS-ERPDMMSVFEEL 1013 + ERP M V L Sbjct: 292 SPMERPKMSEVVRML 306
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1025
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-90
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-68
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-47
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-17
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 6e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-35
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-34
3soc_A322 Activin receptor type-2A; structural genomics cons 7e-39
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-37
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-37
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-21
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-34
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 5e-33
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 6e-33
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-31
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 7e-31
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-30
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-30
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 6e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-29
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-28
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-28
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-06
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-17
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-17
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-17
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-17
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 4e-17
2a19_B284 Interferon-induced, double-stranded RNA-activated 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 9e-17
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-08
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-16
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 4e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-10
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 9e-16
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-15
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-15
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3lzb_A327 Epidermal growth factor receptor; epidermal growth 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
3ork_A311 Serine/threonine protein kinase; structural genomi 6e-15
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 7e-15
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 8e-15
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 9e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 1e-14
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-14
3uqc_A286 Probable conserved transmembrane protein; structur 2e-14
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-14
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-14
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-14
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 4e-14
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-14
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 1e-13
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-13
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 1e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-10
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-13
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-13
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 3e-13
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-13
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-13
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-13
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 6e-13
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-13
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-12
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-12
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 1e-12
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-12
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-12
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-12
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-12
2dyl_A318 Dual specificity mitogen-activated protein kinase 3e-12
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 3e-12
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-12
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 5e-12
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-12
3eqc_A360 Dual specificity mitogen-activated protein kinase; 5e-12
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 6e-12
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 6e-12
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 7e-12
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-11
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-11
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-11
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-11
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-11
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-11
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
3aln_A327 Dual specificity mitogen-activated protein kinase; 4e-11
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 4e-11
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 5e-11
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-10
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 4e-10
3fme_A290 Dual specificity mitogen-activated protein kinase; 5e-10
4aoj_A329 High affinity nerve growth factor receptor; transf 5e-10
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 5e-10
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-10
3an0_A340 Dual specificity mitogen-activated protein kinase; 7e-10
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-09
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-09
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-09
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-09
2xir_A316 Vascular endothelial growth factor receptor 2; ang 5e-09
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-09
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 7e-09
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 8e-09
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 8e-09
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-08
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-08
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-08
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-08
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-08
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-08
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 3e-08
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 6e-08
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 6e-08
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 6e-08
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 6e-08
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 9e-08
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 9e-08
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 9e-08
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-07
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-07
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-07
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-07
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-07
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-07
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-07
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-07
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-07
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 4e-07
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-07
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-07
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 5e-07
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 6e-07
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 7e-07
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 8e-07
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-06
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-06
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-06
3niz_A311 Rhodanese family protein; structural genomics, str 3e-06
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 3e-06
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 3e-06
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-06
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-06
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 6e-06
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-06
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-05
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-05
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-05
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-05
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 1e-05
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-05
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-05
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-05
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 3e-05
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 3e-05
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-05
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-05
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-05
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-05
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 4e-05
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 4e-05
2y0a_A326 Death-associated protein kinase 1; transferase, ca 5e-05
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 5e-05
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 6e-05
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-05
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 8e-05
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 8e-05
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
3bhy_A283 Death-associated protein kinase 3; death associate 1e-04
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-04
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-04
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-04
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 2e-04
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 3e-04
2fst_X367 Mitogen-activated protein kinase 14; active mutant 3e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 3e-04
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  307 bits (789), Expect = 3e-91
 Identities = 144/520 (27%), Positives = 226/520 (43%), Gaps = 74/520 (14%)

Query: 19  SDFEALLQLKKGIAKDPSGQIIDSWDTKSLSSDGCPRNWFGITCTNGYVTSIMLNDMGLV 78
            +   L+  K  +  D +  ++  W +   + + C   + G+TC +  VTSI L+   L 
Sbjct: 12  REIHQLISFKDVL-PDKN--LLPDWSS---NKNPC--TFDGVTCRDDKVTSIDLSSKPLN 63

Query: 79  GNFSF--PTIIGLKMLCNVSVSNNQLMGNITDIGSIQSLEFLDLSHNLFHGLIPSG--IV 134
             FS    +++ L  L ++ +SN+ + G+++      SL  LDLS N   G + +   + 
Sbjct: 64  VGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLG 123

Query: 135 SLKNLMLLNISSNSFEGTFP-SGFGGLGKLKYLDLRANRFGGDIMHLLSQLGSVVHVDLS 193
           S   L  LN+SSN+ +     SG   L  L+ L                        DLS
Sbjct: 124 SCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVL------------------------DLS 159

Query: 194 NNQFSGSLDLGLGDSSFISSIQYLNISENSLVGELFPHDGMPYFDNLEVFDASNNHLVGA 253
            N  SG+  +G   S     +++L IS N + G++          NLE  D S+N+    
Sbjct: 160 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDV-DVSRCV---NLEFLDVSSNNFSTG 215

Query: 254 IPSFNFVFSLRILRLGSNQLSGSLPVALLQESSMMLSELDLSLNQLEGPVGSITSATLKK 313
           IP      +L+ L +  N+LSG    A+   +   L  L++S NQ  GP+  +   +L+ 
Sbjct: 216 IPFLGDCSALQHLDISGNKLSGDFSRAISTCTE--LKLLNISSNQFVGPIPPLPLKSLQY 273

Query: 314 VNLSSNKLSGSLPARVGHCTIVDLSNNRLSGDLSRMQNWGNYVEDIHLSSNFLTGMVPNQ 373
           ++L+ NK +G +P               LSG    +         + LS N   G VP  
Sbjct: 274 LSLAENKFTGEIPD-------------FLSGACDTLTG-------LDLSGNHFYGAVPPF 313

Query: 374 TSQFLRLTSFKVSNNSLEGDLPA-VLGTYPELKVIDLSLNHLNGFLLPSFF-TSTKLTDL 431
                 L S  +S+N+  G+LP   L     LKV+DLS N  +G L  S    S  L  L
Sbjct: 314 FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 373

Query: 432 NLSGNNFSGPLPLQEIQNNPSTGSTQNLSLTSLDLAYNSLSGRLLPGISKFHNLVYLNLS 491
           +LS NNFSGP+        P+       +L  L L  N  +G++ P +S    LV L+LS
Sbjct: 374 DLSSNNFSGPIL-------PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 426

Query: 492 NNKFEGSIPDGLPN--GLKEFNVSFNNLSGVVPENLRNFP 529
            N   G+IP  L +   L++  +  N L G +P+ L    
Sbjct: 427 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 466


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1025
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-42
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-41
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-40
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-38
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-38
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-38
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 7e-37
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-36
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-36
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-35
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-35
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-35
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-35
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-35
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-34
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-34
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-34
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-33
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-32
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-32
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 6e-32
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-31
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-31
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-30
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-30
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-30
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-30
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-30
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-30
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-30
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-29
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-28
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-27
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 6e-27
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-25
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-25
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-25
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-24
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-24
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-24
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-24
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-24
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 6e-24
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-24
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-23
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-23
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-23
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-23
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-22
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-22
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 7e-22
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-21
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-21
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-20
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-20
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-20
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-19
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-19
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-17
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-05
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  153 bits (388), Expect = 3e-42
 Identities = 55/277 (19%), Positives = 112/277 (40%), Gaps = 32/277 (11%)

Query: 738  EVIGRSCHGTLYKATLDSGSILAVKRLREGIAKGKKEFAREVKKLGNIKHPNLVSLQGYY 797
            E +G    G ++    +  + +AVK L++G +     F  E   +  ++H  LV L    
Sbjct: 19   ERLGAGQFGEVWMGYYNGHTKVAVKSLKQG-SMSPDAFLAEANLMKQLQHQRLVRLYAVV 77

Query: 798  WGPKEHEKLVISNYINAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAI 857
                +    +I+ Y+   SL  +L+     KL     ++ L +A  +A  + ++  ER  
Sbjct: 78   ---TQEPIYIITEYMENGSLVDFLKTPSGIKLTI---NKLLDMAAQIAEGMAFIE-ERNY 130

Query: 858  PHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAGTADQVLNAGALGYRPPEFASTSKPCP 917
             H +L++ NIL+   T++  + D+ L R++       +      + +  PE  +      
Sbjct: 131  IHRDLRAANILVS-DTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGT--F 187

Query: 918  SLKSDVYAFGIILLELLTGKSSGEIVCVDPGVVDLTDWVRLLALENRSGECFDRLIMDGH 977
            ++KSDV++FGI+L E++T                       +     +     + +  G+
Sbjct: 188  TIKSDVWSFGILLTEIVTHGR--------------------IPYPGMTNPEVIQNLERGY 227

Query: 978  DMEQPPRILSDMLQVALRCILP-ASERPDMMSVFEEL 1013
             M +P     ++ Q+   C      +RP    +   L
Sbjct: 228  RMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVL 264


>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1025
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.98
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.94
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.94
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.78
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.78
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.77
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.71
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.68
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.98
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.52
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.5
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.29
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 98.25
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.91
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.71
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 96.9
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=0  Score=369.95  Aligned_cols=252  Identities=23%  Similarity=0.428  Sum_probs=205.1

Q ss_pred             CCEEEEECCEEEEEEEEC-CCC---EEEEEECCCC-CHHCHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCEEEEEEEC
Q ss_conf             763531033699999956-998---9999992544-01119999999999955999861232463535789804999961
Q 001700          737 AEVIGRSCHGTLYKATLD-SGS---ILAVKRLREG-IAKGKKEFAREVKKLGNIKHPNLVSLQGYYWGPKEHEKLVISNY  811 (1025)
Q Consensus       737 ~~~iG~G~~g~Vy~~~~~-~g~---~vavK~~~~~-~~~~~~~~~~E~~~l~~l~Hpniv~l~g~~~~~~~~~~~lv~e~  811 (1025)
                      .++||+|+||+||+|+++ +++   .||||++... .....++|.+|++++++++|||||+++|+|.  .....++||||
T Consensus        31 ~~~lG~G~fg~Vy~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l~HpnIv~l~g~~~--~~~~~~iv~Ey  108 (299)
T d1jpaa_          31 EQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVT--KSTPVMIITEF  108 (299)
T ss_dssp             EEEEEECSSSEEEEEEECC---CCEEEEEEECCSSCCHHHHHHHHHHHHHHTTCCCTTBCCEEEEEC--SSSSCEEEEEC
T ss_pred             EEEEEECCCEEEEEEEEECCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEE--ECCEEEEEEEE
T ss_conf             5698027882999999957997889999999784459899999999999998579988861899996--28877999972


Q ss_pred             CCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCEEEECCCCCCCCCCCC
Q ss_conf             46542999982129999999999999999999999999986399971258899997760699978996223521025688
Q 001700          812 INAQSLAVYLQETDPRKLPPLSIDERLRVAVDVARCLNYLHNERAIPHGNLKSTNILLEAPTMNAVLTDYSLHRILTSAG  891 (1025)
Q Consensus       812 ~~~gsL~~~l~~~~~~~~~~l~~~~~~~i~~~ia~aL~~LH~~~~ivHrdlkp~NILl~~~~~~~kl~Dfgla~~~~~~~  891 (1025)
                      +++|+|.+++.....    .++|.+++.++.|||+||+|||+ .+|+||||||+|||++. ++.+||+|||+++......
T Consensus       109 ~~~g~L~~~~~~~~~----~l~~~~~~~i~~qia~gl~yLH~-~~iiHrDlKp~NILl~~-~~~~Kl~DFGla~~~~~~~  182 (299)
T d1jpaa_         109 MENGSLDSFLRQNDG----QFTVIQLVGMLRGIAAGMKYLAD-MNYVHRDLAARNILVNS-NLVCKVSDFGLSRFLEDDT  182 (299)
T ss_dssp             CTTEEHHHHHHTTTT----CSCHHHHHHHHHHHHHHHHHHHH-TTCCCSCCCGGGEEECT-TCCEEECCC----------
T ss_pred             CCCCCCEEEECCCCC----CCCHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCCEEEECC-CCCEEECCCCCCEECCCCC
T ss_conf             279853002104567----99999999999999998898852-79835761504489889-9919988844315756777


Q ss_pred             CCC----CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             755----10357445447533346888999970158999999999991-9989984335999752579999997521666
Q 001700          892 TAD----QVLNAGALGYRPPEFASTSKPCPSLKSDVYAFGIILLELLT-GKSSGEIVCVDPGVVDLTDWVRLLALENRSG  966 (1025)
Q Consensus       892 ~~~----~~~~~gt~~y~aPE~~~~~~~~~s~~~DV~SlGvil~ellt-G~~P~~~~~~~~~~~~l~~~~~~~~~~~~~~  966 (1025)
                      ...    .....||+.|+|||++.+..  ++.++|||||||++|||+| |+.||....    ..++..            
T Consensus       183 ~~~~~~~~~~~~~t~~y~aPE~~~~~~--~~~~sDvwS~Gvvl~el~t~g~~Pf~~~~----~~~~~~------------  244 (299)
T d1jpaa_         183 SDPTYTSALGGKIPIRWTAPEAIQYRK--FTSASDVWSYGIVMWEVMSYGERPYWDMT----NQDVIN------------  244 (299)
T ss_dssp             -------------CGGGSCHHHHHSCC--CCHHHHHHHHHHHHHHHHTTSCCTTTTCC----HHHHHH------------
T ss_pred             CCCEEEECCCCCCCCCCCCHHHHHCCC--CCCCCCCCCCHHHHHHHHHCCCCCCCCCC----HHHHHH------------
T ss_conf             765365025666883003878883699--78612144535789999867999999999----999999------------


Q ss_pred             CCCHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHHHHCCCC
Q ss_conf             3102342289999996589999999998813999-9999989999999630035
Q 001700          967 ECFDRLIMDGHDMEQPPRILSDMLQVALRCILPA-SERPDMMSVFEELSTIVLE 1019 (1025)
Q Consensus       967 ~~~d~~~~~~~~~~~~~~~~~~l~~l~~~Cl~~~-~~RPs~~ev~~~L~~i~~~ 1019 (1025)
                           .+..+.+++.+..++.++.+++.+||+.+ ++||||+||++.|+++...
T Consensus       245 -----~i~~~~~~~~~~~~~~~l~~li~~cl~~~P~~RPs~~ei~~~L~~~l~~  293 (299)
T d1jpaa_         245 -----AIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRN  293 (299)
T ss_dssp             -----HHHTTCCCCCCTTCCHHHHHHHHHHTCSSTTTSCCHHHHHHHHHHHHHS
T ss_pred             -----HHHCCCCCCCCCCCHHHHHHHHHHHCCCCHHHCCCHHHHHHHHHHHHCC
T ss_conf             -----9973788999742269999999997587976892999999999998418



>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure