Citrus Sinensis ID: 001746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MYARRLKCKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDKGEKGKTRREKVKEDAKNKDAHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDFADDSSDCESDNYEETSESEVEDENDASNEEEWTSSNEARTDGSDSEADMQATAEAALKKLVPFNLEELEKLSGELDSSSESSKSEAAEPSDTSKRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYEVNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGEGGSRRKSPFGF
cccccccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccHHccccEEEEEcccccccccHHHHcccccccccccccccccccccccccccccEEEEccccccEEccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEccHHccccccccccHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccc
ccEEEEEEccccEEEEEEccccEEEccEEEcccccccccccccHHHHHHcccEHHHHHcccccccccEEccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHcccccccEEccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccHHcccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHcHcccccccccccccccccccccccccccccccEEEEEcccccccccccEEcccEEccccccccEEccccccccccccEEEEEEEccccEEEEEEEcccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccEHHHHHHHHHHHHccHHHHccccccccccccHHHHHHcccEEEEcccccHHHHHHHccccccccEEEEEcccHHHHHHHHcccccccccccEEcccccccHHHHHHHHHcHHHHHHHHHccHHHHHHccEEcccccccccHHHHHHcccccccHHHHHHcccHHHHHHHccccccccccccccHccccHHHHHHHHHHHHHHcccccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHcccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHcccccHccccccHHHHHHHHHHccccccHHHHcccccccHHHHccccccEEEccccc
myarrlkcksqrwgsvfqpsknsfgqdrltdracsqsfshasalrnhskdgslirryflgsipsrgvvrsslcsnriqlcafsseadgrnasgnnrkpvddganfdkgekgktRREKVKEDAKNKDAHARLGEHEQKEWLNNEKAAIESkkrespfltrRERFKNEFsrrivpwekiniswdtfpyyineNTKSLLVECVGshlkhkkftatfgarltsssgrillrsvpgtELYRERLIRALARELQVPLLvldssvlapydfaddssdcesdnyeetsesevedendasneeewtssneartdgsdseADMQATAEAALKKLVPFNLEELEKLSgeldsssesskseaaepsdtskrllkkgdrvkyigpsvrveadnrIILGkimtsdgpknaytiipdralssgqrgevyevngdrAAVILDIsadnkgegekddkvaeqparppvywidvKHIEHDLDTQAEDCYIAMEALCEVLhstqplivyfpdsslwlsravprcnrKEFVRKVEEMFDQLSGPVVLicgqnknetgpkekeKFTMIlpnfgrlaklplplqrlTEGLKatkrsddnEIYNLFTNvlsihppkeeDLLRTFNKQVEEDRRIVIYRSNLNELHKVLedhelsctdllhvntdgvilTKQRAEKVVGWAKnhylsscsfpsvkgqrlhlprESLEIAILRLKEqetasrkptqnlknlakdeyesnfvsavvppgeigvrfddIGALEDVKKALNELVIlpmrrpdlfsrgnllrpckgillfgppgtgKTLLAKALATEAGanfisitgstltskwfGDAEKLTKALFSFASKLAPVIIFVDEVDSllgarggafehEATRRMRNEFMSAWDGLRSKESQKILILgatnrpfdlddavirrlprriyvdlpdaENRMKILRIFLAHEslesgfqfnelanategysgsdlkNLCIAAAYRPVQELLEEERKrgkndaapvlrplklEDFIQSKakvgpsvaydAASMNELRKWNEqygeggsrrkspfgf
myarrlkcksqrwgsvfqpsknsfgqdrLTDRACSQSFSHAsalrnhskdgsLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFsseadgrnasgnnrkpvddganfdkgekgktrrekvkedaknkdaharlgeheqkewlnnekaaieskkrespfltrrerfknefsrrivpwekiniswDTFPYYINENTKSLLVECVGSHLKHKKFtatfgarltsssgrillrsvpgtELYRERLIRALARELQVPLLVLDSSVLAPYDFADDSSDCESDNYEetsesevedendasneeewtssneartdgsdSEADMQATAEAALKKLVPFNLEELEKLSgeldsssesskseaaepsdtskrllkkgdrvkyigpsvrveadnriilgkimtsdgpknaytiipdralssgqRGEVYEVNGDRAAVILDIsadnkgegekddkvaeqparPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEmfdqlsgpvvlICGQNknetgpkekekFTMILPNfgrlaklplpLQRLTEGLkatkrsddneIYNLFTnvlsihppkeEDLLRTFNkqveedrriVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYlsscsfpsvkgqrlhLPRESLEIAILRlkeqetasrkptqnlknlakdeyesnfvsavvppgeiGVRFDDIGALEDVKKALNELVIlpmrrpdlfsrgNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGgafeheatrRMRNEFMSAWDGLRSKESQKILIlgatnrpfdlddavirrlprriyvdlpdaeNRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEErkrgkndaapvlrplklEDFIQSKAKVGPSVAYDAASMNELRKWneqygeggsrrkspfgf
MYARRLKCKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDKGEKGKTRREKVKEDAKNKDAHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTelyrerliralarelQVPLLVLDSSVLAPYDFADDSSDCESDNYeetsesevedeNDASNEEEWTSSNEARTDGSDSEADMQATAEAALKKLVPFNleeleklsgeldsssesskseaaePSDTSKRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYEVNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPgtgktllakalateagaNFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGEGGSRRKSPFGF
***************************************************SLIRRYFLGSIPSRGVVRSSLCSNRIQLCAF********************************************************************************FKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDF*****************************************************************************************************RVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALS***RGEVYEVNGDRAAVILDI*********************PVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQ***********KFTMILPNFGRLAKLPLPLQRLTEGLKA*****DNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILR***********************ESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQEL**********************DFI****************************************
*******CKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRY********************************************************************************************************RFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVL****************************************************************************************************LLKKGDRVKYIGPSVRVEADNRIILGKIMTS********************GEVYEVNGDRAAVILD*******************ARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVP*CNRKEFVRKVEEMFDQLSGPVVLICG*N****************PNFGRLAKLPLPL***************NEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIY*SNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNH**************************************************YESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDS******************NEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQEL*****************PLKLEDFIQSKA*************NEL********************
***********RWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDKG******************AHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDFADD**********************************************QATAEAALKKLVPFNLEELEKL**********************KRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYEVNGDRAAVILDISADN************QPARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQ**************
MYARRLKCKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFSSE*********************************************************E*A*IESKKRESPFLTRRERFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDF***********************************************************************************************LLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYEVNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGAR****EHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKR**NDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGEGGSRRK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYARRLKCKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFLGSIPSRGVVRSSLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDKGEKGKTRREKVKEDAKNKDAHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEFSRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDFADDSSDCESDNYEETSESEVEDENDASNEEEWTSSNEARTDGSDSEADMQATAEAALKKLVPFNLEELEKLSGELDSSSESSKSEAAEPSDTSKRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYEVNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIEHDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGEGGSRRKSPFGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1018 2.2.26 [Sep-21-2011]
Q7ZZ25380 ATPase family AAA domain- yes no 0.266 0.713 0.433 6e-65
F6QV99361 ATPase family AAA domain- yes no 0.286 0.808 0.427 3e-64
Q9D5T0361 ATPase family AAA domain- yes no 0.286 0.808 0.427 3e-64
Q8NBU5361 ATPase family AAA domain- yes no 0.286 0.808 0.427 3e-64
P28737362 Protein MSP1 OS=Saccharom yes no 0.281 0.792 0.433 6e-64
Q505J9361 ATPase family AAA domain- yes no 0.292 0.825 0.413 1e-63
Q5ZK92613 Spastin OS=Gallus gallus yes no 0.298 0.495 0.437 2e-63
Q503W7362 ATPase family AAA domain- no no 0.275 0.773 0.423 2e-63
Q6NW58570 Spastin OS=Danio rerio GN no no 0.300 0.536 0.424 3e-63
Q6AZT2600 Spastin OS=Xenopus laevis N/A no 0.296 0.503 0.431 4e-63
>sp|Q7ZZ25|ATD1A_DANRE ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2 Back     alignment and function desciption
 Score =  249 bits (637), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 185/277 (66%), Gaps = 6/277 (2%)

Query: 689 KEQETASRKPTQNLKNLAKD-----EYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNE 743
           K++  A ++  Q +K +  +     EYE N  + +V P  I V + D+  L+++   + +
Sbjct: 49  KQKSQAKKRAEQLMKQIGVEGVSLTEYEMNIATLLVDPRSIKVTWRDVAGLDEIISEMQD 108

Query: 744 LVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSK 803
            VILP ++  LFS   LL+P KG+LL+GPPG GKTL+AKA A  +G  FI++  STLT K
Sbjct: 109 TVILPFQKRHLFSGSKLLQPPKGVLLYGPPGCGKTLIAKATAKASGCRFINLQASTLTDK 168

Query: 804 WFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLR 863
           W+G+++KLT A+FS A K+ P IIF+DE+DS L  R  + +HEAT  M+ +FMS WDGL 
Sbjct: 169 WYGESQKLTAAVFSLAVKIQPCIIFLDEIDSFLRNR-SSMDHEATAMMKAQFMSLWDGLD 227

Query: 864 SKESQKILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQF 923
           + E+ +++++GATNRP D+D A++RR+P   +V LP+A  R +ILR+ L+ E+L +    
Sbjct: 228 TGENSQVMVMGATNRPQDVDAAILRRMPTAFHVGLPNAAQREEILRLILSGENLSNAINL 287

Query: 924 NELANATEGYSGSDLKNLCIAAAYRPVQELLEEERKR 960
            E+A+ +EGYSGSDLK LC  AA   V++ + +++ +
Sbjct: 288 KEIASQSEGYSGSDLKELCRDAAMYRVRDYVRKQQMK 324
ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR). Required for NMDA-stimulated AMPAR internalization in an ATPase-dependent manner.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 3
>sp|F6QV99|ATAD1_BOVIN ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2 Back     alignment and function description
>sp|Q9D5T0|ATAD1_MOUSE ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1 Back     alignment and function description
>sp|Q8NBU5|ATAD1_HUMAN ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1 Back     alignment and function description
>sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 Back     alignment and function description
>sp|Q505J9|ATAD1_RAT ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 Back     alignment and function description
>sp|Q503W7|ATD1B_DANRE ATPase family AAA domain-containing protein 1-B OS=Danio rerio GN=atad1b PE=2 SV=2 Back     alignment and function description
>sp|Q6NW58|SPAST_DANRE Spastin OS=Danio rerio GN=spast PE=2 SV=2 Back     alignment and function description
>sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
2254237671032 PREDICTED: uncharacterized protein LOC10 0.991 0.977 0.728 0.0
3565443971017 PREDICTED: uncharacterized protein LOC10 0.969 0.970 0.694 0.0
4494367091032 PREDICTED: uncharacterized protein LOC10 0.990 0.976 0.712 0.0
4494891221033 PREDICTED: uncharacterized LOC101214782 0.990 0.975 0.707 0.0
3565409881016 PREDICTED: uncharacterized protein LOC10 0.967 0.969 0.691 0.0
1864899571003 P-loop containing NTPase domain-containi 0.975 0.990 0.667 0.0
334185474993 P-loop containing nucleoside triphosphat 0.963 0.987 0.667 0.0
2978527061002 hypothetical protein ARALYDRAFT_891942 [ 0.975 0.991 0.666 0.0
2978348901003 hypothetical protein ARALYDRAFT_479491 [ 0.962 0.977 0.659 0.0
186489959981 P-loop containing NTPase domain-containi 0.953 0.989 0.653 0.0
>gi|225423767|ref|XP_002277238.1| PREDICTED: uncharacterized protein LOC100252512 [Vitis vinifera] gi|297737931|emb|CBI27132.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1472 bits (3811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/1039 (72%), Positives = 874/1039 (84%), Gaps = 30/1039 (2%)

Query: 1    MYARRL-KCKSQRWGSVFQPSKNSFGQDRLTDRACSQSFSHASALRNHSKDGSLIRRYFL 59
            MYARRL K ++ +W  VFQPSK  +   +  D   S+S    +   N S   +LIRRY  
Sbjct: 1    MYARRLLKNRNLKWDFVFQPSK-YYITPKHKDYMFSRSLCSRTLAGNCSLCDNLIRRYLS 59

Query: 60   GSIPSRGVVRS------------SLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDK 107
             S+ ++GV               SL S++++   +SSE DGRNAS +   PV DGAN DK
Sbjct: 60   DSLLTQGVAAGNSNVRLHGSFNVSLRSSQLRF--YSSEGDGRNASEDEHIPVKDGANLDK 117

Query: 108  GEKGKTRREKVKEDAKNKDAHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEF 167
            G   KT+R KV+E  ++ D H RLGE +QKEWLNNEK AIES+K+ESPFL+RRE+ KNEF
Sbjct: 118  G---KTKR-KVREAVRHCDEHIRLGEQDQKEWLNNEKLAIESRKKESPFLSRREKLKNEF 173

Query: 168  SRRIVPWEKINISWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLR 227
             RR+VPWEKI +SW+TFPY+I ++TK+LLVEC  SHLKHKKFT ++GARLTSSSGRILL+
Sbjct: 174  LRRVVPWEKITVSWETFPYHIPDHTKNLLVECAASHLKHKKFTVSYGARLTSSSGRILLQ 233

Query: 228  SVPGTELYRERLIRALARELQVPLLVLDSSVLAPYDFADD-SSDCESD--NYEET----S 280
            SVPGTELYRERL+RALAR+LQVPLLVLDSS+LA YDFA+  SS+CESD  N E      S
Sbjct: 234  SVPGTELYRERLVRALARDLQVPLLVLDSSILASYDFAEGCSSECESDDDNLESCEDCIS 293

Query: 281  ESEVEDENDASNEEEWTSSNEARTDGSDSEADMQATAEAALKKLVPFNLEELE-KLSGEL 339
            ESE+EDE+D+++EEEWTSS E ++D SD++ D+QA+AEA LKKLVP  L++ E +++ EL
Sbjct: 294  ESEIEDESDSNDEEEWTSSGEVKSDASDND-DVQASAEA-LKKLVPHKLKKFEQRVAAEL 351

Query: 340  DSSSESSKSEAAEPSDTSKRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTI 399
            + SSESS SEA E SD  K  LKKGDRVKY+GPS+ +EADNR+ILGKI T DGP NAYTI
Sbjct: 352  EISSESSTSEAVESSDKPKWSLKKGDRVKYVGPSIDIEADNRVILGKIPTCDGPTNAYTI 411

Query: 400  IPDRALSSGQRGEVYEVNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIE 459
               R LSSGQRGEVYEVNGDR AVILD S     EGE+D+K+ +Q  +P VYW+ VK IE
Sbjct: 412  FRGRPLSSGQRGEVYEVNGDRVAVILDRSEKKPNEGEEDEKLIDQAEKPSVYWMQVKDIE 471

Query: 460  HDLDTQAEDCYIAMEALCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQ 519
            +DLDT+ ED YIAMEALCEVLHSTQPLIVYFPDSS WL RAV + N+KEFV +V+EMFDQ
Sbjct: 472  YDLDTEGEDRYIAMEALCEVLHSTQPLIVYFPDSSQWLLRAVSKPNQKEFVCRVQEMFDQ 531

Query: 520  LSGPVVLICGQNKNETGPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIY 579
            LSGPVVLICGQNK E G KE+EKFTM++P  GRLAKLP+PL++LTEGLKATK S++NEI 
Sbjct: 532  LSGPVVLICGQNKTEAGSKEREKFTMLVPGLGRLAKLPVPLKQLTEGLKATKTSENNEIL 591

Query: 580  NLFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNT 639
             LF+NV+ I  PK+E+LLRTFNKQVEEDRRI+I RSNLNELHKVLE+H+LSC DLLHVNT
Sbjct: 592  KLFSNVICIDTPKDEELLRTFNKQVEEDRRIIISRSNLNELHKVLEEHQLSCMDLLHVNT 651

Query: 640  DGVILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPT 699
            DGVILTKQ+AEK+VGWAKNHYLSSC  PS+KG+RL +PRESLEIA+LRLK QE  SRKP+
Sbjct: 652  DGVILTKQKAEKIVGWAKNHYLSSCMLPSIKGERLSVPRESLEIAVLRLKVQEAISRKPS 711

Query: 700  QNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGN 759
             +LKNLAKDEYESNFVSAVVPPGEIGV+FDDIGALEDVKKALNELVILPMRRP+LFS GN
Sbjct: 712  HSLKNLAKDEYESNFVSAVVPPGEIGVKFDDIGALEDVKKALNELVILPMRRPELFSHGN 771

Query: 760  LLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFA 819
            LLRPCKGILLFGPPGTGKTLLAKALATEAGANFIS+TGS LTSKWFGDAEKLTKALFSFA
Sbjct: 772  LLRPCKGILLFGPPGTGKTLLAKALATEAGANFISVTGSNLTSKWFGDAEKLTKALFSFA 831

Query: 820  SKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRP 879
             KLAPVIIFVDEVDSLLGARGGAFEHEATR+MRNEFM+AWDGLRSK++Q+I+ILGATNRP
Sbjct: 832  GKLAPVIIFVDEVDSLLGARGGAFEHEATRKMRNEFMAAWDGLRSKDNQRIIILGATNRP 891

Query: 880  FDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLK 939
            FDLD+AVIRRLPRRIYVDLPDAENRMKILRIFLA E++E GFQF++LANATEGYSGSDLK
Sbjct: 892  FDLDEAVIRRLPRRIYVDLPDAENRMKILRIFLASENIEPGFQFDKLANATEGYSGSDLK 951

Query: 940  NLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELR 999
            NLC+AAAYRPVQELLEEE+K G +   PVLR L L+DFI+SKAKVGPSVA+DAASMNELR
Sbjct: 952  NLCVAAAYRPVQELLEEEQKGGGDILPPVLRSLTLDDFIKSKAKVGPSVAFDAASMNELR 1011

Query: 1000 KWNEQYGEGGSRRKSPFGF 1018
            KWNEQYGEGGSRRKS FGF
Sbjct: 1012 KWNEQYGEGGSRRKSLFGF 1030

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356544397|ref|XP_003540638.1| PREDICTED: uncharacterized protein LOC100802939 [Glycine max] Back     alignment and taxonomy information
>gi|449436709|ref|XP_004136135.1| PREDICTED: uncharacterized protein LOC101214782 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489122|ref|XP_004158221.1| PREDICTED: uncharacterized LOC101214782 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356540988|ref|XP_003538966.1| PREDICTED: uncharacterized protein LOC100812718 [Glycine max] Back     alignment and taxonomy information
>gi|186489957|ref|NP_175433.2| P-loop containing NTPase domain-containing protein [Arabidopsis thaliana] gi|332194397|gb|AEE32518.1| P-loop containing NTPase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185474|ref|NP_188608.4| P-loop containing nucleoside triphosphate hydrolase domain-containing protein [Arabidopsis thaliana] gi|332642761|gb|AEE76282.1| P-loop containing nucleoside triphosphate hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297852706|ref|XP_002894234.1| hypothetical protein ARALYDRAFT_891942 [Arabidopsis lyrata subsp. lyrata] gi|297340076|gb|EFH70493.1| hypothetical protein ARALYDRAFT_891942 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297834890|ref|XP_002885327.1| hypothetical protein ARALYDRAFT_479491 [Arabidopsis lyrata subsp. lyrata] gi|297331167|gb|EFH61586.1| hypothetical protein ARALYDRAFT_479491 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186489959|ref|NP_001117460.1| P-loop containing NTPase domain-containing protein [Arabidopsis thaliana] gi|332194398|gb|AEE32519.1| P-loop containing NTPase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
TAIR|locus:20310051003 AT1G50140 [Arabidopsis thalian 0.980 0.995 0.626 0.0
TAIR|locus:21332981265 AT4G02480 [Arabidopsis thalian 0.496 0.399 0.425 4.5e-123
TAIR|locus:21267831122 AT4G24860 [Arabidopsis thalian 0.424 0.385 0.441 1.9e-104
TAIR|locus:2024522829 DAA1 "DUO1-activated ATPase 1" 0.263 0.323 0.548 8.9e-103
TAIR|locus:2132922830 AT4G28000 [Arabidopsis thalian 0.333 0.408 0.451 3.6e-98
TAIR|locus:4010714050829 AT5G52882 [Arabidopsis thalian 0.286 0.352 0.496 1.1e-90
TAIR|locus:2168646403 AT5G53540 [Arabidopsis thalian 0.295 0.746 0.408 2.3e-59
ZFIN|ZDB-GENE-040426-2331570 spast "spastin" [Danio rerio ( 0.300 0.536 0.399 3.1e-59
TAIR|locus:2137777398 AT4G27680 [Arabidopsis thalian 0.287 0.736 0.423 2.2e-58
RGD|1308494581 Spast "spastin" [Rattus norveg 0.300 0.526 0.400 2.3e-55
TAIR|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3117 (1102.3 bits), Expect = 0., P = 0.
 Identities = 641/1023 (62%), Positives = 751/1023 (73%)

Query:     1 MYARRLKCKSQRWGSVFQPSKNSFGQDRLTDRACSQSF-SHASALRNHSKDGSLIRRYFL 59
             MY R ++ ++QRWG V Q  K    +  + D   SQS+ S  S L +H +       +  
Sbjct:     1 MYTRTIR-RNQRWGFVLQQDK-CLVRPVIRDHTGSQSYRSTTSILTDHLRRN----HHSH 54

Query:    60 GSIPSRGVVRSSLCSNRIQLCAFSSEADGRNASGNNRKPVDDGANFDKGEKGKTRREKVK 119
             G+I SR  +  S  S   QL  FSSE DG NAS ++R P+    N DK   GK   EK  
Sbjct:    55 GAIASRDYLSYSWNS---QLRRFSSEGDGNNASEDSRFPL----NKDK--MGK---EKST 102

Query:   120 EDAKNKDAHARLGEHEQKEWLNNEKAAIESKKRESPFLTRRERFKNEFSRRIVPWEKINI 179
                ++ D+HA+LG  +Q EWLNNEK A ES+K ESPFL +RER KNEF RRI PWE I +
Sbjct:   103 VGVEHFDSHAQLGVQDQIEWLNNEKRASESRK-ESPFLNKRERLKNEFLRRIQPWETIQL 161

Query:   180 SWDTFPYYINENTKSLLVECVGSHLKHKKFTATFGARLTSSSGRILLRSVPGTXXXXXXX 239
             SW++FPYY++E+TK  LVECV SH+K K  T+ +GARL SSSGRILL+SVPGT       
Sbjct:   162 SWESFPYYVHEHTKDTLVECVSSHIKQKSMTSKYGARLDSSSGRILLQSVPGTELYRERL 221

Query:   240 XXXXXXXXQVPLLVLDSSVLAPYDFADD-SSDCESDNYXXXX---XXXXXXXNDASNEEE 295
                     QVPLLVLDSSVLAPYDFADD + + ESD+                +   + +
Sbjct:   222 VRALARDTQVPLLVLDSSVLAPYDFADDYNEESESDDDIAESDQCTSQSEAEEETDGDND 281

Query:   296 WTSSNEARTDGSDSEADMQATAEAALKKLVPFNXXXXXXXXXXXXXXXXXXXXXXXXPSD 355
              TSS+E + +G+D E      ++  LKKL                              D
Sbjct:   282 DTSSSETKIEGTDDEERYLEISKEVLKKLGADIEDIEKRMSEQLYGSSEVSEAAAVDQDD 341

Query:   356 TSKRLLKKGDRVKYIGPSVRVEADNRIILGKIMTSDGPKNAYTIIPDRALSSGQRGEVYE 415
              +KR LKKGD+VKY+G   + EA +R++LGKI TSDG K+A+T+IP R LSSGQRGEVYE
Sbjct:   342 KAKRPLKKGDQVKYVGSPKKDEAKHRVVLGKISTSDGQKSAFTVIPGRPLSSGQRGEVYE 401

Query:   416 VNGDRAAVILDISADNKGEGEKDDKVAEQPARPPVYWIDVKHIEHDLDTQAEDCYIAMEA 475
             V G+R AVI +   D   EG  + K AEQP   P++W+DVK +++DLD QA D YIAMEA
Sbjct:   402 VIGNRVAVIFEYGDDKTSEGS-EKKPAEQPQMLPIHWLDVKDLKYDLDMQAVDGYIAMEA 460

Query:   476 LCEVLHSTQPLIVYFPDSSLWLSRAVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNET 535
             L EVL S QPLIVYFPDS+ WLSRAVP+  RKEFV KV+EMFD+LSGP+V+ICGQNK ET
Sbjct:   461 LNEVLQSIQPLIVYFPDSTQWLSRAVPKTRRKEFVDKVKEMFDKLSGPIVMICGQNKIET 520

Query:   536 GPKEKEKFTMILPNFGRLAKLPLPLQRLTEGLKATKRSDDNEIYNLFTNVLSIHPPKEED 595
             G KE+EKFTM+LPN  R+ KLPLPL+ LTEG     +S++NEIY LFTNV+ +HPPKEED
Sbjct:   521 GSKEREKFTMVLPNLSRVVKLPLPLKGLTEGFTGRGKSEENEIYKLFTNVMRLHPPKEED 580

Query:   596 LLRTFNKQVEEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGVILTKQRAEKVVGW 655
              LR F KQ+ EDRRIVI RSN+NEL K LE+HEL CTDL  VNTDGVILTKQ+AEK +GW
Sbjct:   581 TLRLFKKQLGEDRRIVISRSNINELLKALEEHELLCTDLYQVNTDGVILTKQKAEKAIGW 640

Query:   656 AKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFV 715
             AKNHYL+SC  P VKG RL LPRESLEI+I RL++ E  S KP+QNLKN+AKDEYE NFV
Sbjct:   641 AKNHYLASCPVPLVKGGRLSLPRESLEISIARLRKLEDNSLKPSQNLKNIAKDEYERNFV 700

Query:   716 SAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPXX 775
             SAVV PGEIGV+F+DIGALEDVKKALNELVILPMRRP+LF+RGNLLRPCKGILLFGPP  
Sbjct:   701 SAVVAPGEIGVKFEDIGALEDVKKALNELVILPMRRPELFARGNLLRPCKGILLFGPPGT 760

Query:   776 XXXXXXXXXXXXXXXNFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSL 835
                            NFISITGSTLTSKWFGDAEKLTKALFSFA+KLAPVIIFVDE+DSL
Sbjct:   761 GKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFATKLAPVIIFVDEIDSL 820

Query:   836 LGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIRRLPRRIY 895
             LGARGG+ EHEATRRMRNEFM+AWDGLRSK+SQ+ILILGATNRPFDLDDAVIRRLPRRIY
Sbjct:   821 LGARGGSSEHEATRRMRNEFMAAWDGLRSKDSQRILILGATNRPFDLDDAVIRRLPRRIY 880

Query:   896 VDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLE 955
             VDLPDAENR+KIL+IFL  E+LES FQF +LA  TEGYSGSDLKNLCIAAAYRPVQELL+
Sbjct:   881 VDLPDAENRLKILKIFLTPENLESDFQFEKLAKETEGYSGSDLKNLCIAAAYRPVQELLQ 940

Query:   956 EERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGEGGSRRKSP 1015
             EE+K  + +A+P LR L L+DFIQSKAKV PSVAYDA +MNELRKWNEQYGEGGSR KSP
Sbjct:   941 EEQKGARAEASPGLRSLSLDDFIQSKAKVSPSVAYDATTMNELRKWNEQYGEGGSRTKSP 1000

Query:  1016 FGF 1018
             FGF
Sbjct:  1001 FGF 1003
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0032504 "multicellular organism reproduction" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
TAIR|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2331 spast "spastin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1308494 Spast "spastin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-71
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-57
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 1e-52
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 7e-51
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 9e-49
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-47
pfam00004131 pfam00004, AAA, ATPase family associated with vari 1e-45
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-42
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-41
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-39
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 5e-34
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-31
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-31
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 6e-31
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-29
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-28
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-20
smart00382148 smart00382, AAA, ATPases associated with a variety 9e-18
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 3e-10
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 2e-07
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-06
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 6e-06
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 7e-06
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 3e-05
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 5e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 6e-05
pfam13401124 pfam13401, AAA_22, AAA domain 1e-04
TIGR02639 730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 2e-04
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 2e-04
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 4e-04
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 7e-04
pfam13207114 pfam13207, AAA_17, AAA domain 0.001
pfam07726131 pfam07726, AAA_3, ATPase family associated with va 0.002
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.002
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.002
pfam00910105 pfam00910, RNA_helicase, RNA helicase 0.003
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.003
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 0.004
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 0.004
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  245 bits (628), Expect = 2e-71
 Identities = 141/412 (34%), Positives = 204/412 (49%), Gaps = 45/412 (10%)

Query: 584 NVLSIHPPKEEDLLRTFNKQV-EEDRRIVIYRSNLNELHKVLEDHELSCTDLLHVNTDGV 642
            V+ I      D L    ++    DR I +   +     ++L+ H         +     
Sbjct: 118 QVIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEILQIHTR------LMFLGPP 171

Query: 643 ILTKQRAEKVVGWAKNHYLSSCSFPSVKGQRLHLPRESLEIAILRLKEQETASRKPTQNL 702
              K  A + VG       S     +       L +E+    + R  +        T++ 
Sbjct: 172 GTGKTLAARTVG------KSGADLGA-------LAKEAALRELRRAIDLVGEYIGVTEDD 218

Query: 703 KNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLR 762
              A  +   +    V+   E  V  DDIG LE+ K+ L E +  P++RP+LF +  L R
Sbjct: 219 FEEALKKVLPS--RGVLFEDED-VTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGL-R 274

Query: 763 PCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKL 822
           P KG+LL+GPPGTGKTLLAKA+A E+ + FIS+ GS L SKW G++EK  + LF  A KL
Sbjct: 275 PPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGESEKNIRELFEKARKL 334

Query: 823 APVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDL 882
           AP IIF+DE+DSL   RG + E  + RR+  + ++  DG+   E   +L++ ATNRP DL
Sbjct: 335 APSIIFIDEIDSLASGRGPS-EDGSGRRVVGQLLTELDGIEKAEG--VLVIAATNRPDDL 391

Query: 883 DDAVIR--RLPRRIYVDLPDAENRMKILRIFLAHE--SLESGFQFNELANATEGYSGSDL 938
           D A++R  R  R IYV LPD E R++I +I L  +   L       ELA  TEGYSG+D+
Sbjct: 392 DPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKPPLAEDVDLEELAEITEGYSGADI 451

Query: 939 KNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAY 990
             L   AA   ++E                 R + L+DF+ +  K+ PSV Y
Sbjct: 452 AALVREAALEALREARR--------------REVTLDDFLDALKKIKPSVTY 489

Length = 494
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1018
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.98
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.98
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.98
CHL00176 638 ftsH cell division protein; Validated 99.97
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.97
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.97
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.96
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.96
CHL00206 2281 ycf2 Ycf2; Provisional 99.96
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.95
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.93
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.9
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.89
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.89
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.88
CHL00195489 ycf46 Ycf46; Provisional 99.87
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.87
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.87
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.86
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.86
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.86
PRK03992389 proteasome-activating nucleotidase; Provisional 99.86
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.85
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.84
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.83
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.83
CHL00181287 cbbX CbbX; Provisional 99.83
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.83
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.82
CHL002062281 ycf2 Ycf2; Provisional 99.81
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.81
PF00004132 AAA: ATPase family associated with various cellula 99.81
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.81
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.79
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.77
CHL00176638 ftsH cell division protein; Validated 99.77
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.77
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.76
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.76
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.75
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.75
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.74
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.72
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.72
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.7
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.68
CHL00095821 clpC Clp protease ATP binding subunit 99.68
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.67
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.66
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.66
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.66
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.66
PRK10865857 protein disaggregation chaperone; Provisional 99.64
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.64
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.64
PRK00149450 dnaA chromosomal replication initiation protein; R 99.63
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.62
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.6
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK12422445 chromosomal replication initiation protein; Provis 99.54
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.54
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.53
PRK14088440 dnaA chromosomal replication initiation protein; P 99.53
PRK14086617 dnaA chromosomal replication initiation protein; P 99.52
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.52
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.52
PRK13342 413 recombination factor protein RarA; Reviewed 99.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.51
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.5
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK10865 857 protein disaggregation chaperone; Provisional 99.5
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.49
PRK14087450 dnaA chromosomal replication initiation protein; P 99.49
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.49
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.49
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.49
PRK04195 482 replication factor C large subunit; Provisional 99.49
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.47
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.46
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.46
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.46
CHL00095 821 clpC Clp protease ATP binding subunit 99.46
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.45
PRK06893229 DNA replication initiation factor; Validated 99.44
PRK08084235 DNA replication initiation factor; Provisional 99.43
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.43
PRK12402337 replication factor C small subunit 2; Reviewed 99.43
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.43
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.42
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.42
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.42
PLN03025319 replication factor C subunit; Provisional 99.42
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.41
KOG2028 554 consensus ATPase related to the helicase subunit o 99.41
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.4
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.39
PHA02544316 44 clamp loader, small subunit; Provisional 99.39
PRK08727233 hypothetical protein; Validated 99.38
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.38
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.37
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.37
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.37
PRK05642234 DNA replication initiation factor; Validated 99.37
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK13341 725 recombination factor protein RarA/unknown domain f 99.36
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.36
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.36
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.36
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.35
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.34
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.34
PRK06620214 hypothetical protein; Validated 99.34
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.33
COG0593408 DnaA ATPase involved in DNA replication initiation 99.32
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.32
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.29
PRK00440319 rfc replication factor C small subunit; Reviewed 99.29
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.28
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.26
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.25
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.24
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.24
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.23
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.18
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.16
PRK09087226 hypothetical protein; Validated 99.15
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.08
PRK09112351 DNA polymerase III subunit delta'; Validated 99.08
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.08
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.07
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.07
PHA02244383 ATPase-like protein 99.06
PRK05564313 DNA polymerase III subunit delta'; Validated 99.04
PRK07471365 DNA polymerase III subunit delta'; Validated 99.03
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.03
smart00382148 AAA ATPases associated with a variety of cellular 99.02
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.02
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.01
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.98
PRK07399314 DNA polymerase III subunit delta'; Validated 98.94
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.94
PF00004132 AAA: ATPase family associated with various cellula 98.94
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.93
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.92
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.92
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.91
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.9
PRK05707328 DNA polymerase III subunit delta'; Validated 98.9
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.89
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.87
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.86
COG0714329 MoxR-like ATPases [General function prediction onl 98.85
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.83
PRK04132846 replication factor C small subunit; Provisional 98.82
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.82
PRK08058329 DNA polymerase III subunit delta'; Validated 98.8
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.79
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.77
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.77
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.77
PRK11608326 pspF phage shock protein operon transcriptional ac 98.76
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.75
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.73
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.72
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.71
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.71
smart00350509 MCM minichromosome maintenance proteins. 98.71
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.69
PRK15424538 propionate catabolism operon regulatory protein Pr 98.69
PRK12377248 putative replication protein; Provisional 98.68
COG1221403 PspF Transcriptional regulators containing an AAA- 98.68
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.68
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.68
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.67
PRK08116268 hypothetical protein; Validated 98.66
PRK06871325 DNA polymerase III subunit delta'; Validated 98.66
PRK13531 498 regulatory ATPase RavA; Provisional 98.65
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.63
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.63
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.63
COG2204464 AtoC Response regulator containing CheY-like recei 98.61
PRK07993334 DNA polymerase III subunit delta'; Validated 98.6
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.59
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.57
PF07726131 AAA_3: ATPase family associated with various cellu 98.56
PRK07952244 DNA replication protein DnaC; Validated 98.56
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.55
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.55
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.55
PRK06964342 DNA polymerase III subunit delta'; Validated 98.54
PRK08769319 DNA polymerase III subunit delta'; Validated 98.54
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.53
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.53
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.51
PRK08181269 transposase; Validated 98.49
PRK06090319 DNA polymerase III subunit delta'; Validated 98.45
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.43
TIGR00763775 lon ATP-dependent protease La. This protein is ind 98.39
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.38
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.36
PRK06835329 DNA replication protein DnaC; Validated 98.35
PRK06526254 transposase; Provisional 98.33
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.32
PRK08699325 DNA polymerase III subunit delta'; Validated 98.31
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.3
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.29
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.29
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.29
PRK09862506 putative ATP-dependent protease; Provisional 98.28
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.27
PRK08939306 primosomal protein DnaI; Reviewed 98.27
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.24
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.23
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.23
PRK09183259 transposase/IS protein; Provisional 98.23
PF13173128 AAA_14: AAA domain 98.22
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.22
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.21
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.21
PRK06921266 hypothetical protein; Provisional 98.19
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.16
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.14
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.11
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.1
PRK13765 637 ATP-dependent protease Lon; Provisional 98.1
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.1
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.08
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.08
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.05
PRK15115444 response regulator GlrR; Provisional 98.04
PF05729166 NACHT: NACHT domain 98.02
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.98
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.91
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.88
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.86
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.85
PRK05917290 DNA polymerase III subunit delta'; Validated 97.84
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 97.84
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.83
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.81
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.79
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.78
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.74
CHL00181287 cbbX CbbX; Provisional 97.71
PRK07276290 DNA polymerase III subunit delta'; Validated 97.69
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.67
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.67
PRK05818261 DNA polymerase III subunit delta'; Validated 97.65
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.65
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.61
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.59
PF14516331 AAA_35: AAA-like domain 97.54
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.51
PRK07132299 DNA polymerase III subunit delta'; Validated 97.5
KOG2383467 consensus Predicted ATPase [General function predi 97.5
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.49
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.48
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.45
PRK11823446 DNA repair protein RadA; Provisional 97.44
PRK00771437 signal recognition particle protein Srp54; Provisi 97.42
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.42
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.39
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.39
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.38
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.35
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.33
PHA02624647 large T antigen; Provisional 97.3
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.28
PHA00729226 NTP-binding motif containing protein 97.28
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.27
cd01394218 radB RadB. The archaeal protein radB shares simila 97.22
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.17
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.15
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.15
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.15
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.13
PRK08118167 topology modulation protein; Reviewed 97.12
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.12
PRK00131175 aroK shikimate kinase; Reviewed 97.09
PRK04841 903 transcriptional regulator MalT; Provisional 97.07
PRK06067234 flagellar accessory protein FlaH; Validated 97.06
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.03
PHA02774613 E1; Provisional 96.98
PRK07261171 topology modulation protein; Provisional 96.97
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.96
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.95
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.94
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.94
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 96.92
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 96.9
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.9
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.86
COG1485367 Predicted ATPase [General function prediction only 96.86
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.86
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.85
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.84
PRK15455 644 PrkA family serine protein kinase; Provisional 96.84
PRK10536262 hypothetical protein; Provisional 96.83
KOG0482721 consensus DNA replication licensing factor, MCM7 c 96.83
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.82
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.82
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.79
PRK09354349 recA recombinase A; Provisional 96.77
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.76
PRK13947171 shikimate kinase; Provisional 96.75
PRK03839180 putative kinase; Provisional 96.73
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.73
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.73
PRK10867433 signal recognition particle protein; Provisional 96.7
PRK04296190 thymidine kinase; Provisional 96.69
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.69
PRK13342413 recombination factor protein RarA; Reviewed 96.68
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 96.68
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.68
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.67
PRK13948182 shikimate kinase; Provisional 96.66
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.66
PRK09376416 rho transcription termination factor Rho; Provisio 96.66
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 96.66
PRK14974336 cell division protein FtsY; Provisional 96.66
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.65
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.64
PRK13695174 putative NTPase; Provisional 96.62
PRK00625173 shikimate kinase; Provisional 96.61
PRK04328249 hypothetical protein; Provisional 96.61
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.61
cd01128249 rho_factor Transcription termination factor rho is 96.56
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.55
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.54
PRK14532188 adenylate kinase; Provisional 96.53
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 96.52
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.51
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.51
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.51
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.49
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.47
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.45
PRK13949169 shikimate kinase; Provisional 96.45
PRK06762166 hypothetical protein; Provisional 96.43
PRK14531183 adenylate kinase; Provisional 96.43
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.43
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.43
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.42
PRK06217183 hypothetical protein; Validated 96.4
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.38
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.38
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.37
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.37
PRK05973237 replicative DNA helicase; Provisional 96.3
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.29
TIGR02533486 type_II_gspE general secretory pathway protein E. 96.29
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 96.26
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.25
PRK14530215 adenylate kinase; Provisional 96.25
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.25
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.24
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.22
PRK04195482 replication factor C large subunit; Provisional 96.21
PRK13764602 ATPase; Provisional 96.21
smart00487201 DEXDc DEAD-like helicases superfamily. 96.18
COG4650531 RtcR Sigma54-dependent transcription regulator con 96.17
PRK10436462 hypothetical protein; Provisional 96.16
KOG0477854 consensus DNA replication licensing factor, MCM2 c 96.14
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.13
PTZ00088229 adenylate kinase 1; Provisional 96.12
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.12
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.12
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.12
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 96.11
PRK08233182 hypothetical protein; Provisional 96.11
PRK14528186 adenylate kinase; Provisional 96.09
PRK03731171 aroL shikimate kinase II; Reviewed 96.08
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.07
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.06
PRK06547172 hypothetical protein; Provisional 96.05
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.05
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.04
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.04
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.03
PF0933662 Vps4_C: Vps4 C terminal oligomerisation domain; In 96.01
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.01
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.99
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.99
TIGR00959428 ffh signal recognition particle protein. This mode 95.99
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.99
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.99
PF13479213 AAA_24: AAA domain 95.98
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.96
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.95
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.95
PRK13946184 shikimate kinase; Provisional 95.94
PLN02200234 adenylate kinase family protein 95.94
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 95.93
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 95.91
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.91
PRK02496184 adk adenylate kinase; Provisional 95.91
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.9
PRK10416318 signal recognition particle-docking protein FtsY; 95.86
PRK05057172 aroK shikimate kinase I; Reviewed 95.86
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.85
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.84
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 95.84
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 95.83
PRK00279215 adk adenylate kinase; Reviewed 95.83
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.83
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 95.81
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.8
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.78
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.78
PRK06581263 DNA polymerase III subunit delta'; Validated 95.77
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.76
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.75
PRK04040188 adenylate kinase; Provisional 95.74
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.73
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.72
PRK14527191 adenylate kinase; Provisional 95.71
PRK14730195 coaE dephospho-CoA kinase; Provisional 95.71
PRK06696223 uridine kinase; Validated 95.68
PRK09302 509 circadian clock protein KaiC; Reviewed 95.67
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.66
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.62
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.61
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 95.59
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.56
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.53
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.53
PRK00149450 dnaA chromosomal replication initiation protein; R 95.52
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.52
cd03115173 SRP The signal recognition particle (SRP) mediates 95.51
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 95.49
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 95.48
PRK09302509 circadian clock protein KaiC; Reviewed 95.48
PRK04182180 cytidylate kinase; Provisional 95.47
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.45
TIGR00064272 ftsY signal recognition particle-docking protein F 95.43
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.42
PRK01184184 hypothetical protein; Provisional 95.42
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.42
TIGR00767415 rho transcription termination factor Rho. Members 95.41
PRK102631355 DNA translocase FtsK; Provisional 95.4
PF1324576 AAA_19: Part of AAA domain 95.38
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.37
PTZ00035337 Rad51 protein; Provisional 95.36
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.34
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.34
PLN02674244 adenylate kinase 95.34
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.33
PTZ00202550 tuzin; Provisional 95.33
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.33
PRK00889175 adenylylsulfate kinase; Provisional 95.33
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.32
PRK13833323 conjugal transfer protein TrbB; Provisional 95.32
PLN02199303 shikimate kinase 95.29
PTZ001121164 origin recognition complex 1 protein; Provisional 95.28
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.26
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.3e-76  Score=670.34  Aligned_cols=475  Identities=27%  Similarity=0.409  Sum_probs=378.2

Q ss_pred             HHHHHHHHHhhCCCeEEEEcCchhh-hhh-ccCcchHHHHHHHHHHHHhcCCCCEEEEeeccCCCCCccccccccccccc
Q 001746          472 AMEALCEVLHSTQPLIVYFPDSSLW-LSR-AVPRCNRKEFVRKVEEMFDQLSGPVVLICGQNKNETGPKEKEKFTMILPN  549 (1018)
Q Consensus       472 ~i~~L~e~~~~~~p~Iiff~did~~-~~~-s~~~~~~~~~~s~~~~~l~~l~g~v~vi~~~~~~~~~~~~~~~~~~~~~~  549 (1018)
                      .|..||+.|+++.|.||||||||-. ..| .-|+..-.+||+.|++.||.+.-..     +    .++            
T Consensus       270 kiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~-----~----~g~------------  328 (802)
T KOG0733|consen  270 KIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEK-----T----KGD------------  328 (802)
T ss_pred             HHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccc-----c----CCC------------
Confidence            7889999999999999999999986 333 2245555688999999888885110     0    000            


Q ss_pred             cccccCCCCchhhhhcccccCCCcchHHHHh--ccccEEEEcCCChHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHhhh
Q 001746          550 FGRLAKLPLPLQRLTEGLKATKRSDDNEIYN--LFTNVLSIHPPKEEDLLRTFNKQVEEDRRIVIYRSNLNELHKVLEDH  627 (1018)
Q Consensus       550 ~~~~~~~~~~~~~LvIGmTnR~d~iD~aL~r--rFe~~ieI~LPdeegRl~Il~iht~~~~~~~~~~~~v~~l~~~l~t~  627 (1018)
                                 ..||||+|||||.+|+||+|  |||++|.++.|++.+|..||.+..+.++-..  +-+..+|++  .|.
T Consensus       329 -----------~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g--~~d~~qlA~--lTP  393 (802)
T KOG0733|consen  329 -----------PVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSG--DFDFKQLAK--LTP  393 (802)
T ss_pred             -----------CeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCC--CcCHHHHHh--cCC
Confidence                       03567999999999999999  9999999999999999999999876655433  344666666  899


Q ss_pred             cCCcccccccccchhhhhHhhhhhhHhh---ccc-------cccc---ccCC----------C----------Ccc----
Q 001746          628 ELSCTDLLHVNTDGVILTKQRAEKVVGW---AKN-------HYLS---SCSF----------P----------SVK----  670 (1018)
Q Consensus       628 ~~~gaDL~~Lct~a~lls~~~~~~~V~~---a~~-------~~l~---~~~~----------~----------~v~----  670 (1018)
                      ||.||||.+||++|+.....++-.....   ..+       .-+.   ++.+          +          ..+    
T Consensus       394 GfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~  473 (802)
T KOG0733|consen  394 GFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSK  473 (802)
T ss_pred             CccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcCh
Confidence            9999999999999987765553332211   000       0000   0000          0          000    


Q ss_pred             --CCceeeCHHHHHHHHHHhhhhhhccCCCcccccccchhHhhhhhcccccCCCCCCcccccccChHHHHHHHHHHHHcc
Q 001746          671 --GQRLHLPRESLEIAILRLKEQETASRKPTQNLKNLAKDEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILP  748 (1018)
Q Consensus       671 --~~kv~V~~~df~~Al~~l~p~~~~~~~~~~~l~~~~~~e~e~~~~~~ii~~~e~~vtfdDIgGle~vk~~L~e~V~~p  748 (1018)
                        ...+.|..+||..|+..++|+..                     +.+.+.  -|+++|+||||+++++.+|..+|.+|
T Consensus       474 E~~~~L~i~~eDF~~Al~~iQPSak---------------------REGF~t--VPdVtW~dIGaL~~vR~eL~~aI~~P  530 (802)
T KOG0733|consen  474 ELLEGLSIKFEDFEEALSKIQPSAK---------------------REGFAT--VPDVTWDDIGALEEVRLELNMAILAP  530 (802)
T ss_pred             HHhccceecHHHHHHHHHhcCcchh---------------------ccccee--cCCCChhhcccHHHHHHHHHHHHhhh
Confidence              12455666677777766666521                     122222  25799999999999999999999999


Q ss_pred             cCCchhhccCCCCCCCceEEEEcCCCChHHHHHHHHHHHhCCcEEEEeccccchhhhhhHHHHHHHHHHHHHhcCCeEEE
Q 001746          749 MRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIF  828 (1018)
Q Consensus       749 L~~~elf~~~gl~~p~~gVLL~GPPGTGKT~LArAIA~elg~~fi~Is~seL~s~~~ge~ek~I~~lF~~A~k~~PsIIf  828 (1018)
                      +++|++|.+.| +..|.|||||||||||||.||+|+|+|.|++|+.|.+++|+++|+|++|+.|+.+|..|+.++|||||
T Consensus       531 iK~pd~~k~lG-i~~PsGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlNkYVGESErAVR~vFqRAR~saPCVIF  609 (802)
T KOG0733|consen  531 IKRPDLFKALG-IDAPSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNKYVGESERAVRQVFQRARASAPCVIF  609 (802)
T ss_pred             ccCHHHHHHhC-CCCCCceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHHHHHHHhhcCCCeEEE
Confidence            99999999999 56789999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecchhhhhhccCCCcchHHHHHHHHHHHhhhccccccCCCcEEEEEecCCCCCCcHHHHh--ccCccccccCCCHHHHHH
Q 001746          829 VDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIR--RLPRRIYVDLPDAENRMK  906 (1018)
Q Consensus       829 IDEID~L~~~r~~~~~~e~~~~il~~LL~~Ldgl~~~~~~~VlVIaTTN~p~~LD~aLlr--RFd~~I~V~lPd~eeR~e  906 (1018)
                      +||||+|++.|.... .....+++|+||+.|||+..  ...|.|||+||+|+.+|+|++|  ||++.++|++|+.++|.+
T Consensus       610 FDEiDaL~p~R~~~~-s~~s~RvvNqLLtElDGl~~--R~gV~viaATNRPDiIDpAiLRPGRlDk~LyV~lPn~~eR~~  686 (802)
T KOG0733|consen  610 FDEIDALVPRRSDEG-SSVSSRVVNQLLTELDGLEE--RRGVYVIAATNRPDIIDPAILRPGRLDKLLYVGLPNAEERVA  686 (802)
T ss_pred             ecchhhcCcccCCCC-chhHHHHHHHHHHHhccccc--ccceEEEeecCCCcccchhhcCCCccCceeeecCCCHHHHHH
Confidence            999999999987654 77788999999999999954  5679999999999999999999  999999999999999999


Q ss_pred             HHHHHHh--ccCCCCcccHHHHHHHcc--CCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCC-CccCCCHHHHHHHH
Q 001746          907 ILRIFLA--HESLESGFQFNELANATE--GYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAP-VLRPLKLEDFIQSK  981 (1018)
Q Consensus       907 ILk~~L~--~~~l~~dvdl~~LA~~Te--GfSgaDL~~L~~~Aa~~Airr~~~~~~~~~~~~~~~-~~rpLT~eDF~~Al  981 (1018)
                      ||+.+++  +..+.+++|+++||..+.  ||||+||..||++|.+.|+++.+.+........... ....+|+.||.+|+
T Consensus       687 ILK~~tkn~k~pl~~dVdl~eia~~~~c~gftGADLaaLvreAsi~AL~~~~~~~~~~~~~~~~~~~~~~~t~~hF~eA~  766 (802)
T KOG0733|consen  687 ILKTITKNTKPPLSSDVDLDEIARNTKCEGFTGADLAALVREASILALRESLFEIDSSEDDVTVRSSTIIVTYKHFEEAF  766 (802)
T ss_pred             HHHHHhccCCCCCCcccCHHHHhhcccccCCchhhHHHHHHHHHHHHHHHHHhhccccCcccceeeeeeeecHHHHHHHH
Confidence            9999999  777889999999999876  999999999999999999999876432211111000 02348999999999


Q ss_pred             HhhCCCcchhhhhHHHHHHHHHHhCCCCCc
Q 001746          982 AKVGPSVAYDAASMNELRKWNEQYGEGGSR 1011 (1018)
Q Consensus       982 ~kv~PSvs~~~~~m~el~kW~diyG~~g~r 1011 (1018)
                      ++++||++....  ..|...+..+|+....
T Consensus       767 ~~i~pSv~~~dr--~~Yd~l~k~~~L~~~~  794 (802)
T KOG0733|consen  767 QRIRPSVSERDR--KKYDRLNKSRSLSTAT  794 (802)
T ss_pred             HhcCCCccHHHH--HHHHHHhhhhcccccC
Confidence            999999986543  3466677777765443

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
3vfd_A389 Human Spastin Aaa Domain Length = 389 6e-54
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-47
3b9p_A297 Spastin Length = 297 1e-46
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-42
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 3e-42
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-41
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-41
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 5e-40
1xwi_A322 Crystal Structure Of Vps4b Length = 322 2e-38
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 7e-35
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 8e-35
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 8e-35
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-32
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 9e-30
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 3e-29
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 3e-29
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 3e-29
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 5e-29
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-27
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 3e-27
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 5e-27
2ce7_A 476 Edta Treated Length = 476 5e-25
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 5e-25
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 9e-25
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 2e-23
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 3e-23
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 3e-23
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-19
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 9e-19
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-18
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-18
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-17
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-17
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (532), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 192/317 (60%), Gaps = 11/317 (3%)
Query: 693  TASRKPTQNLKNLAK-DEYESNFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRR 751
            TA+RK  ++LKN    D   +N +   +      V+FDDI   +  K+AL E+VILP  R
Sbjct: 79   TATRK-KKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLR 137
Query: 752  PDLFSRGNLLRPCKGILLFGPPXXXXXXXXXXXXXXXXXNFISITGSTLTSKWFGDAEKL 811
            P+LF+   L  P +G+LLFGPP                  F +I+ ++LTSK+ G+ EKL
Sbjct: 138  PELFT--GLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKL 195
Query: 812  TKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMSAWDGLRSKESQKIL 871
             +ALF+ A +L P IIF+D+VDSLL  R    EH+A+RR++ EF+  +DG++S    ++L
Sbjct: 196  VRALFAVARELQPSIIFIDQVDSLLCERREG-EHDASRRLKTEFLIEFDGVQSAGDDRVL 254
Query: 872  ILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRMKILRIFLAHE-SLESGFQFNELANAT 930
            ++GATNRP +LD+AV+RR  +R+YV LP+ E R+ +L+  L  + S  +  +  +LA  T
Sbjct: 255  VMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMT 314
Query: 931  EGYSGSDLKNLCIAAAYRPVQELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAY 990
            +GYSGSDL  L   AA  P++EL  E+    KN +A  +R ++L DF +S  K+  SV+ 
Sbjct: 315  DGYSGSDLTALAKDAALGPIRELKPEQV---KNMSASEMRNIRLSDFTESLKKIKRSVS- 370
Query: 991  DAASMNELRKWNEQYGE 1007
               ++    +WN+ +G+
Sbjct: 371  -PQTLEAYIRWNKDFGD 386
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-140
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-137
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-133
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-126
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-123
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-116
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-111
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-78
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-76
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-76
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-62
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-69
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 5e-66
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 5e-49
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 9e-43
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-42
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-42
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-42
2r62_A268 Cell division protease FTSH homolog; ATPase domain 6e-42
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-37
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-35
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-35
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
2krk_A86 26S protease regulatory subunit 8; structural geno 4e-11
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-09
3kw6_A78 26S protease regulatory subunit 8; structural geno 1e-08
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 3e-08
3pvs_A 447 Replication-associated recombination protein A; ma 2e-06
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 1e-05
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-05
2chq_A319 Replication factor C small subunit; DNA-binding pr 6e-05
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 1e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 1e-04
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 5e-04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 5e-04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 6e-04
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 6e-04
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 8e-04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 8e-04
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
 Score =  419 bits (1080), Expect = e-140
 Identities = 128/297 (43%), Positives = 180/297 (60%), Gaps = 10/297 (3%)

Query: 713  NFVSAVVPPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGP 772
              +   +  G   V + DI   +  K+AL E+VILP  RP+LF+   L  P KG+LLFGP
Sbjct: 5    QLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTG--LRAPAKGLLLFGP 62

Query: 773  PGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEV 832
            PG GKTLLA+A+ATE  A F++I+ ++LTSK+ GD EKL +ALF+ A  + P IIF+DEV
Sbjct: 63   PGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEV 122

Query: 833  DSLLGARGGAFEHEATRRMRNEFMSAWDGLRS-KESQKILILGATNRPFDLDDAVIRRLP 891
            DSLL  R  + EHEA+RR++ EF+  +DGL    +  +I++L ATNRP +LD+A +RR  
Sbjct: 123  DSLLSERSSS-EHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFT 181

Query: 892  RRIYVDLPDAENRMKILRIFLAHESLE-SGFQFNELANATEGYSGSDLKNLCIAAAYRPV 950
            +R+YV LPD + R  +L   L  +           LA  T+GYSGSDL  L   AA  P+
Sbjct: 182  KRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPI 241

Query: 951  QELLEEERKRGKNDAAPVLRPLKLEDFIQSKAKVGPSVAYDAASMNELRKWNEQYGE 1007
            +EL  E+    K      +R +  +DF  S  ++  SVA    S+N   KW++ YG+
Sbjct: 242  RELNVEQV---KCLDISAMRAITEQDFHSSLKRIRRSVA--PQSLNSYEKWSQDYGD 293
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1018
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 5e-74
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 8e-74
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-59
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-50
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-36
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-26
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-24
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 6e-21
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-20
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 4e-14
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 6e-11
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 9e-11
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-08
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-08
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-05
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-05
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 2e-05
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 1e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 1e-04
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 1e-04
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 3e-04
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 7e-04
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 0.001
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.001
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 0.001
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 0.002
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.002
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 0.002
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.002
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 0.002
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 0.002
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.002
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 0.002
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 0.003
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 0.003
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 0.003
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 0.003
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 0.003
d1ckea_225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 0.004
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

 Score =  242 bits (619), Expect = 5e-74
 Identities = 82/235 (34%), Positives = 121/235 (51%), Gaps = 8/235 (3%)

Query: 726 VRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALA 785
           V F D+   E+ K+ L E+V   ++ P  F      R  KG+LL GPPG GKT LA+A+A
Sbjct: 6   VTFKDVAGAEEAKEELKEIVEF-LKNPSRFHEMGA-RIPKGVLLVGPPGVGKTHLARAVA 63

Query: 786 TEAGANFISITGSTLTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAF-- 843
            EA   FI+ +GS     + G      + LF  A + AP I+F+DE+D++   RG     
Sbjct: 64  GEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSGVGG 123

Query: 844 EHEATRRMRNEFMSAWDGLRSKESQKILILGATNRPFDLDDAVIR--RLPRRIYVDLPDA 901
            ++   +  N+ +   DG        I+++ ATNRP  LD A++R  R  R+I +D PD 
Sbjct: 124 GNDEREQTLNQLLVEMDGFEKDT--AIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDV 181

Query: 902 ENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLEE 956
           + R +ILRI    + L        LA  T G+ G+DL+NL   AA    +E   +
Sbjct: 182 KGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRK 236
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1018
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.95
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.95
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.94
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.92
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.92
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.92
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.91
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.88
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.85
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.77
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.76
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.75
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.7
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.7
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.7
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.66
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.65
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.65
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.61
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.58
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.56
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.55
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.54
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.54
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.5
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.5
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.46
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.44
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.44
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.18
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.03
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.97
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.95
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.43
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.24
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.16
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.95
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.84
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.77
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.67
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.65
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 97.63
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.59
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.46
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.46
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.44
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.44
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.36
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.32
d1okkd2207 GTPase domain of the signal recognition particle r 97.32
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.31
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.24
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.24
d1vmaa2213 GTPase domain of the signal recognition particle r 97.21
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.19
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.18
d2qy9a2211 GTPase domain of the signal recognition particle r 97.18
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.14
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.14
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.1
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.09
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.07
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.04
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.03
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.02
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.01
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.99
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.93
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.92
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.91
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.9
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.89
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.87
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.86
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.81
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.81
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.74
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.74
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.73
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.72
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.72
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.72
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.68
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.58
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.57
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.44
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.39
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.38
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.24
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.13
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.13
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.07
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.8
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.71
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.56
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.47
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.38
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.29
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.05
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.0
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.76
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.58
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.54
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.45
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.42
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.11
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.01
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.93
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.82
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.66
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.47
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.44
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.37
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 93.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.25
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.11
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.09
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.06
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.03
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.95
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.82
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.8
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.69
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.58
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.57
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.56
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.07
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.03
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.99
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.97
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.94
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.52
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.47
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.45
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.43
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.39
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 91.13
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.13
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.12
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.1
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.97
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.95
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.82
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.54
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.4
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.22
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.22
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.19
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.06
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.8
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.76
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.69
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.62
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.59
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.56
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.25
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 88.16
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.03
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 87.87
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 87.38
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 86.7
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 86.57
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.55
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.5
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.4
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.16
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.96
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 85.73
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.89
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 84.86
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 84.86
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 84.33
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 84.24
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 84.09
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.05
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 83.88
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.64
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 83.52
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 83.49
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.37
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 83.26
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 83.23
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 83.05
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.05
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 82.98
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 82.79
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 82.58
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 82.58
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 82.54
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 82.41
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.32
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.3
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 82.24
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 82.2
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.68
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 81.58
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 81.26
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.01
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 80.87
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 80.52
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 80.41
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 80.41
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 80.39
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 80.26
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 80.06
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 80.06
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.4e-45  Score=320.57  Aligned_cols=247  Identities=35%  Similarity=0.583  Sum_probs=223.3

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             89998865443568199999999998731378011103998889915999869998399999999999299299994653
Q 001746          720 PPGEIGVRFDDIGALEDVKKALNELVILPMRRPDLFSRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGST  799 (1018)
Q Consensus       720 ~~~e~~vtfddIgGle~vk~~L~e~V~~pl~~pelf~~~~l~~p~rgILL~GPPGTGKT~LAkAIA~elg~~fi~Is~s~  799 (1018)
                      ..+++.++|+|++|+++++++|.+.|.+ +.+++.|.+.+ ..+++++|||||||||||++|+++|++++.+++.+++++
T Consensus         3 ~~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g-~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~   80 (256)
T d1lv7a_           3 TEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLG-GKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSD   80 (256)
T ss_dssp             EECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC------CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCS
T ss_pred             CCCCCCCCHHHHHCHHHHHHHHHHHHHH-HHCHHHHHHCC-CCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEHHH
T ss_conf             8889998999981639999999999999-87999999869-998886786689988822899999998299879988699


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHCCCCCC--CHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf             11122211899999999998720994898530125531159986--0588999999888641166656788579998239
Q 001746          800 LTSKWFGDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAF--EHEATRRMRNEFMSAWDGLRSKESQKILILGATN  877 (1018)
Q Consensus       800 L~s~~~gesek~I~~iF~~A~k~~PsIIfIDEID~L~~~r~~~~--~~e~~~~il~eLL~lLdgl~~~~~~~VlVIaTTN  877 (1018)
                      +.+.|.|++++.++.+|..|+.++||||||||+|.++..+....  ......+++++|+..++++..  +.+++||||||
T Consensus        81 l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~--~~~v~vIatTn  158 (256)
T d1lv7a_          81 FVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG--NEGIIVIAATN  158 (256)
T ss_dssp             STTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS--SSCEEEEEEES
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC--CCCEEEEEECC
T ss_conf             4260010789999999999997599899997756657567898888748999999999999538777--79989998079


Q ss_pred             CCCCCCHHHHH--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998589970--0374322358999999999999971158887002999999815998999999999999999999999
Q 001746          878 RPFDLDDAVIR--RLPRRIYVDLPDAENRMKILRIFLAHESLESGFQFNELANATEGYSGSDLKNLCIAAAYRPVQELLE  955 (1018)
Q Consensus       878 ~p~~Ld~aLlr--RFd~~I~V~lPs~eeR~eILk~~l~~~~l~~dvdl~~LA~~T~G~SgaDL~~Lv~~Aa~~Airr~l~  955 (1018)
                      .|+.+|++++|  ||+..|+|++|+.++|.+||+.++.+..+..++++..++..|+||+++||.++|.+|+..++++.  
T Consensus       159 ~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~~--  236 (256)
T d1lv7a_         159 RPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGN--  236 (256)
T ss_dssp             CTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHTT--
T ss_pred             CCCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCC--
T ss_conf             931079857689878779877995999999999984259986865699999986899899999999999999999828--


Q ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             997307889998766877999999997529
Q 001746          956 EERKRGKNDAAPVLRPLKLEDFIQSKAKVG  985 (1018)
Q Consensus       956 ~e~~~~~~~~~~~~~~IT~eDf~~Al~kv~  985 (1018)
                                   ...|+++||.+|++++.
T Consensus       237 -------------~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         237 -------------KRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             -------------CSSBCHHHHHHHHHHHT
T ss_pred             -------------CCCCCHHHHHHHHHHHH
T ss_conf             -------------98348999999999996
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure