Citrus Sinensis ID: 001745

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MLVLVGTMPSLASLVSLGSISVTGTTSCCSESSCCSLVKRVSLTKRNFKGKKRWVCKYSVTTQTTTTTTDFIEQGNGSAVSFDSNTFRGRNSDNDSDGDDNGIVLKPAPRPVLKSLGVKGGASVSGVNSMGWDPSRVGEDSDEEERNKVIESLDEVLEKAEKLETRNESGNVSVNKATLPNVSADTKNGRPMNSVGAKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKMESQLNIPPRPVQPPLRPQPKLQTKPSVASTPVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAGKFKDDYRKKGGPRKRIVDDDDEIPDEEASELIPGAARKGRKWTKASRKAAKLKAAKDAAPVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKRTLEEASASMASALEGAGIEL
cEEEEcccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccccccccccEEEEccccccccccHHHHHHHcccccccccccccccccEEEEEccccccccEEEcccccHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHcccccccccccccEEEccccccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccccEEEEEEEccccccccEEEEcccccEEEEEccccccccccccccccEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccEEEcEEEEccccccHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEcccEEEEEccEEEEEccccccccccHHHHHHccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHHHHHHHccccc
cEEEEcccccccccEEccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEccEEEcccccEEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHEEHccccHHHHHHHHccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccEEEEEcccEEHHHHHHHHHccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccccHHHccccccEEEEEccccccHHHHHHHHHHcccHccccccccccEEEEcEEEEEEccccEEEEEEccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHcccccHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccccEEEEEEEccccccccEEEEEccccEEEEEEcccccEEccccccccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHcEEcEEEEEcccHHHHHHHHHHHHcccccEEEEEEEcccccccHcHHHHHHHccEEEEEEcccccHHHHHHHHHccccEHHHHHHHHHHHHHHHHHHccccHHHHHEHEcHHHHHHHHcccccEEEEEEEEccEEEEcccEEEEEccEEEEEccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEHHHccHHHHHHHHHHHHHHccccc
mlvlvgtmpSLASLVSLgsisvtgttsccsessccslvkrvsltkrnfkgkkrwVCKYSvttqttttttdfieqgngsavsfdsntfrgrnsdndsdgddngivlkpaprpvlkslgvkggasvsgvnsmgwdpsrvgedsdeeERNKVIESLDEVLEKAEKLETrnesgnvsvnkatlpnvsadtkngrpmnsvgakksKTLKSVWKKGDSVASIQKVVketpktkvkkeepkmggdmkmesqlnipprpvqpplrpqpklqtkpsvastpvikkpvvlkdvgagqklstigeadsavknkerkpilidkfaskkpavdplisqavlaptkpgkgpagkfkddyrkkggprkrivddddeipdeeaselipgaarkgrkwTKASRKAAKLKAAKDAAPVKVEILEVGEKGMLIEELARNLAIGEGEILgslyskgikpegvqtLDKDMVKMICKDYevevldadpvkMEEMARkkdlfdeedldkledrppvltimghvdhgktTLLDHIRKTKVAAAEaggitqgigaykvqvpvdgklqpcvfldtpgheafgamrargarvTDIAVIVVAaddgirpqtNEAIAHAKAAGVPIVIAINkidkdganpERVMQELSsiglmpedwggdipmvqisalkgekvDDLLETIMLVAELQElkanphrnakgtvieaglhkskgpvatfilqngtlkkgdvvVCGEAFGKVRALfddsgnrvdeagpsipvqiiglngvpiagdefevvDSLDVAREKAEARAFSLRNERisakagdgkVTLSSLASAVsagklsgldlhqLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQatgdisasDVDLAVASKAIILgfnvkapgsvktyadnkgvEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSsgsgrvagcmvsegklvkgcgirvirdgktvhVGVLDSLRRVKENVKEVNaglecgvgaadyddleegdIIEAFNSIQRKRTLEEASASMASALEGAGIEL
MLVLVGTMPSLASLVSLGSISVTGttsccsessccslvkrvsltkrnfkgkkrwvckysvttqttttttdfieqgngsavsfdsntfrgrnsdndsdgddngivlkpaprpvlkslgvkggasvsgvnsmgwdpsrvgedsdeeerNKVIESLDEVLEKAEKletrnesgnvsvnkatlpnvsadtkngrpmnsvgakksktlksvwkkgdsvasiqkvvketpktkvkkeepkmggdmkMESQLNIPPRPVQPPLRPQPKLqtkpsvastpvikkpvvlkdvgagqklstigeadsavknkerkpilidkfaskkpavdplisqavlaptkpgkgpagkfkddyrkkggprkrivddddeipdeeaselipgaarkgrkwtkASRKAAklkaakdaapvkveilevgekgmLIEELARNLAIGEGEILgslyskgikpegVQTLDKDMVKMICKDYEvevldadpvkmEEMARkkdlfdeedldkLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINkidkdganPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELqelkanphrNAKGTVIeaglhkskGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARafslrnerisakagdgkvTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIIlgfnvkapgsvktyadnkgveirLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVkgcgirvirdgktvhvgvldslrrVKENvkevnaglecgvgaadyddlEEGDIIEAFNSIQRKRTLEEASASMAsalegagiel
MLVLVGTMPSLASLVSLGSISVTGTTsccsessccsLVKRVSLTKRNFKGKKRWVCKYSVttqttttttDFIEQGNGSAVSFDSNTFrgrnsdndsdgddngIVLKPAPRPVLKSLGVKGGASVSGVNSMGWDPSRVGEDSDEEERNKVIESLDEVLEKAEKLETRNESGNVSVNKATLPNVSADTKNGRPMNSVGAkksktlksvwkkGDSVASIQkvvketpktkvkkeepkMGGDMKMESQLNIpprpvqpplrpqpklqtkpSVASTPVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAGKFKDDYRKKGGPRKRIVddddeipdeeASELIPGAARKGRKWTkasrkaaklkaakdaapvkVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARkkdlfdeedldkledRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTdiavivvaaddgiRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGkvtlsslasavsagklsglDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKRTleeasasmasalegagIEL
**VLVGTMPSLASLVSLGSISVTGTTSCCSESSCCSLVKRVSLTKRNFKGKKRWVCKYSV*************************************************************************************************************************************************************************************************************************VVLK********************************************************************************************************************APVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDAD**************************PVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKD*********ELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAR****************************LASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNS*************************
MLVL***MPSLA*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************EVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARKK**********LEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAE***********************SLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRK****************AGI**
MLVLVGTMPSLASLVSLGSISV***********CCSLVKRVSLTKRNFKGKKRWVCKYSVTTQTTTTTTDFIEQGNGSAVSFDSNTFRGRNSDNDSDGDDNGIVLKPAPRPVLKSLGVKGGASVSGVNSMGWD**************KVIESLDEVLEKAEK*********VSVNKATLPNVSADTKNGRPMNSVGAKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKMESQLNIPPRPVQPPL*************STPVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAGKFKDDYRKKGGPRKRIVDDDDEIPDEEASELIPG************************APVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKRTLEEASASMASALEGAGIEL
MLV***TMPSLASL*SL**************SSCCSLVKRVSLTKRNFKGKKRWVCKYSVTTQTTTTTTDFIEQGNGSAVSF*******************GIVLKPAPRPVLKSL*****************************R*KVIESLDEVLEKAEKL******************************************************************************************************************************************************************************************************************************************APVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKRTLEEASAS************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVLVGTMPSLASLVSLGSISVTGTTSCCSESSCCSLVKRVSLTKRNFKGKKRWVCKYSVTTQTTTTTTDFIEQGNGSAVSFDSNTFRGRNSDNDSDGDDNGIVLKPAPRPVLKSLGVKGGASVSGVNSMGWDPSRVGEDSDEEExxxxxxxxxxxxxxxxxxxxxNESGNVSVNKATLPNVSADTKNGRPMNSVGAKKSKTLKSVWKKGDSVASIQKVVKETPKTKVKKEEPKMGGDMKMESQLNIPPRPVQPPLRPQPKLQTKPSVASTPVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGPAGKFKDDYRKKGGPRKRIVDDDDEIPDEEASELIPGAARKGRKWTKASRKAAKLKAAKDAAPVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKRTLEEASASMASALEGAGIEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1018 2.2.26 [Sep-21-2011]
Q9SHI11026 Translation initiation fa yes no 0.983 0.975 0.716 0.0
P579971012 Translation initiation fa N/A no 0.952 0.958 0.691 0.0
Q3MBZ71038 Translation initiation fa yes no 0.566 0.555 0.555 0.0
Q8YQJ11039 Translation initiation fa yes no 0.567 0.556 0.549 0.0
B7KIU21101 Translation initiation fa yes no 0.608 0.562 0.521 1e-180
P726891001 Translation initiation fa N/A no 0.574 0.584 0.525 1e-180
Q318P81128 Translation initiation fa yes no 0.599 0.540 0.518 1e-180
B2J9551056 Translation initiation fa yes no 0.566 0.546 0.552 1e-179
B0JU671010 Translation initiation fa yes no 0.571 0.576 0.533 1e-179
A2BYM01161 Translation initiation fa yes no 0.615 0.540 0.503 1e-176
>sp|Q9SHI1|IF2C_ARATH Translation initiation factor IF-2, chloroplastic OS=Arabidopsis thaliana GN=At1g17220 PE=2 SV=2 Back     alignment and function desciption
 Score = 1375 bits (3559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1038 (71%), Positives = 863/1038 (83%), Gaps = 37/1038 (3%)

Query: 1    MLVLVGTMPSLASLVSLG--SISVTGTTSCCSESSCCSLVKRVSLTKRNFKGKKRWVCKY 58
            MLVLVGTMPSLASLVSLG    SV+GT+S     +  +LVKRVSL++R+ KG K+W+C+Y
Sbjct: 4    MLVLVGTMPSLASLVSLGGACASVSGTSSS---DASYALVKRVSLSRRSVKGTKKWLCRY 60

Query: 59   SVTTQTTTTTTDFIEQGNGSAVSFDSNTFRGRNSDNDSDGDDNGIVLKPAPRPVLKSLGV 118
            SV++ TTTTT DFI   N ++VS DSN+FRG       DGDD+ +VLK  P+PVLK    
Sbjct: 61   SVSSSTTTTTADFIADQNNNSVSIDSNSFRG-----SKDGDDSEVVLKQTPKPVLKPPVA 115

Query: 119  KGGASVSGVNSMGW--DPSRVGEDSDEEERNKVIESLDEVLEKAEKLETR---NESGNVS 173
            +    + GVN+  W  D S  G+   EEERNKVIESL EVL+KAEKLE     N+ G  +
Sbjct: 116  RVERGL-GVNTAPWSKDLSNGGKFDGEEERNKVIESLGEVLDKAEKLEIPKPGNKEGGEA 174

Query: 174  VNKATLPNVSADTKNGRPMNSV--GAKKSKTLKSVWKKGDSVASIQKVVKETPKTKVK-- 229
            V  +     S++++NG   N+   G +K+KT+KSVW+KGD+VA++QKVVKE+PK   +  
Sbjct: 175  VKPSQPSANSSNSRNGSYANASDGGTRKTKTMKSVWRKGDAVAAVQKVVKESPKIFNRGV 234

Query: 230  KEEPKMGGDMKMESQLNIP------PRPVQPPLRPQPKLQTKPSVASTPVIKKPVVLKDV 283
            + EP+   + ++ ++   P      P   QPP+RPQP LQ KP VA  P +KK  +LKD+
Sbjct: 235  QTEPRTREEGEVNAKAGTPLAPPQPPFRPQPPVRPQPMLQGKPMVA--PPVKKSPILKDL 292

Query: 284  GAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKGP-AGKFK 342
            G   K     E DS+VK+KERKPIL+DKFASKK  VDP  SQAVLAPTKPGKGP + KF+
Sbjct: 293  GMAAKPLVSEEVDSSVKSKERKPILVDKFASKKKGVDPAASQAVLAPTKPGKGPPSNKFR 352

Query: 343  DDYRKK----GGPRKRIVDDDDEIPDEEASELIPGAARKGRKWTKASRKAAKLKAAKDAA 398
             ++R K      PR+RIV +DD   D++AS  I  + RKGRKW+KASRKA +L+AAKDAA
Sbjct: 353  VEHRNKKNASASPRRRIVAEDD--GDDDAS--ISRSGRKGRKWSKASRKAVRLQAAKDAA 408

Query: 399  PVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDKDMVKMICKDYE 458
            PVK EILEV E+GM IE+LA NLAIGEG+ILG LYSKGI+P+GV TLD++MVKMIC+DY+
Sbjct: 409  PVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVHTLDREMVKMICRDYD 468

Query: 459  VEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAA 518
            VEVLDAD VK+EEMA+K+  FDEEDLDKLEDRPPV+TIMGHVDHGKTTLLD+IRK+KVAA
Sbjct: 469  VEVLDADSVKVEEMAKKRQTFDEEDLDKLEDRPPVITIMGHVDHGKTTLLDYIRKSKVAA 528

Query: 519  AEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDG 578
            +EAGGITQGIGAYKV VPVDGKLQ CVFLDTPGHEAFGAMRARGARVTDIA+IVVAADDG
Sbjct: 529  SEAGGITQGIGAYKVSVPVDGKLQSCVFLDTPGHEAFGAMRARGARVTDIAIIVVAADDG 588

Query: 579  IRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQIS 638
            IRPQTNEAIAHAKAA VPIVIAINKIDK+GA+P+RVMQELSSIGLMPEDWGGD+PMVQIS
Sbjct: 589  IRPQTNEAIAHAKAAAVPIVIAINKIDKEGASPDRVMQELSSIGLMPEDWGGDVPMVQIS 648

Query: 639  ALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKG 698
            ALKGE VDDLLET+MLVAELQELKANPHRNAKG VIEAGL K+KGP ATFI+Q GTLK+G
Sbjct: 649  ALKGENVDDLLETVMLVAELQELKANPHRNAKGIVIEAGLDKAKGPFATFIVQKGTLKRG 708

Query: 699  DVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKA 758
            DVVVCGEAFGKVRALFD SG RVDEAGPSIPVQ+IGLN VPIAGDEFE+V SLDVARE A
Sbjct: 709  DVVVCGEAFGKVRALFDHSGERVDEAGPSIPVQVIGLNNVPIAGDEFEIVSSLDVAREMA 768

Query: 759  EARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQ 818
            EARA SLR+ERISAKAGDGKVTLSSLASAVSA K+SGLDLHQLN+I+KVDVQGSIEAVRQ
Sbjct: 769  EARAVSLRDERISAKAGDGKVTLSSLASAVSAKKMSGLDLHQLNIILKVDVQGSIEAVRQ 828

Query: 819  ALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIR 878
            ALQVLPQ+NVTLKFLLQATGD+S SDVDLA AS+AI+ GFNVKA GSVK  A+NKGVEIR
Sbjct: 829  ALQVLPQENVTLKFLLQATGDVSNSDVDLASASEAIVFGFNVKASGSVKKAAENKGVEIR 888

Query: 879  LYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCMVSEGKLVKGCG 938
            LYRVIY+LIDD+RNAMEGLLE+VEEQ+PIGSAEVRA FSSGSGRVAGCMV+EGK VK CG
Sbjct: 889  LYRVIYELIDDVRNAMEGLLESVEEQIPIGSAEVRATFSSGSGRVAGCMVNEGKFVKDCG 948

Query: 939  IRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDIIEAFNSIQRKR 998
            IRV+R GKTVHVGVLDSL+RVKENVKEV+AGLECG+G  DYDD  EGDIIEAFN++Q++R
Sbjct: 949  IRVVRKGKTVHVGVLDSLKRVKENVKEVSAGLECGIGMDDYDDWIEGDIIEAFNAVQKRR 1008

Query: 999  TLEEASASMASALEGAGI 1016
            TLEEASASM++A+E AG+
Sbjct: 1009 TLEEASASMSAAIEEAGV 1026
One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex.
Arabidopsis thaliana (taxid: 3702)
>sp|P57997|IF2C_PHAVU Translation initiation factor IF-2, chloroplastic OS=Phaseolus vulgaris GN=IF2CP PE=2 SV=1 Back     alignment and function description
>sp|Q3MBZ7|IF2_ANAVT Translation initiation factor IF-2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q8YQJ1|IF2_NOSS1 Translation initiation factor IF-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|B7KIU2|IF2_CYAP7 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7424) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|P72689|IF2_SYNY3 Translation initiation factor IF-2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|B2J955|IF2_NOSP7 Translation initiation factor IF-2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
2555841761033 mitochondrial translational initiation f 0.979 0.965 0.747 0.0
2240614371020 predicted protein [Populus trichocarpa] 0.956 0.954 0.740 0.0
2241175421031 predicted protein [Populus trichocarpa] 0.974 0.962 0.736 0.0
2978446621027 hypothetical protein ARALYDRAFT_471925 [ 0.984 0.975 0.718 0.0
152200551026 translation initiation factor IF-2 [Arab 0.983 0.975 0.716 0.0
136058891026 At1g17220/F20D23_8 [Arabidopsis thaliana 0.983 0.975 0.715 0.0
57347461016 Similar to translation initiation factor 0.976 0.978 0.714 0.0
1478107151005 hypothetical protein VITISV_024584 [Viti 0.950 0.963 0.724 0.0
4494669391023 PREDICTED: translation initiation factor 0.974 0.969 0.700 0.0
3594944771047 PREDICTED: LOW QUALITY PROTEIN: translat 0.944 0.918 0.719 0.0
>gi|255584176|ref|XP_002532827.1| mitochondrial translational initiation factor, putative [Ricinus communis] gi|223527418|gb|EEF29557.1| mitochondrial translational initiation factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1419 bits (3672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1051 (74%), Positives = 890/1051 (84%), Gaps = 54/1051 (5%)

Query: 1    MLVLVGTMPSLASLVSLGSISVTGTTSCCSESSCCS---LVKRVSLTKRNFKGKKRW--V 55
            M+VLVG+MPSLASL+SLGS+SV   TS  S+S   S   LV+RVSL+KR  K  KRW  V
Sbjct: 4    MVVLVGSMPSLASLISLGSLSVAAATSSSSDSYYSSSYSLVRRVSLSKRGLKSAKRWHCV 63

Query: 56   CKYSVTTQTTTTTTDFI-EQGNGSAVSFDSN-TFRGRNSDNDSDGDDNGIVLKPAPRPVL 113
            CK SVTT      TDFI +QGN  AVS DSN +FR  ++  D+D +   I+LKPAPRPVL
Sbjct: 64   CKCSVTT------TDFIADQGN--AVSIDSNNSFRASSNGGDADSE---ILLKPAPRPVL 112

Query: 114  K-SLGVKG----GASVSGVNSMGWDPSRVGEDSDEEERNKVIESLDEVLEKAEKLETRNE 168
            K SLG KG    G S S +NS   D      + DE+ERNKVIESL EVLEKAEKLET   
Sbjct: 113  KPSLGSKGDSLLGMSSSQLNSGDSD------NDDEQERNKVIESLGEVLEKAEKLETSKP 166

Query: 169  SG----------NVSVNKATLPNVSADTKNGRPMNSVGAKKSKTLKSVWKKGDSVASIQK 218
            SG          N +VNK T PN+  +++  +  +S   +K+KTLKSVW+KGD+V+S+QK
Sbjct: 167  SGPGNPSSSGKDNGNVNKITPPNIGTNSRIAKSESSGATRKTKTLKSVWRKGDTVSSVQK 226

Query: 219  VVKETPK--TKVKKEEPKMGGDMKMESQLNIPPRPVQPPLRPQPKLQTKPSVASTPVIKK 276
            VVKE PK   K+ KE+   G   K+ESQ + P RPVQPPLRPQPKLQ KPSVA  PV+KK
Sbjct: 227  VVKEAPKVINKLVKEDTITGEGTKLESQSSFPLRPVQPPLRPQPKLQAKPSVAPPPVMKK 286

Query: 277  PVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPTKPGKG 336
            PV+LKDVGA  +    GEADS  KN  R+PIL+DKFA KKP VDPLI+QAVLAPTKPGKG
Sbjct: 287  PVILKDVGAAPRPPVSGEADS--KNNGRQPILVDKFARKKPVVDPLIAQAVLAPTKPGKG 344

Query: 337  PA-GKFKDDYRKK----GGPRKRIVDDDD-EIPDEEASEL---IPGAARKGRKWTKASRK 387
            PA GKFKD  RKK    GGPR+R+V++D+ EIPDEE SEL   IPG ARKGRKW+KASRK
Sbjct: 345  PAPGKFKD--RKKSISPGGPRRRLVNNDELEIPDEETSELNVSIPGTARKGRKWSKASRK 402

Query: 388  AAKLKAAKDAAPVKVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLDK 447
            AA+L+AAKDAAPVKVEILEVGE GMLIEELA NL I EGEILG LYSKGIKP+GVQTLDK
Sbjct: 403  AARLQAAKDAAPVKVEILEVGENGMLIEELAYNLTISEGEILGYLYSKGIKPDGVQTLDK 462

Query: 448  DMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGKTTL 507
            DMVKMICK+++VEV+D  PV+ EEMARK+++ DE+DLDKLEDRPPVLTIMGHVDHGKTTL
Sbjct: 463  DMVKMICKEHDVEVIDVAPVRFEEMARKREILDEDDLDKLEDRPPVLTIMGHVDHGKTTL 522

Query: 508  LDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVTD 567
            LD+IRK+KV A+EAGGITQGIGAYKV  PVDGK+QPCVFLDTPGHEAFGAMRARGARVTD
Sbjct: 523  LDYIRKSKVTASEAGGITQGIGAYKVLTPVDGKMQPCVFLDTPGHEAFGAMRARGARVTD 582

Query: 568  IAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPED 627
            IA+IVVAADDGIRPQTNEAIAHAKAAGVPIV+AINKIDKDGANPERVMQ+LSSIGLMPED
Sbjct: 583  IAIIVVAADDGIRPQTNEAIAHAKAAGVPIVVAINKIDKDGANPERVMQDLSSIGLMPED 642

Query: 628  WGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVAT 687
            WGGDIPMVQISALKG+ +DDLLET+MLVAELQELKANPHRNAKGTVIEAGL KSKGP+AT
Sbjct: 643  WGGDIPMVQISALKGDNIDDLLETVMLVAELQELKANPHRNAKGTVIEAGLDKSKGPIAT 702

Query: 688  FILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFEV 747
            FI+QNGTLK+GDVVVCGEAFGKVRALFDD G RVDEAGPSIPVQ+IGL+ VP AGDEFE 
Sbjct: 703  FIIQNGTLKRGDVVVCGEAFGKVRALFDDGGKRVDEAGPSIPVQVIGLSNVPKAGDEFEA 762

Query: 748  VDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKV 807
            V SLD+AREKAEARA  LRNERI+AKAGDGK+TLSSLASAVS+G+LSG+DLHQLN+I+KV
Sbjct: 763  VASLDIAREKAEARAELLRNERITAKAGDGKITLSSLASAVSSGRLSGIDLHQLNIILKV 822

Query: 808  DVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVK 867
            DVQGS+EAVRQALQVLPQDNVTLKFLLQATGD+S+SDVDLA+AS+AIILGFNVKAPGSVK
Sbjct: 823  DVQGSVEAVRQALQVLPQDNVTLKFLLQATGDVSSSDVDLAIASEAIILGFNVKAPGSVK 882

Query: 868  TYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGCM 927
            + A+NKGVEIRLYRVIYDLIDD+RNAMEGLLE VEEQ  IGSA VRA+FSSGSGRVAGCM
Sbjct: 883  SNAENKGVEIRLYRVIYDLIDDVRNAMEGLLEPVEEQETIGSAVVRAVFSSGSGRVAGCM 942

Query: 928  VSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGDI 987
            V++GK+VKGCG++VIR  KT+HVGVLDSLRRVKE VKEV+AGLECG+   DYDD EEGD 
Sbjct: 943  VTDGKVVKGCGVKVIRKRKTIHVGVLDSLRRVKELVKEVSAGLECGIAMEDYDDWEEGDT 1002

Query: 988  IEAFNSIQRKRTLEEASASMASALEGAGIEL 1018
            IEAFN++++KRTLEEASASMA+ALE AGI +
Sbjct: 1003 IEAFNTVEKKRTLEEASASMAAALEHAGINV 1033

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224061437|ref|XP_002300479.1| predicted protein [Populus trichocarpa] gi|222847737|gb|EEE85284.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117542|ref|XP_002317604.1| predicted protein [Populus trichocarpa] gi|222860669|gb|EEE98216.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297844662|ref|XP_002890212.1| hypothetical protein ARALYDRAFT_471925 [Arabidopsis lyrata subsp. lyrata] gi|297336054|gb|EFH66471.1| hypothetical protein ARALYDRAFT_471925 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220055|ref|NP_173165.1| translation initiation factor IF-2 [Arabidopsis thaliana] gi|334302824|sp|Q9SHI1.2|IF2C_ARATH RecName: Full=Translation initiation factor IF-2, chloroplastic; Flags: Precursor gi|332191439|gb|AEE29560.1| translation initiation factor IF-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13605889|gb|AAK32930.1|AF367343_1 At1g17220/F20D23_8 [Arabidopsis thaliana] gi|24111275|gb|AAN46761.1| At1g17220/F20D23_8 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5734746|gb|AAD50011.1|AC007651_6 Similar to translation initiation factor IF2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147810715|emb|CAN76368.1| hypothetical protein VITISV_024584 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449466939|ref|XP_004151183.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like [Cucumis sativus] gi|449528237|ref|XP_004171112.1| PREDICTED: translation initiation factor IF-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359494477|ref|XP_003634785.1| PREDICTED: LOW QUALITY PROTEIN: translation initiation factor IF-2, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
TAIR|locus:20204271026 FUG1 "fu-gaeri1" [Arabidopsis 0.711 0.705 0.723 3.4e-310
TIGR_CMR|CHY_1766827 CHY_1766 "translation initiati 0.562 0.692 0.453 5e-134
UNIPROTKB|Q9KU80898 infB "Translation initiation f 0.565 0.641 0.441 2.7e-128
TIGR_CMR|VC_0643898 VC_0643 "initiation factor IF- 0.565 0.641 0.441 2.7e-128
TIGR_CMR|BA_3950686 BA_3950 "translation initiatio 0.562 0.835 0.462 9.6e-128
TIGR_CMR|GSU_1588883 GSU_1588 "translation initiati 0.558 0.644 0.437 8.1e-125
UNIPROTKB|P0A705890 infB [Escherichia coli K-12 (t 0.565 0.647 0.425 2.4e-123
TIGR_CMR|SPO_0061835 SPO_0061 "translation initiati 0.565 0.689 0.441 3.6e-121
TIGR_CMR|SO_1204885 SO_1204 "translation initiatio 0.569 0.655 0.427 5.1e-121
TIGR_CMR|CPS_2203889 CPS_2203 "translation initiati 0.567 0.650 0.414 5.4e-118
TAIR|locus:2020427 FUG1 "fu-gaeri1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2635 (932.6 bits), Expect = 3.4e-310, Sum P(2) = 3.4e-310
 Identities = 530/733 (72%), Positives = 589/733 (80%)

Query:   272 PVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQAVLAPT 331
             P +KK  +LKD+G   K     E DS+VK+KERKPIL+DKFASKK  VDP  SQAVLAPT
Sbjct:   281 PPVKKSPILKDLGMAAKPLVSEEVDSSVKSKERKPILVDKFASKKKGVDPAASQAVLAPT 340

Query:   332 KPGKGP-AGKFKDDYRKK----GGPRKRIVXXXXXXXXXXASELIPGAARKGRKWTXXXX 386
             KPGKGP + KF+ ++R K      PR+RIV           S     + RKGRKW+    
Sbjct:   341 KPGKGPPSNKFRVEHRNKKNASASPRRRIVAEDDGDDDASISR----SGRKGRKWSKASR 396

Query:   387 XXXXXXXXXXXXXXXVEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQTLD 446
                             EILEV E+GM IE+LA NLAIGEG+ILG LYSKGI+P+GV TLD
Sbjct:   397 KAVRLQAAKDAAPVKAEILEVEEEGMSIEDLAYNLAIGEGDILGYLYSKGIRPDGVHTLD 456

Query:   447 KDMVKMICKDYEVEVLDADPVKMEEMARXXXXXXXXXXXXXXXRPPVLTIMGHVDHGKTT 506
             ++MVKMIC+DY+VEVLDAD VK+EEMA+               RPPV+TIMGHVDHGKTT
Sbjct:   457 REMVKMICRDYDVEVLDADSVKVEEMAKKRQTFDEEDLDKLEDRPPVITIMGHVDHGKTT 516

Query:   507 LLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGARVT 566
             LLD+IRK+KVAA+EAGGITQGIGAYKV VPVDGKLQ CVFLDTPGHEAFGAMRARGARVT
Sbjct:   517 LLDYIRKSKVAASEAGGITQGIGAYKVSVPVDGKLQSCVFLDTPGHEAFGAMRARGARVT 576

Query:   567 XXXXXXXXXXXXXRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPE 626
                          RPQTNEAIAHAKAA VPIVIAINKIDK+GA+P+RVMQELSSIGLMPE
Sbjct:   577 DIAIIVVAADDGIRPQTNEAIAHAKAAAVPIVIAINKIDKEGASPDRVMQELSSIGLMPE 636

Query:   627 DWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVA 686
             DWGGD+PMVQISALKGE VDDLLET+MLVAELQELKANPHRNAKG VIEAGL K+KGP A
Sbjct:   637 DWGGDVPMVQISALKGENVDDLLETVMLVAELQELKANPHRNAKGIVIEAGLDKAKGPFA 696

Query:   687 TFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDEFE 746
             TFI+Q GTLK+GDVVVCGEAFGKVRALFD SG RVDEAGPSIPVQ+IGLN VPIAGDEFE
Sbjct:   697 TFIVQKGTLKRGDVVVCGEAFGKVRALFDHSGERVDEAGPSIPVQVIGLNNVPIAGDEFE 756

Query:   747 VVDSLDVAREKAEARAFSLRNERISAKAGDGXXXXXXXXXXXXXXXXXXXDLHQLNVIMK 806
             +V SLDVARE AEARA SLR+ERISAKAGDG                   DLHQLN+I+K
Sbjct:   757 IVSSLDVAREMAEARAVSLRDERISAKAGDGKVTLSSLASAVSAKKMSGLDLHQLNIILK 816

Query:   807 VDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSV 866
             VDVQGSIEAVRQALQVLPQ+NVTLKFLLQATGD+S SDVDLA AS+AI+ GFNVKA GSV
Sbjct:   817 VDVQGSIEAVRQALQVLPQENVTLKFLLQATGDVSNSDVDLASASEAIVFGFNVKASGSV 876

Query:   867 KTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGSGRVAGC 926
             K  A+NKGVEIRLYRVIY+LIDD+RNAMEGLLE+VEEQ+PIGSAEVRA FSSGSGRVAGC
Sbjct:   877 KKAAENKGVEIRLYRVIYELIDDVRNAMEGLLESVEEQIPIGSAEVRATFSSGSGRVAGC 936

Query:   927 MVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLEEGD 986
             MV+EGK VK CGIRV+R GKTVHVGVLDSL+RVKENVKEV+AGLECG+G  DYDD  EGD
Sbjct:   937 MVNEGKFVKDCGIRVVRKGKTVHVGVLDSLKRVKENVKEVSAGLECGIGMDDYDDWIEGD 996

Query:   987 IIEAFNSIQRKRT 999
             IIEAFN++Q++RT
Sbjct:   997 IIEAFNAVQKRRT 1009
GO:0003743 "translation initiation factor activity" evidence=IEA;IGI;ISS
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0006413 "translational initiation" evidence=IEA;IGI
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TIGR_CMR|CHY_1766 CHY_1766 "translation initiation factor IF-2" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU80 infB "Translation initiation factor IF-2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0643 VC_0643 "initiation factor IF-2" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3950 BA_3950 "translation initiation factor IF-2" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1588 GSU_1588 "translation initiation factor IF-2" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A705 infB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0061 SPO_0061 "translation initiation factor IF-2" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1204 SO_1204 "translation initiation factor IF-2" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2203 CPS_2203 "translation initiation factor IF-2" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7U8L9IF2_SYNPXNo assigned EC number0.50630.61000.9553yesno
P57997IF2C_PHAVUNo assigned EC number0.69150.95280.9584N/Ano
Q9SHI1IF2C_ARATHNo assigned EC number0.71670.98330.9756yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
PRK05306746 PRK05306, infB, translation initiation factor IF-2 0.0
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 0.0
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 0.0
CHL00189742 CHL00189, infB, translation initiation factor 2; P 0.0
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 9e-92
PRK04004586 PRK04004, PRK04004, translation initiation factor 5e-63
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 3e-54
TIGR00491590 TIGR00491, aIF-2, translation initiation factor aI 6e-50
PRK148451049 PRK14845, PRK14845, translation initiation factor 3e-43
cd0370295 cd03702, IF2_mtIF2_II, This family represents the 8e-41
pfam11987109 pfam11987, IF-2, Translation-initiation factor 2 1e-37
cd0370195 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family rep 2e-34
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-33
cd0369284 cd03692, mtIF2_IVc, mtIF2_IVc: this family represe 1e-31
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 7e-24
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 3e-20
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 6e-19
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 1e-18
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 4e-18
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 1e-17
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 5e-17
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 9e-17
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 2e-16
cd00880161 cd00880, Era_like, E 7e-16
COG3276447 COG3276, SelB, Selenocysteine-specific translation 1e-15
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 1e-15
PRK10512614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 2e-15
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 1e-14
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 2e-14
COG0050394 COG0050, TufB, GTPases - translation elongation fa 2e-14
PRK12740 668 PRK12740, PRK12740, elongation factor G; Reviewed 4e-14
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 4e-14
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 4e-14
PRK13351 687 PRK13351, PRK13351, elongation factor G; Reviewed 5e-14
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 1e-13
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 2e-13
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 3e-13
CHL00071409 CHL00071, tufA, elongation factor Tu 3e-13
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 7e-13
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 2e-12
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 2e-12
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 2e-12
TIGR00484 689 TIGR00484, EF-G, translation elongation factor EF- 2e-12
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 4e-12
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 9e-12
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 1e-11
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 2e-11
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 2e-11
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 2e-11
COG1159298 COG1159, Era, GTPase [General function prediction 2e-11
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 4e-11
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 5e-11
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 7e-11
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 1e-10
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 2e-10
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 2e-10
cd04163168 cd04163, Era, E 2e-10
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 2e-10
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 3e-10
PRK00089292 PRK00089, era, GTPase Era; Reviewed 7e-10
PRK04000411 PRK04000, PRK04000, translation initiation factor 2e-09
PRK07560 731 PRK07560, PRK07560, elongation factor EF-2; Review 4e-09
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 5e-09
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 1e-08
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 1e-08
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 2e-08
TIGR00490 720 TIGR00490, aEF-2, translation elongation factor aE 2e-08
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 2e-08
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 5e-08
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provision 5e-08
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 9e-08
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 2e-07
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 3e-07
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 3e-07
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 4e-07
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 1e-06
PRK12739 691 PRK12739, PRK12739, elongation factor G; Reviewed 2e-06
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 2e-06
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 5e-06
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 5e-06
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 1e-05
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 2e-05
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 2e-05
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 2e-05
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 2e-05
PLN00116 843 PLN00116, PLN00116, translation elongation factor 2e-05
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 6e-05
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 9e-05
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 1e-04
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Revie 1e-04
PRK00007 693 PRK00007, PRK00007, elongation factor G; Reviewed 1e-04
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 2e-04
COG2262411 COG2262, HflX, GTPases [General function predictio 3e-04
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 3e-04
TIGR00436270 TIGR00436, era, GTP-binding protein Era 3e-04
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Pr 3e-04
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 6e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 8e-04
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 0.001
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
pfam0476052 pfam04760, IF2_N, Translation initiation factor IF 0.001
cd04165224 cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP 0.002
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 0.002
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 0.002
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 0.003
cd01878204 cd01878, HflX, HflX GTPase family 0.003
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 0.003
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 0.003
PRK00098298 PRK00098, PRK00098, GTPase RsgA; Reviewed 0.003
pfam00071162 pfam00071, Ras, Ras family 0.004
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 0.004
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information 
 Score =  823 bits (2129), Expect = 0.0
 Identities = 323/736 (43%), Positives = 452/736 (61%), Gaps = 28/736 (3%)

Query: 267 SVASTPVIKKPVVLKDVGAGQKLSTIGEADSAVKNKERKPILIDKFASKKPAVDPLISQA 326
           S       +K    ++     K      A +  + + +        A +          A
Sbjct: 36  STVEEEEARKEEAKREAEEEAKAEAEEAAAAEAEEEAKAEAAAAAPAEEAAEAAAAAEAA 95

Query: 327 VLAPTKPGKGPAGKFKDDYRKKGGPRKRIVDDDDEIPDEEASELIPGAARKGRKWTKASR 386
                     PA       + K   +K+      +   +  +       + G+   +   
Sbjct: 96  ARPAEDEAARPAEAAARRPKAKKAAKKKKGPKPKKKKPKRKAARGGKRGKGGKGRRRRRG 155

Query: 387 KAAKLKAAKDAAPVK--VEILEVGEKGMLIEELARNLAIGEGEILGSLYSKGIKPEGVQT 444
           +  + K  K   P +     + + E  + + ELA  +A+   E++  L+  G+     Q+
Sbjct: 156 RRRRRKKKKKQKPTEKIPREVVIPE-TITVAELAEKMAVKAAEVIKKLFKLGVMATINQS 214

Query: 445 LDKDMVKMICKDYEVEVLDADPVKMEEMARKKDLFDEEDLDKLEDRPPVLTIMGHVDHGK 504
           LD++  +++ +++  EV            +   L +++D + L  RPPV+TIMGHVDHGK
Sbjct: 215 LDQETAELLAEEFGHEV------------KLVSLLEDDDEEDLVPRPPVVTIMGHVDHGK 262

Query: 505 TTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRARGAR 564
           T+LLD IRKT VAA EAGGITQ IGAY+V+    GK+    FLDTPGHEAF AMRARGA+
Sbjct: 263 TSLLDAIRKTNVAAGEAGGITQHIGAYQVETN-GGKI---TFLDTPGHEAFTAMRARGAQ 318

Query: 565 VTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLM 624
           VTDI V+VVAADDG+ PQT EAI HAKAAGVPI++AINKIDK GANP+RV QELS  GL+
Sbjct: 319 VTDIVVLVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPGANPDRVKQELSEYGLV 378

Query: 625 PEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGP 684
           PE+WGGD   V +SA  GE +D+LLE I+L AE+ ELKANP R A+GTVIEA L K +GP
Sbjct: 379 PEEWGGDTIFVPVSAKTGEGIDELLEAILLQAEVLELKANPDRPARGTVIEAKLDKGRGP 438

Query: 685 VATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIPVQIIGLNGVPIAGDE 744
           VAT ++QNGTLK GD+VV G  +G+VRA+ DD+G RV EAGPS PV+I+GL+GVP AGDE
Sbjct: 439 VATVLVQNGTLKVGDIVVAGTTYGRVRAMVDDNGKRVKEAGPSTPVEILGLSGVPQAGDE 498

Query: 745 FEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLSGLDLHQLNVI 804
           F VV+    ARE AE R    R ++++ +    +V+L +L   +  G++      +LN+I
Sbjct: 499 FVVVEDEKKAREIAEYRQEKAREKKLARQQ---RVSLENLFEQMKEGEVK-----ELNLI 550

Query: 805 MKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPG 864
           +K DVQGS+EA++ +L+ L  D V +  +    G I+ SDV LA AS AII+GFNV+   
Sbjct: 551 IKADVQGSVEALKDSLEKLSTDEVKVNIIHSGVGAITESDVTLAAASNAIIIGFNVRPDA 610

Query: 865 SVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIF-SSGSGRV 923
             +  A+ +GV+IR Y +IYDLIDD++ AM G+LE   E+  IG AEVR +F  S  G +
Sbjct: 611 KARKLAEQEGVDIRYYSIIYDLIDDVKAAMSGMLEPEYEEEIIGQAEVREVFKVSKVGTI 670

Query: 924 AGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYDDLE 983
           AGCMV+EGK+ +   +RV+RDG  ++ G L+SL+R K++VKEV AG ECG+G  +Y+D++
Sbjct: 671 AGCMVTEGKIKRNAKVRVLRDGVVIYEGELESLKRFKDDVKEVRAGYECGIGLENYNDIK 730

Query: 984 EGDIIEAFNSIQRKRT 999
           EGDIIEA+  ++ KRT
Sbjct: 731 EGDIIEAYEMVEVKRT 746

Length = 746
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|237833 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information
>gnl|CDD|239673 cd03702, IF2_mtIF2_II, This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>gnl|CDD|221359 pfam11987, IF-2, Translation-initiation factor 2 Back     alignment and domain information
>gnl|CDD|239672 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|239663 cd03692, mtIF2_IVc, mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218250 pfam04760, IF2_N, Translation initiation factor IF-2, N-terminal region Back     alignment and domain information
>gnl|CDD|206728 cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP1)-like family includes GTPBP2 Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|234631 PRK00098, PRK00098, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1018
KOG1145683 consensus Mitochondrial translation initiation fac 100.0
PRK05306787 infB translation initiation factor IF-2; Validated 100.0
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 100.0
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 100.0
CHL00189742 infB translation initiation factor 2; Provisional 100.0
PRK04004586 translation initiation factor IF-2; Validated 100.0
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 100.0
PRK148451049 translation initiation factor IF-2; Provisional 100.0
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 100.0
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.97
PRK10218607 GTP-binding protein; Provisional 99.97
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.97
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.97
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.96
PRK12317425 elongation factor 1-alpha; Reviewed 99.96
PRK12736394 elongation factor Tu; Reviewed 99.96
PRK05433600 GTP-binding protein LepA; Provisional 99.96
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.96
PTZ00141446 elongation factor 1- alpha; Provisional 99.96
PLN00043447 elongation factor 1-alpha; Provisional 99.96
PRK12735396 elongation factor Tu; Reviewed 99.96
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.96
CHL00071409 tufA elongation factor Tu 99.96
PLN03127447 Elongation factor Tu; Provisional 99.96
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.96
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.96
PLN03126478 Elongation factor Tu; Provisional 99.95
COG1217603 TypA Predicted membrane GTPase involved in stress 99.95
PRK00049396 elongation factor Tu; Reviewed 99.95
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.95
KOG0462650 consensus Elongation factor-type GTP-binding prote 99.95
COG3276447 SelB Selenocysteine-specific translation elongatio 99.94
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.94
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.94
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.94
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.94
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.94
PRK12739691 elongation factor G; Reviewed 99.93
PRK00007693 elongation factor G; Reviewed 99.93
PRK00741526 prfC peptide chain release factor 3; Provisional 99.93
PRK13351687 elongation factor G; Reviewed 99.93
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.92
TIGR00503527 prfC peptide chain release factor 3. This translat 99.92
PRK07560 731 elongation factor EF-2; Reviewed 99.92
PRK12740668 elongation factor G; Reviewed 99.92
PF11987108 IF-2: Translation-initiation factor 2; InterPro: I 99.92
COG0050394 TufB GTPases - translation elongation factors [Tra 99.92
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.91
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.91
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.91
KOG0460449 consensus Mitochondrial translation elongation fac 99.91
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.91
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.9
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.89
KOG0461522 consensus Selenocysteine-specific elongation facto 99.89
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.88
COG5258527 GTPBP1 GTPase [General function prediction only] 99.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.87
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.87
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.87
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.85
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.85
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.84
PTZ00416 836 elongation factor 2; Provisional 99.84
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.84
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.83
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.83
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.82
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.82
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.82
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.82
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.82
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.82
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.82
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.82
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.82
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.81
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.81
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.81
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.81
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.81
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.81
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.81
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.81
cd00881189 GTP_translation_factor GTP translation factor fami 99.81
PTZ00369189 Ras-like protein; Provisional 99.81
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.81
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.81
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.81
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.8
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.8
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.8
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.8
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.8
KOG0465721 consensus Mitochondrial elongation factor [Transla 99.8
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.8
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.8
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.8
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.8
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.8
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.8
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.8
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.8
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.8
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.8
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.8
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.8
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.79
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.79
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.79
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.79
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.79
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.79
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.79
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.79
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.79
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.79
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.79
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.79
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.79
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.79
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.79
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.79
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.79
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.79
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.79
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.79
COG0486454 ThdF Predicted GTPase [General function prediction 99.78
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.78
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.78
cd0370295 IF2_mtIF2_II This family represents the domain II 99.78
KOG0394210 consensus Ras-related GTPase [General function pre 99.78
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.78
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.78
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.78
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.78
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.78
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.78
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.78
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.78
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.78
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.78
PRK04213201 GTP-binding protein; Provisional 99.78
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.77
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.77
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.77
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.77
COG1160444 Predicted GTPases [General function prediction onl 99.77
PLN00223181 ADP-ribosylation factor; Provisional 99.77
COG1160444 Predicted GTPases [General function prediction onl 99.77
PRK03003472 GTP-binding protein Der; Reviewed 99.77
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.77
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.77
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.77
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.77
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.77
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.77
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.77
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.77
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.77
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.77
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.77
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.77
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.77
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.77
PRK15494339 era GTPase Era; Provisional 99.77
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.77
PLN03118211 Rab family protein; Provisional 99.77
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.77
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.76
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.76
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.76
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.76
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.76
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.76
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.76
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.76
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.76
PTZ00133182 ADP-ribosylation factor; Provisional 99.75
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.75
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.75
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.75
PLN03110216 Rab GTPase; Provisional 99.75
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.75
PRK03003472 GTP-binding protein Der; Reviewed 99.75
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.75
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.75
PRK00093435 GTP-binding protein Der; Reviewed 99.75
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.75
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.75
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.74
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.74
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.74
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.74
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.74
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.74
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.74
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.74
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 99.74
PLN03108210 Rab family protein; Provisional 99.74
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.74
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.74
COG1159298 Era GTPase [General function prediction only] 99.73
PRK00093435 GTP-binding protein Der; Reviewed 99.73
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.73
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.73
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.73
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.72
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.72
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.72
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.71
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.71
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.7
PRK00089292 era GTPase Era; Reviewed 99.7
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.7
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.7
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.7
KOG0459501 consensus Polypeptide release factor 3 [Translatio 99.7
KOG0464753 consensus Elongation factor G [Translation, riboso 99.7
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.69
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.69
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.69
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.69
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.68
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.68
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.68
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.68
KOG0463641 consensus GTP-binding protein GP-1 [General functi 99.68
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.67
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.67
PRK12299335 obgE GTPase CgtA; Reviewed 99.67
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.65
PRK11058426 GTPase HflX; Provisional 99.64
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.64
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.64
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.64
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.64
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.63
PRK12298390 obgE GTPase CgtA; Reviewed 99.62
COG0218200 Predicted GTPase [General function prediction only 99.62
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.62
PRK12297424 obgE GTPase CgtA; Reviewed 99.62
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.62
PRK12296500 obgE GTPase CgtA; Reviewed 99.62
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.62
COG2229187 Predicted GTPase [General function prediction only 99.61
cd04105203 SR_beta Signal recognition particle receptor, beta 99.61
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.6
KOG0466466 consensus Translation initiation factor 2, gamma s 99.59
KOG1143591 consensus Predicted translation elongation factor 99.58
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.57
KOG0395196 consensus Ras-related GTPase [General function pre 99.56
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.54
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.54
COG1100219 GTPase SAR1 and related small G proteins [General 99.53
cd01896233 DRG The developmentally regulated GTP-binding prot 99.52
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.51
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.5
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.49
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.48
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.48
PTZ00099176 rab6; Provisional 99.48
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.47
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 99.47
PLN00023334 GTP-binding protein; Provisional 99.46
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.46
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.45
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.44
COG1084346 Predicted GTPase [General function prediction only 99.43
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.4
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.39
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.39
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.39
PRK09866741 hypothetical protein; Provisional 99.35
KOG0467 887 consensus Translation elongation factor 2/ribosome 99.34
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.33
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.31
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.31
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.3
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.29
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.29
COG2262411 HflX GTPases [General function prediction only] 99.28
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.23
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.22
COG1163365 DRG Predicted GTPase [General function prediction 99.21
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.17
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.17
KOG4252246 consensus GTP-binding protein [Signal transduction 99.13
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.12
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.12
COG0536369 Obg Predicted GTPase [General function prediction 99.12
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 99.1
COG3596296 Predicted GTPase [General function prediction only 99.08
PRK09602396 translation-associated GTPase; Reviewed 99.08
PRK13768253 GTPase; Provisional 99.03
KOG0090238 consensus Signal recognition particle receptor, be 99.03
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.0
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.0
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 98.99
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 98.98
PRK09435332 membrane ATPase/protein kinase; Provisional 98.89
KOG2486320 consensus Predicted GTPase [General function predi 98.87
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.86
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.86
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.84
PTZ00258390 GTP-binding protein; Provisional 98.83
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.82
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.82
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 98.81
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.81
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.81
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.8
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.79
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.79
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.76
KOG1673205 consensus Ras GTPases [General function prediction 98.74
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.71
KOG0410410 consensus Predicted GTP binding protein [General f 98.66
PRK09601364 GTP-binding protein YchF; Reviewed 98.66
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 98.64
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.58
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.58
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.57
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.56
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.5
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.44
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.43
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.38
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.38
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.35
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.31
COG0012372 Predicted GTPase, probable translation factor [Tra 98.3
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.3
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.28
KOG3886295 consensus GTP-binding protein [Signal transduction 98.25
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.24
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.23
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.13
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 98.1
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.08
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.07
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 98.06
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.04
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.02
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.01
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 98.0
PRK10416318 signal recognition particle-docking protein FtsY; 98.0
COG5019373 CDC3 Septin family protein [Cell division and chro 97.93
PRK09563287 rbgA GTPase YlqF; Reviewed 97.9
cd0369683 selB_II selB_II: this subfamily represents the dom 97.9
PRK12289352 GTPase RsgA; Reviewed 97.9
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.89
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.88
TIGR00064272 ftsY signal recognition particle-docking protein F 97.88
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.87
KOG3905473 consensus Dynein light intermediate chain [Cell mo 97.84
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.83
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.82
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.82
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.8
PRK09563287 rbgA GTPase YlqF; Reviewed 97.8
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.77
PRK00098298 GTPase RsgA; Reviewed 97.77
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.77
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.76
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 97.74
KOG0052391 consensus Translation elongation factor EF-1 alpha 97.72
PF0476054 IF2_N: Translation initiation factor IF-2, N-termi 97.71
cd0369085 Tet_II Tet_II: This subfamily represents domain II 97.71
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.7
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.7
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.68
PRK12736394 elongation factor Tu; Reviewed 97.67
PLN03126478 Elongation factor Tu; Provisional 97.66
PRK14974336 cell division protein FtsY; Provisional 97.63
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.63
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 97.61
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.61
COG1161322 Predicted GTPases [General function prediction onl 97.6
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 97.6
PRK12288347 GTPase RsgA; Reviewed 97.58
PRK01889356 GTPase RsgA; Reviewed 97.57
PLN00043 447 elongation factor 1-alpha; Provisional 97.57
PRK12735396 elongation factor Tu; Reviewed 97.56
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 97.55
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 97.54
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.54
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 97.52
PLN03127447 Elongation factor Tu; Provisional 97.52
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 97.51
TIGR00485394 EF-Tu translation elongation factor TU. This align 97.49
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.49
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.47
cd0368985 RF3_II RF3_II: this subfamily represents the domai 97.46
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.44
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.43
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.43
CHL00071409 tufA elongation factor Tu 97.42
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 97.41
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 97.4
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.39
PRK12317425 elongation factor 1-alpha; Reviewed 97.38
cd0369683 selB_II selB_II: this subfamily represents the dom 97.38
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.38
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.38
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.37
PRK00049396 elongation factor Tu; Reviewed 97.36
cd03112158 CobW_like The function of this protein family is u 97.35
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 97.34
KOG1491391 consensus Predicted GTP-binding protein (ODN super 97.33
PRK12289352 GTPase RsgA; Reviewed 97.33
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 97.3
COG1162301 Predicted GTPases [General function prediction onl 97.28
PRK13796365 GTPase YqeH; Provisional 97.23
KOG0082354 consensus G-protein alpha subunit (small G protein 97.21
PRK13796365 GTPase YqeH; Provisional 97.21
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 97.2
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 97.19
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 97.18
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 97.17
PTZ00141 446 elongation factor 1- alpha; Provisional 97.16
PRK12288347 GTPase RsgA; Reviewed 97.13
PRK00771437 signal recognition particle protein Srp54; Provisi 97.13
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 97.09
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 97.09
cd03114148 ArgK-like The function of this protein family is u 97.07
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 97.03
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 97.02
cd0369986 lepA_II lepA_II: This subfamily represents the dom 96.97
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 96.96
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.95
cd03115173 SRP The signal recognition particle (SRP) mediates 96.95
PRK04000411 translation initiation factor IF-2 subunit gamma; 96.94
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.92
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.89
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 96.84
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 96.8
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 96.78
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.71
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 96.67
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 96.62
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.61
TIGR00959428 ffh signal recognition particle protein. This mode 96.61
PRK13695174 putative NTPase; Provisional 96.59
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 96.57
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 96.55
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 96.55
PRK10867433 signal recognition particle protein; Provisional 96.54
PRK11537318 putative GTP-binding protein YjiA; Provisional 96.53
PRK00098298 GTPase RsgA; Reviewed 96.51
cd03110179 Fer4_NifH_child This protein family's function is 96.49
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.45
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 96.45
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.45
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 96.45
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 96.44
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 96.41
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.4
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.4
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 96.39
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 96.39
cd02036179 MinD Bacterial cell division requires the formatio 96.36
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.3
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.22
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.17
PRK05433 600 GTP-binding protein LepA; Provisional 96.12
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.09
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 95.99
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.96
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 95.96
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 95.96
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.94
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 95.93
COG0523323 Putative GTPases (G3E family) [General function pr 95.91
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.9
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 95.71
COG1162301 Predicted GTPases [General function prediction onl 95.62
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.58
COG3276 447 SelB Selenocysteine-specific translation elongatio 95.53
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 95.52
KOG3887347 consensus Predicted small GTPase involved in nucle 95.48
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 95.47
KOG2484435 consensus GTPase [General function prediction only 95.45
KOG2423572 consensus Nucleolar GTPase [General function predi 95.4
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.39
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 95.25
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 95.25
COG3523 1188 IcmF Type VI protein secretion system component Va 95.01
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 94.95
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 94.69
COG1161322 Predicted GTPases [General function prediction onl 94.66
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.43
PRK05306 787 infB translation initiation factor IF-2; Validated 94.38
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 94.37
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.36
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 93.96
KOG0780483 consensus Signal recognition particle, subunit Srp 93.81
cd03111106 CpaE_like This protein family consists of proteins 93.5
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.46
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 93.4
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=8.6e-121  Score=1026.41  Aligned_cols=590  Identities=51%  Similarity=0.732  Sum_probs=527.6

Q ss_pred             CCCccHHHHHHHhCCCHHHHHHHHHhCCCcccc---cccCCH----HHHHHHHHhcCCceeecChhhhHHhhhhcccCCh
Q 001745          409 EKGMLIEELARNLAIGEGEILGSLYSKGIKPEG---VQTLDK----DMVKMICKDYEVEVLDADPVKMEEMARKKDLFDE  481 (1018)
Q Consensus       409 ~~~itv~eLa~~l~~~~~~iik~L~~~G~~~~i---n~~Ld~----e~~~lla~E~g~~v~~~~~~~~e~l~~~~~~~~e  481 (1018)
                      +..|++.+||..++.+..++...|+..|...+.   ...||.    +++++++.+|++.....+.. .++.........+
T Consensus        65 ~~~m~~~kla~~~~~~~~~v~e~l~sv~~a~~~~~~~~~ld~~~I~ev~~~~~~~~~~~~~~~~~~-~e~~~~~~~~~~~  143 (683)
T KOG1145|consen   65 WNYMTAAKLAAALKCSVDEVQEALLSVGFAYNLAIADSNLDTKGILEVVELILMKYRFVLLPAETS-VEEKAADVAPQPE  143 (683)
T ss_pred             cccccHHHHhhhhcCCHHHHHHHHHhccccccccccccccchHHHHHHHHHHhhccccccCChhhh-hhhhhhhcccCCc
Confidence            468999999999999999999999999883221   133444    45566677777655433221 2222222334456


Q ss_pred             hhhhccCCCCCEEEEEeCCCCCHHHHHHHHHcCcccccccCCceeeeeeEEEEEecCCceecEEEEeCCCccchHHHHHh
Q 001745          482 EDLDKLEDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDTPGHEAFGAMRAR  561 (1018)
Q Consensus       482 e~~~~l~~r~pkVaImGhvdvGKTTLLnrL~~~~v~~~e~gGiTqdIga~~V~i~~dgk~~~ItfIDTPGHE~F~~~r~r  561 (1018)
                      .+...+.+|||+|+||||+||||||||++|+++.++..+.+||||||++|.+.++ +|  ..++|+|||||.+|..||.|
T Consensus       144 a~p~~l~~RpPVVTiMGHVDHGKTTLLD~lRks~VAA~E~GGITQhIGAF~V~~p-~G--~~iTFLDTPGHaAF~aMRaR  220 (683)
T KOG1145|consen  144 ADPKLLEPRPPVVTIMGHVDHGKTTLLDALRKSSVAAGEAGGITQHIGAFTVTLP-SG--KSITFLDTPGHAAFSAMRAR  220 (683)
T ss_pred             cCHhhcCCCCCeEEEeecccCChhhHHHHHhhCceehhhcCCccceeceEEEecC-CC--CEEEEecCCcHHHHHHHHhc
Confidence            6778889999999999999999999999999999999999999999999999987 44  67999999999999999999


Q ss_pred             hhccCCEEEEEEecCCCCChhHHHHHHHHHHcCCCEEEEEecCCCCCCChHHHHHHHHhcCCCCCCCCCCCcEEEEecCC
Q 001745          562 GARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANPERVMQELSSIGLMPEDWGGDIPMVQISALK  641 (1018)
Q Consensus       562 g~~~ADiVILVVDAddGv~~QT~E~I~~ak~~gIPIIVVINKiDL~~a~~erv~~eL~e~gl~~e~~g~~vpiVeISAkt  641 (1018)
                      |++.+|+++|||+++||+|+||.|.|.|++.+++|+||++||||++++++++++.+|..+++..+.||++++++++||++
T Consensus       221 GA~vtDIvVLVVAadDGVmpQT~EaIkhAk~A~VpiVvAinKiDkp~a~pekv~~eL~~~gi~~E~~GGdVQvipiSAl~  300 (683)
T KOG1145|consen  221 GANVTDIVVLVVAADDGVMPQTLEAIKHAKSANVPIVVAINKIDKPGANPEKVKRELLSQGIVVEDLGGDVQVIPISALT  300 (683)
T ss_pred             cCccccEEEEEEEccCCccHhHHHHHHHHHhcCCCEEEEEeccCCCCCCHHHHHHHHHHcCccHHHcCCceeEEEeeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHHHHHhhhhcCCCCCCcceEEEEeeecCCCcEEEEEeEeeEEecCCEEEEccceeEEEEEeccCCCcc
Q 001745          642 GEKVDDLLETIMLVAELQELKANPHRNAKGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRV  721 (1018)
Q Consensus       642 GeGIdeLleaIl~lael~~lk~~p~r~~~g~ViEs~~dkg~G~VatglV~~GtLkvGD~Vv~G~~~gKVRaI~~~~g~~V  721 (1018)
                      |+|++.|.++++.++++++++++|..+++|+|+|+..++++|.++|++|++|||+.|+.++||.+|+|||+|+|++|+++
T Consensus       301 g~nl~~L~eaill~Ae~mdLkA~p~g~~eg~VIES~vdkg~G~~aT~iVkrGTLkKG~vlV~G~~w~KVr~l~D~nGk~i  380 (683)
T KOG1145|consen  301 GENLDLLEEAILLLAEVMDLKADPKGPAEGWVIESSVDKGRGPVATVIVKRGTLKKGSVLVAGKSWCKVRALFDHNGKPI  380 (683)
T ss_pred             CCChHHHHHHHHHHHHHhhcccCCCCCceEEEEEeeecCCccceeEEEEeccccccccEEEEechhhhhhhhhhcCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCccEEEeccCCCCCCCCeEEEecChHHHHHHHHHHHHHHHHHHHhhhcCCCccchhhhHHHhhcCccC-------
Q 001745          722 DEAGPSIPVQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGKVTLSSLASAVSAGKLS-------  794 (1018)
Q Consensus       722 ~eA~pg~~V~V~Gl~~vP~aGd~~~vv~~e~~Ar~~a~~r~~~~~~~~i~~~~~~~~~~l~~~~~~~~~~~~~-------  794 (1018)
                      ++|.||+||+|.||+++|+|||.++.|++++.||++.+.|....+++++.....+.+..++...+++...+..       
T Consensus       381 ~~A~Ps~pv~V~GwkdlP~aGD~vleVeSe~~Ar~~~~~R~~~~~~Ek~~~~~e~~~~~~~~~~~~~~a~r~~~~~~~~~  460 (683)
T KOG1145|consen  381 DEATPSQPVEVLGWKDLPIAGDEVLEVESEDRARKVLSKRKDESEQEKISRDLEDIEEQREEAAEALLAKREEGENIGRK  460 (683)
T ss_pred             cccCCCCceEeecccCCCCCCceEEEEecHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhhhhhhhccccc
Confidence            9999999999999999999999999999999999999999877766665433222233333333333221111       


Q ss_pred             -CCCc----ceeeEEEEcCCCccHHHHHHHHHhCCCCCeEEEEEEcccCCCCHhhHHHHHhcCCEEEEecCCCChhHHhH
Q 001745          795 -GLDL----HQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTY  869 (1018)
Q Consensus       795 -~~~~----~~l~vIiKaDv~GSlEAi~~~L~~l~~~~v~i~ii~~~VG~ItesDV~lA~as~aiIi~FnV~~~~~a~~~  869 (1018)
                       .++.    +.+|+|||+|++||+|||.++|+.|++++|+++|+|+|||+||++|++||.+++|||+||||+.++..+++
T Consensus       461 ~~v~~~~~~~~~niIiK~DV~GS~EAv~d~L~tl~~~~v~l~~v~~gVG~vtesDlelA~~~daiI~~FnV~~~~~~~~~  540 (683)
T KOG1145|consen  461 TRVELHEQNPLFNIIIKCDVQGSAEAVLDALSTLNSEQVKLNVVHSGVGPVTESDLELAQASDAIIYGFNVKASPSVKQL  540 (683)
T ss_pred             eecccccCCcceEEEEEecccchHHHHHHHHhhcCCCceEEEEEEeccCCCCcchhHHHHhcCcEEEEEecCCChHHHHH
Confidence             1233    34999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCceEEEechHhHHHHHHHHHHhcccccceeeeeeEeEEEEEEeecCC--c--eEEEEEEeeeeEeeCCcEEEeeCC
Q 001745          870 ADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIFSSGS--G--RVAGCMVSEGKLVKGCGIRVIRDG  945 (1018)
Q Consensus       870 A~~~~V~I~~~~IIY~Liddik~~~~~~l~~~~~e~~~G~A~V~~vF~~~~--g--~IaGc~V~~G~i~~~~~vrviR~g  945 (1018)
                      |++.||+|+.|||||+||||+++.|.+.|+|..+++++|+|+|+++|.++.  +  .||||+|++|++.+.+.+|++|||
T Consensus       541 a~~~gVkI~~~nVIY~LieDv~~~ls~rlp~v~e~~vvGea~Vl~~F~i~~~rkr~~VAGC~V~~G~~~K~~~~rlvR~g  620 (683)
T KOG1145|consen  541 AAAKGVKIRLYNVIYRLIEDVRELLSERLPPVEEQEVVGEAEVLATFDIREKRKRVPVAGCRVNNGVIKKSCKIRLVRNG  620 (683)
T ss_pred             HhccCceEeehhHHHHHHHHHHHHHHhhCCCceEEeeccceeeeeeEeeccccccccccceEeecceEeecceEEEEeCC
Confidence            999999999999999999999999999999999999999999999998643  3  499999999999999999999999


Q ss_pred             EEEEEEEEeeeecccccccccccCceeEEEEccCC-CCCCCCEEEEEEEEEeehhHHHHHH
Q 001745          946 KTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYD-DLEEGDIIEAFNSIQRKRTLEEASA 1005 (1018)
Q Consensus       946 ~vi~~G~i~SLk~~k~dV~ev~~G~EcGi~i~~f~-d~~~GD~ie~y~~~~~~~~l~~~~~ 1005 (1018)
                      +|||+|.|.||||.|+||++|++|.||||.|++|| +|++||+|+||+   .++.+++++.
T Consensus       621 ~vV~~G~l~SlKh~KedV~~vkkg~ECGl~~~d~~~~f~~GD~i~~ye---~k~i~~e~~~  678 (683)
T KOG1145|consen  621 KVVFEGELDSLKHLKEDVTEVKKGHECGLTFDDGNEDFKEGDKIQCYE---KKRILEETSW  678 (683)
T ss_pred             cEEEEechhHHhhhhhhhhhhcCCCeeeeEeccCCcCCCcCCEEEEee---hhhhhhhccc
Confidence            99999999999999999999999999999999999 999999999999   5666676554

>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF11987 IF-2: Translation-initiation factor 2; InterPro: IPR023115 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
1zo1_I501 If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col 1e-119
3izy_P537 Mammalian Mitochondrial Translation Initiation Fact 8e-98
2lkc_A178 Free B.St If2-G2 Length = 178 4e-54
1g7s_A594 X-Ray Structure Of Translation Initiation Factor If 1e-30
1g7r_A594 X-Ray Structure Of Translation Initiation Factor If 2e-28
1z9b_A135 Solution Structure Of The C1-Subdomain Of Bacillus 1e-17
1d1n_A99 Solution Structure Of The Fmet-Trnafmet Binding Dom 1e-16
3cb4_D599 The Crystal Structure Of Lepa Length = 599 9e-11
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 9e-11
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 1e-08
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 3e-08
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 2e-07
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 3e-06
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 6e-06
4ac9_A482 Crystal Structure Of Translation Elongation Factor 1e-05
2crv_A120 Solution Structure Of C-Terminal Domain Of Mitochon 2e-05
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 2e-05
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 2e-05
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 4e-05
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 4e-05
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 4e-05
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 5e-05
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 5e-05
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 5e-05
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 5e-05
2rdo_7 704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 1e-04
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 1e-04
3j0e_H 702 Models For The T. Thermophilus Ribosome Recycling F 1e-04
2xex_A 693 Crystal Structure Of Staphylococcus Aureus Elongati 1e-04
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 1e-04
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 1e-04
2d74_A419 Crystal Structure Of Translation Initiation Factor 1e-04
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 1e-04
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 1e-04
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 2e-04
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 2e-04
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 2e-04
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 2e-04
4fn5_A 709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 2e-04
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 2e-04
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 2e-04
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 3e-04
3zz0_A 693 Crystal Structure Of Ribosomal Elongation Factor (E 5e-04
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 6e-04
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 7e-04
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 7e-04
3zzt_A 693 Crystal Structure Of Staphylococcus Aureus Elongati 8e-04
>pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 Back     alignment and structure 
Iteration: 1

 Score =  427 bits (1099), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 241/511 (47%), Positives = 333/511 (65%), Gaps = 13/511 (2%)
Query: 490 RPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDT 549
           R PV+TIMGHVDHGKT+LL++IR TKVA+ EAGGITQ IGAY V+   +G +    FLDT
Sbjct: 3   RAPVVTIMGHVDHGKTSLLEYIRSTKVASGEAGGITQHIGAYHVETE-NGMI---TFLDT 58
Query: 550 PGHEAFGAMRARGARVTXXXXXXXXXXXXXRPQTNEAIAHAKAAGVPIVIAINKIDKDGA 609
           PGH AF +MRARGA+ T              PQT EAI HAKAA VP+V+A+NKIDK  A
Sbjct: 59  PGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAQVPVVVAVNKIDKPEA 118
Query: 610 NPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNA 669
           +P+RV  ELS  G++PE+WGG+   V +SA  G  +D+LL+ I+L AE+ ELKA     A
Sbjct: 119 DPDRVKNELSQYGILPEEWGGESQFVHVSAKAGTGIDELLDAILLQAEVLELKAVRKGMA 178
Query: 670 KGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIP 729
            G VIE+ L K +GPVAT +++ GTL KGD+V+CG  +G+VRA+ ++ G  V EAGPSIP
Sbjct: 179 SGAVIESFLDKGRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAGPSIP 238
Query: 730 VQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKAGDGXXXXXXXXXXXX 789
           V+I+GL+GVP AGDE  VV     ARE A  R    R  +++ +                
Sbjct: 239 VEILGLSGVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQ--------QKSKLENM 290
Query: 790 XXXXXXXDLHQLNVIMKVDVQGSIEAVRQALQVLPQDNVTLKFLLQATGDISASDVDLAV 849
                  ++H++N+++K DVQGS+EA+  +L  L  D V +K +    G I+ +D  LA 
Sbjct: 291 FANMTEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDEVKVKIIGSGVGGITETDATLAA 350
Query: 850 ASKAIILGFNVKAPGSVKTYADNKGVEIRLYRVIYDLIDDMRNAMEGLLETVEEQVPIGS 909
           AS AI++GFNV+A  S +   + + +++R Y VIY+LID+++ AM G+L    +Q  IG 
Sbjct: 351 ASNAILVGFNVRADASARKVIEAESLDLRYYSVIYNLIDEVKAAMSGMLSPELKQQIIGL 410
Query: 910 AEVRAIFSSGS-GRVAGCMVSEGKLVKGCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNA 968
           AEVR +F S   G +AGCMV+EG + +   IRV+RD   ++ G L+SLRR K++V EV  
Sbjct: 411 AEVRDVFKSPKFGAIAGCMVTEGVVKRHNPIRVLRDNVVIYEGELESLRRFKDDVNEVRN 470
Query: 969 GLECGVGAADYDDLEEGDIIEAFNSIQRKRT 999
           G+ECG+G  +Y+D+  GD+IE F  I+ +RT
Sbjct: 471 GMECGIGVKNYNDVRTGDVIEVFEIIEIQRT 501
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure
>pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 Back     alignment and structure
>pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Complexed With Gdp Length = 594 Back     alignment and structure
>pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Length = 594 Back     alignment and structure
>pdb|1Z9B|A Chain A, Solution Structure Of The C1-Subdomain Of Bacillus Stearothermophilus Translation Initiation Factor If2 Length = 135 Back     alignment and structure
>pdb|1D1N|A Chain A, Solution Structure Of The Fmet-Trnafmet Binding Domain Of Becillus Stearothermophillus Translation Initiation Factor If2 Length = 99 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|2CRV|A Chain A, Solution Structure Of C-Terminal Domain Of Mitochondrial Translational Initiationfactor 2 Length = 120 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
3izy_P537 Translation initiation factor IF-2, mitochondrial; 0.0
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 0.0
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 0.0
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 1e-106
1z9b_A135 Translation initiation factor IF-2; protein synthe 4e-39
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 5e-35
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 9e-34
1wb1_A482 Translation elongation factor SELB; selenocysteine 7e-22
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 2e-21
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 1e-20
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 4e-20
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 2e-17
2elf_A370 Protein translation elongation factor 1A; tRNA, py 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 4e-14
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 4e-14
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 5e-14
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 1e-12
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 1e-12
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 2e-12
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 2e-11
1f60_A458 Elongation factor EEF1A; protein-protein complex, 3e-11
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 5e-11
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 5e-11
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 8e-04
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 5e-11
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 1e-10
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 4e-10
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 4e-10
3t1o_A198 Gliding protein MGLA; G domain containing protein, 5e-10
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 2e-09
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 2e-09
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 3e-09
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 8e-05
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 1e-08
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 1e-08
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-08
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 2e-07
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 3e-07
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 1e-05
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-05
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 2e-05
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 5e-05
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 5e-05
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 9e-05
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 9e-05
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 1e-04
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 1e-04
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 1e-04
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 1e-04
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 1e-04
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 1e-04
3iby_A256 Ferrous iron transport protein B; G protein, G dom 1e-04
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 2e-04
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 3e-04
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 3e-04
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 6e-04
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 8e-04
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 9e-04
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 Back     alignment and structure
 Score =  753 bits (1947), Expect = 0.0
 Identities = 222/537 (41%), Positives = 310/537 (57%), Gaps = 38/537 (7%)

Query: 490 RPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVPVDGKLQPCVFLDT 549
           R PV+TIMGHVDHGKTTLLD +RKT+VAA EAGGITQ IGA+ V +P   K+    FLDT
Sbjct: 3   RSPVVTIMGHVDHGKTTLLDKLRKTQVAAMEAGGITQHIGAFLVSLPSGEKI---TFLDT 59

Query: 550 PGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGA 609
           PGH AF AMRARG +VTDI ++VVAADDG+  QT E+I HAK A VPIV+AINK DK  A
Sbjct: 60  PGHAAFSAMRARGTQVTDIVILVVAADDGVMKQTVESIQHAKDAHVPIVLAINKCDKAEA 119

Query: 610 NPERVMQELSSIGLMPEDWGGDIPMVQISALKGEKVDDLLETIMLVAELQELKANPHRNA 669
           +PE+V +EL +  ++ ED+GGD+  V +SAL GE +  L E  + +AE+ ELKA+P    
Sbjct: 120 DPEKVKKELLAYDVVCEDYGGDVQAVHVSALTGENMMALAEATIALAEMLELKADPTGAV 179

Query: 670 KGTVIEAGLHKSKGPVATFILQNGTLKKGDVVVCGEAFGKVRALFDDSGNRVDEAGPSIP 729
           +GTVIE+   K +GPV T I+Q GTL+KG ++V G+++ KVR +FD++G  V+EA PS+P
Sbjct: 180 EGTVIESFTDKGRGPVTTAIIQRGTLRKGSILVAGKSWAKVRLMFDENGRAVNEAYPSMP 239

Query: 730 VQIIGLNGVPIAGDEFEVVDSLDVAREKAEARAFSLRNERISAKA--------------- 774
           V IIG   +P AGDE   V+S   ARE  + R +    E+                    
Sbjct: 240 VGIIGWRDLPSAGDEILEVESEPRAREVVDWRKYEQEQEKNKEDLKLIEEKRKEHQEAHR 299

Query: 775 --------------GDGKVTLSSLASAVSAGKLSGLDLHQLNVIMKVDVQGSIEAVRQAL 820
                            K         +   +    D + L VI+K DV GS+EA+   +
Sbjct: 300 KDREKYGTVHWKERSYIKYREKRQQQPLKPKEKLERDSNVLPVIVKGDVDGSVEAILNVM 359

Query: 821 QVLPQ-DNVTLKFLLQATGDISASDVDLAVASKAIILGFNVKAPGSVKTYADNKGVEIRL 879
                     L  +    GDIS +DV+LA     +I GFNV A   ++  A  KGV+I+L
Sbjct: 360 DTYDASHECELDLVHFGVGDISENDVNLAETFHGVIYGFNVNAGNVIQQLAAKKGVKIKL 419

Query: 880 YRVIYDLIDDMRNAMEGLLETVEEQVPIGSAEVRAIF----SSGSGRVAGCMVSEGKLVK 935
           +++IY LI+D++  +   L  + E+ PIG A + A F          VAGC V +G++ K
Sbjct: 420 HKIIYRLIEDLQEELSSRLPCIVEEHPIGEASILATFSITEGKKKVPVAGCRVQKGQIEK 479

Query: 936 GCGIRVIRDGKTVHVGVLDSLRRVKENVKEVNAGLECGVGAADYD-DLEEGDIIEAF 991
               ++IR+G  +  G L SL+  K++   V  G++CG+   +   + + GD I  +
Sbjct: 480 QKKFKLIRNGHVIWKGSLISLKHHKDDTSVVKTGMDCGLSLDEEKIEFKVGDAIICY 536
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1z9b_A Translation initiation factor IF-2; protein synthesis translation intiation IF2 FMet-tRNA structure; NMR {Geobacillus stearothermophilus} Length = 135 Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Length = 99 Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Length = 120 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1018
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 5e-40
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 7e-37
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 3e-32
d1d1na_99 b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 6e-32
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 3e-30
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 5e-30
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 1e-29
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 6e-28
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 1e-27
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 9e-26
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 1e-24
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 2e-24
d1g7sa3131 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, 4e-24
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 5e-23
d1g7sa1101 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, 6e-22
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-21
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 6e-21
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 2e-19
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 1e-17
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 2e-15
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 9e-14
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 1e-13
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 1e-13
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 3e-13
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 5e-13
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 1e-12
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 2e-12
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 4e-12
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 1e-11
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-11
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 4e-11
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 1e-10
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 1e-10
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-10
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 4e-10
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 4e-10
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 9e-10
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 1e-09
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-09
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 2e-09
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-09
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 4e-09
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 5e-09
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 1e-08
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 2e-08
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 4e-08
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 5e-08
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-07
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 4e-07
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 7e-07
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 7e-07
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 4e-06
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 7e-05
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 1e-04
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 2e-04
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 2e-04
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 3e-04
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 3e-04
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 6e-04
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 0.003
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 0.004
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 0.004
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

 Score =  144 bits (365), Expect = 5e-40
 Identities = 55/195 (28%), Positives = 81/195 (41%), Gaps = 42/195 (21%)

Query: 496 IMGHVDHGKTTLLDHIRKT-----------------KVAAAEAGGITQGIGAYKVQVPVD 538
            +GHVDHGKTTL   +                    K     A GIT      + +    
Sbjct: 8   TIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPEERARGITINTAHVEYETAK- 66

Query: 539 GKLQPCVFLDTPGHEAFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVP-I 597
              +    +D PGH  +      GA   D A++VV+A DG  PQT E I  A+  GVP I
Sbjct: 67  ---RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYI 123

Query: 598 VIAINKIDK--DGANPERVMQELSSIGLMPEDWGGDIPMVQISALKG------------- 642
           V+ +NK+D   D    + V  E+  +    E  G ++P+++ SAL               
Sbjct: 124 VVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEQMHRNPKTRRG 183

Query: 643 -----EKVDDLLETI 652
                +K+ +LL+ I
Sbjct: 184 ENEWVDKIWELLDAI 198
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Length = 99 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1g7sa3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 131 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 101 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1018
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.97
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.96
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 99.96
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.95
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.95
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.95
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.95
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.95
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.95
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.95
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.94
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.94
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.93
d1g7sa3131 Initiation factor IF2/eIF5b, domain 3 {Archaeon Me 99.92
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.88
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.87
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.86
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.86
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.86
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.86
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.85
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.85
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.85
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.84
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.84
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.84
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.82
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.82
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.82
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.82
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.82
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.81
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.81
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.8
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.78
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.77
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.77
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.76
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.76
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.76
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.72
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.72
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.7
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.7
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.69
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.68
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.68
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.67
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.66
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.58
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.57
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.56
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.43
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.41
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.33
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.24
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.16
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.01
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.96
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 98.76
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.72
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.65
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.59
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.5
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 98.49
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 98.29
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 98.24
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 98.21
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 98.19
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 98.08
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 98.04
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 97.99
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.97
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.97
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.97
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 97.95
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 97.93
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 97.89
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 97.86
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.8
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 97.79
d1vmaa2213 GTPase domain of the signal recognition particle r 97.78
d2qy9a2211 GTPase domain of the signal recognition particle r 97.77
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.75
d1okkd2207 GTPase domain of the signal recognition particle r 97.75
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 97.75
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.72
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 97.67
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 97.63
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.56
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 97.56
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 97.49
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 97.48
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.35
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 97.32
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.3
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 97.27
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.2
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 97.2
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 97.17
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 97.05
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.98
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.71
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 96.63
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 96.53
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.52
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 96.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.98
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.88
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.72
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 94.53
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.56
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.64
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.81
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.68
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.54
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.82
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.78
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.77
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.48
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 90.21
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.02
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.98
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.83
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.56
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.26
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.24
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.1
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.07
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.0
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.75
d2awna2232 Maltose transport protein MalK, N-terminal domain 88.73
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.7
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 88.56
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 88.49
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.28
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.03
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 87.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 87.63
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 87.41
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 87.4
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.3
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.81
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.65
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.47
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.34
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 86.24
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 86.2
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 86.19
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 86.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.12
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.04
d2hyda1255 Putative multidrug export ATP-binding/permease pro 85.9
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 85.87
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 85.86
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 85.81
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 85.79
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 85.78
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.69
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 85.67
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.56
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 85.55
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 85.1
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.0
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.69
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 84.53
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.51
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 84.29
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.15
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 83.82
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 83.57
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 83.55
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 82.77
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.67
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.42
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.1
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.06
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.84
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 80.65
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 80.62
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 80.28
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 80.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 80.11
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=99.97  E-value=5.8e-30  Score=210.56  Aligned_cols=170  Identities=41%  Similarity=0.710  Sum_probs=135.4

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEEEE--------------CCCCEECEEEEECCCCC
Q ss_conf             7999899999289999789999998086323235882134305999972--------------19950219999299964
Q 001745          488 EDRPPVLTIMGHVDHGKTTLLDHIRKTKVAAAEAGGITQGIGAYKVQVP--------------VDGKLQPCVFLDTPGHE  553 (1018)
Q Consensus       488 ~~r~pkVaIIGhvdsGKTTLLn~L~k~kv~~se~gGiTqdI~a~~V~i~--------------~dgk~~~ItLIDTPGHE  553 (1018)
                      .-|.|+|+|+||+|||||||+++|++......+.+++|.++........              +.+....++|+|||||+
T Consensus         2 ~~r~p~IaIiGh~d~GKSTL~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iDtPGh~   81 (227)
T d1g7sa4           2 KIRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKKFSIRETLPGLFFIDTPGHE   81 (227)
T ss_dssp             EECCCEEEEECSTTSSHHHHHHHHHHHHHSCC----CCCBTTEEEEEHHHHHHHSCGGGGGCGGGGTCCEEEEECCCTTS
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHCCHHEECCCEEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCEE
T ss_conf             98998799996998549999999982366001457454531531232101223444332100110111342234641100


Q ss_pred             CHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCH---------------H------
Q ss_conf             1078899521037889999954899984389999999982999999996678899993---------------8------
Q 001745          554 AFGAMRARGARVTDIAVIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKIDKDGANP---------------E------  612 (1018)
Q Consensus       554 ~F~~~r~rgl~~ADiVILVVDAsdGv~~QT~E~I~~lk~~gIPIIVVINKiDl~~a~~---------------e------  612 (1018)
                      +|...+.+++..+|++|||+||.+|+++|+.+++..+...++|+|+++||+|+.....               .      
T Consensus        82 ~f~~~~~~~~~~~D~~ilVvda~~g~~~~~~~~~~~~~~~~~p~iivlNK~D~~~~~~~~~~~~~~~~~~~~~~~v~~~~  161 (227)
T d1g7sa4          82 AFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKIDRIHGWRVHEGRPFMETFSKQDIQVQQKL  161 (227)
T ss_dssp             CCTTSBCSSSBSCSEEEEEEETTTCCCHHHHHHHHHHHHTTCCEEEEEECGGGSTTCCCCTTCCHHHHHTTSCHHHHHHH
T ss_pred             CCCCCCHHCCCCCCEEEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             00011100012464589998612376320257777764379759999989307881455446788875420308889899


Q ss_pred             -----HHHHHHHHCCC------CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             -----99999985298------8888799985999713899995899999999999
Q 001745          613 -----RVMQELSSIGL------MPEDWGGDIPMVQISALKGEKVDDLLETIMLVAE  657 (1018)
Q Consensus       613 -----rv~~eL~e~gl------~~e~~gg~vpvV~ISAktGeGIdeLlE~Ii~lae  657 (1018)
                           +....+...++      ....|....+++++||++|.|+++|++.|..+++
T Consensus       162 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~i~pvSa~~G~gid~Ll~~l~~l~~  217 (227)
T d1g7sa4         162 DTKVYELVGKLHEEGFESERFDRVTDFASQVSIIPISAITGEGIPELLTMLMGLAQ  217 (227)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEGGGCSCTTTEEEEEECCTTTCTTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999986656665123100157774999348989899999999999999
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure