Citrus Sinensis ID: 001759


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ
ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEHHHHHHHccccccEEEccccccHHHHHHHcccccEEEEEEEEEcccccccccccEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccccccccccccEEEEEcccccHHHHHcccccccccccccccccEEEEEEcccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHHcHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHcc
cccHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccEEEEEcccEEEEEcccccccEEcccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEHEcccccccEEEEEEEEcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccHHEEcccEEEEEccccccccEEEEEEEcccEEcccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHcccccccHccccHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcc
maqtrryvpnqqLDLEQILQEAQYRWLRPTEICEILRNYqkfhltpdppvrppagslflfDRKALRYFRkdghrwrkkkdgktVKEAHEKLKAGSIDVLHCYyahgednenfqRRSYWMLDGQLEHIVLVHYREVKegyksgrsaadpgsqiessqtsSARSLAQanssapaaqtshasipnkidwngqavssefedvdsghgsgtpsVAQSIYGSMSQNASLVAASIaglpelsrhpqwfagskinhgsgssmwpqidnssrnatSVLDqhghqnfyvgqpsgadfithkltdarlasdstianigtcgerlITDIdvhavttssqgASQVLLEHNFNLinnqcqncpvpevtvasvsqagikpkeelgelkkldsfgrwmdqeiggdcddslmasdsgnywntldaenddkevsSLSHHMQLemdslgpslsqeqlfsirdfspdwaysgaETKVLIIGMFLgtkklssdtkwgcmfgeievpaevltdnvircqapshaagrvpfyitgsnrlacsevrefeyrekpskagypvaskiapeDEVRLQTRLAKFLyldperkwfdctiedcnkcklkNTIYSmrgdsekdwgrvdespmaiegdcpnsRDKLIQNLLRNRLCEWLVWkiheggkgpnviddggQGVVHLAAALGyewamrpiiatgvspnfrdargrTALHWASYFGREETVIMLVKLgaapgavedptpafpggqtaadlassrghkgIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAqigvqsdgpaaeQLSLRGSLAAVRKSAHAAALIQQAFRVRsfrhrqsiqssddvsEVSVDLVALGslnkvskmihfEDYLHFAAIKIQQkyrgwkgrkDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRrgsglrgfrvgnstanvasenektdeyeFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFEnfkmcddgsgllsqgedslngptkdnlHAYVADQ
maqtrryvpnqqldLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRyfrkdghrwrkkkdgktvkeaheklkagsidvLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKsgrsaadpgsqIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSqagikpkeelgelkkldSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPshaagrvpfyitGSNRLACSEVREFEyrekpskagypvaskiapedeVRLQTRLAKFlyldperkwfdctiedcnkcklkntiysmrgdsekdwGRVDESpmaiegdcpnsrDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHrqsiqssddvsevSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLqahvrghqvrkqykkvvwsvSIVEkailrwrrrgsglrgfrvgnstanvasenektdeyeflrigrkqkfaGVEKALErvksmvrnpeardQYMRMVAKFENFKMCDDGSGLLsqgedslngptkdnlhayvadq
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPkeelgelkklDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVaaalaaekanetaaQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQssddvsevsvdlvALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILrwrrrgsglrgfrvgNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ
************LDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWR*************KLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK***************************************************************************************VAASIAGL*******QWFA******************************GHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQA***********KKLDSFGRWMDQEIGGDC***********YW**********************************LFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEY**********V***IAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMR************************RDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAP***************************IAGYLA*************************************************************AHAAALIQQAFRVRSFR************EVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGN**************YEFLRIGRKQKFAGVEK*****************YMRMVAKFENFKMC*****************************
*********NQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKD****KEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK*****************************************************************************************************************************************************************************************************************************************************************************************************************RDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYRE****************DEVRLQTRLAKFLYL******************************EKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFR**************************************FAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVR*Q**KVVWSVSIVEKAILRWRRRGS************************EFLRIGRKQKFAGVEKALERVKSMVRN*EARDQYMRMVAKFE*************************NLHAYVA**
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDG***************HEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGY**************************************ASIPNKIDWNGQAVS**************PSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSF***************SVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ
****RRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKE**********************************************************************************************************************************************************LT********************I*D**V*****************************************************KKLDSFGRWMDQEIG**********************************************SQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDC***********************DWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLT**********************************EQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGL**F***************TDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDD****************KDNLHAYVADQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTKDNLHAYVADQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1017 2.2.26 [Sep-21-2011]
Q8GSA71032 Calmodulin-binding transc yes no 0.919 0.906 0.405 0.0
Q6NPP41050 Calmodulin-binding transc no no 0.576 0.558 0.431 1e-139
Q9FY741007 Calmodulin-binding transc no no 0.576 0.581 0.426 1e-135
Q9FYG21016 Calmodulin-binding transc no no 0.515 0.515 0.402 5e-98
O23463923 Calmodulin-binding transc no no 0.580 0.639 0.323 2e-77
Q9LSP8838 Calmodulin-binding transc no no 0.549 0.667 0.324 2e-74
Q9Y6Y1 1673 Calmodulin-binding transc yes no 0.112 0.068 0.428 6e-19
A2A891 1682 Calmodulin-binding transc yes no 0.112 0.067 0.428 7e-19
O94983 1202 Calmodulin-binding transc no no 0.113 0.095 0.416 4e-17
Q80Y50 1208 Calmodulin-binding transc no no 0.113 0.095 0.4 3e-15
>sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 Back     alignment and function desciption
 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1023 (40%), Positives = 580/1023 (56%), Gaps = 88/1023 (8%)

Query: 1   MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLF 60
           MA+ RR+ P  +LD+ QIL EA++RWLRP EICEIL+NYQ+F ++ +PP  P +GS+F+F
Sbjct: 1   MAEARRFSPVHELDVGQILSEARHRWLRPPEICEILQNYQRFQISTEPPTTPSSGSVFMF 60

Query: 61  DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWML 120
           DRK LRYFRKDGH WRKKKDGKTVKEAHE+LKAGS+DVLHCYYAHG+DNENFQRRSYW+L
Sbjct: 61  DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL 120

Query: 121 DGQLEHIVLVHYREVKEGYKS------------GRSAADPGSQIESSQTSSARSLAQANS 168
             +L HIV VHY EVK    S             RS  + G  + S     A      N 
Sbjct: 121 QEELSHIVFVHYLEVKGSRVSTSFNRMQRTEDAARSPQETGDALTSEHDGYASCSFNQND 180

Query: 169 SAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSG---HGSGT---------PSVAQSIYGS 216
            +  +QT+ ++  N         S E ED +S    HGS T         P+   ++ G 
Sbjct: 181 HSNHSQTTDSASVNGFH------SPELEDAESAYNQHGSSTAYSHQELQQPATGGNLTGF 234

Query: 217 MSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQN 276
                  +    +   EL   P   +   ++  S +   P + N  +N  S+ D    + 
Sbjct: 235 DPYYQISLTPRDSYQKELRTIPVTDSSIMVDK-SKTINSPGVTNGLKNRKSI-DSQTWEE 292

Query: 277 FYVGQPSGADFI------THKLTDARLASDSTIANIGTCGERLIT--DIDVHAVTTSSQG 328
                 SG + +       H++ D  L S  T+ +  +  E ++   + ++++  TS + 
Sbjct: 293 ILGNCGSGVEALPLQPNSEHEVLDQILESSFTMQDFASLQESMVKSQNQELNSGLTSDRT 352

Query: 329 ASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGE--LKKLDSFGRWMDQEI 386
                 +   N I+N   N   P   ++++ Q  +     LGE  LKK+DSF RWM +E+
Sbjct: 353 VWFQGQDMELNAISNLASNEKAP--YLSTMKQHLLHGA--LGEEGLKKMDSFNRWMSKEL 408

Query: 387 G-----GDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDS--LGPSLSQEQLF 439
           G      D ++S   S S  YW  +++E+      S  H+ + +MD   + PSLS+EQLF
Sbjct: 409 GDVGVIADANESFTQSSSRTYWEEVESED-----GSNGHNSRRDMDGYVMSPSLSKEQLF 463

Query: 440 SIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAP 499
           SI DFSP WAY G E  V + G FL T++ +   +W CMFG+ EVPA+V+++ +++C AP
Sbjct: 464 SINDFSPSWAYVGCEVVVFVTGKFLKTREETEIGEWSCMFGQTEVPADVISNGILQCVAP 523

Query: 500 SHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYL 559
            H AGRVPFY+T SNRLACSEVREFEY+   S+     A   +  D   L+ R  K L  
Sbjct: 524 MHEAGRVPFYVTCSNRLACSEVREFEYKVAESQVFDREADDESTID--ILEARFVKLLCS 581

Query: 560 DPERKW-FDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNL 618
             E          D ++   K ++     D + D   ++E          N ++ L+Q  
Sbjct: 582 KSENTSPVSGNDSDLSQLSEKISLLLFENDDQLDQMLMNEISQE------NMKNNLLQEF 635

Query: 619 LRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARG 678
           L+  L  WL+ KI EGGKGP+V+D+GGQGV+H AA+LGY WA+ P I  GVS +FRD  G
Sbjct: 636 LKESLHSWLLQKIAEGGKGPSVLDEGGQGVLHFAASLGYNWALEPTIIAGVSVDFRDVNG 695

Query: 679 RTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAE 738
            TALHWA++FGRE  +  L+ LGAAPG + DP P FP G T +DLA + GHKGIAGYL+E
Sbjct: 696 WTALHWAAFFGRERIIGSLIALGAAPGTLTDPNPDFPSGSTPSDLAYANGHKGIAGYLSE 755

Query: 739 ADLSSHLSSLTVNENGMDNVAAALAAEKANETAAQIGVQSDGPAAEQLSLRGSLAAVRKS 798
             L +H+S L++N+   + V  A +   ++ T +                     AVR +
Sbjct: 756 YALRAHVSLLSLNDKNAETVEMAPSPSSSSLTDSL-------------------TAVRNA 796

Query: 799 AHAAALIQQAFRVRSFRHRQSIQSSDDVSEVSVD--LVALGSLNKVSKMIHFEDYLHFAA 856
             AAA I Q FR +SF+ +Q  +  D    +S +  L  L      S   H +D +  AA
Sbjct: 797 TQAAARIHQVFRAQSFQKKQLKEFGDKKLGMSEERALSMLAPKTHKSGRAHSDDSVQAAA 856

Query: 857 IKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRG 916
           I+IQ K+RG+KGRKD+L  R  I+K+QAHVRG+Q RK Y+K++WSV ++EK ILRWRR+G
Sbjct: 857 IRIQNKFRGYKGRKDYLITRQRIIKIQAHVRGYQFRKNYRKIIWSVGVLEKVILRWRRKG 916

Query: 917 SGLRGFRVGNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYM 976
           +GLRGF+       +    EK ++ +F + GRKQ    ++KAL RVKSMV+ PEARDQY 
Sbjct: 917 AGLRGFKSEALVEKMQDGTEKEEDDDFFKQGRKQTEDRLQKALARVKSMVQYPEARDQYR 976

Query: 977 RMV 979
           R++
Sbjct: 977 RLL 979




Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 Back     alignment and function description
>sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 Back     alignment and function description
>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 Back     alignment and function description
>sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 Back     alignment and function description
>sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1017
2254321511018 PREDICTED: calmodulin-binding transcript 0.988 0.987 0.678 0.0
255556532999 calmodulin-binding transcription activat 0.964 0.981 0.643 0.0
224112060933 predicted protein [Populus trichocarpa] 0.908 0.990 0.655 0.0
356564670999 PREDICTED: calmodulin-binding transcript 0.954 0.971 0.621 0.0
449485221989 PREDICTED: calmodulin-binding transcript 0.938 0.964 0.580 0.0
449460391890 PREDICTED: calmodulin-binding transcript 0.854 0.976 0.568 0.0
365927834939 calmodulin-binding transcription factor 0.902 0.977 0.531 0.0
218192235989 hypothetical protein OsI_10332 [Oryza sa 0.900 0.926 0.447 0.0
242036649994 hypothetical protein SORBIDRAFT_01g04448 0.906 0.927 0.447 0.0
3571136561034 PREDICTED: calmodulin-binding transcript 0.929 0.913 0.445 0.0
>gi|225432151|ref|XP_002274846.1| PREDICTED: calmodulin-binding transcription activator 1 [Vitis vinifera] gi|297736797|emb|CBI25998.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1368 bits (3542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1029 (67%), Positives = 810/1029 (78%), Gaps = 24/1029 (2%)

Query: 1    MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLF 60
            MA++RRYVPNQQLDLEQIL EAQ+RWLRPTEICEILRNYQKF +TPDPPV PPAGSLFLF
Sbjct: 1    MAESRRYVPNQQLDLEQILLEAQHRWLRPTEICEILRNYQKFLITPDPPVTPPAGSLFLF 60

Query: 61   DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWML 120
            DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGS+DVLHCYYAHGEDNENFQRRSYWML
Sbjct: 61   DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWML 120

Query: 121  DGQLEHIVLVHYREVKEGYKSGRSA-----ADPGSQIESSQTSSARSLAQANSSAPAAQT 175
            D QLEHIVLVHYRE+KEGYK+  S      A P SQI + Q SSA  L+Q N+     Q 
Sbjct: 121  DEQLEHIVLVHYREIKEGYKTSTSVPRLPNAVPASQIGTIQGSSAPCLSQGNAPTVTGQI 180

Query: 176  SHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELS 235
            S+AS PN  DW+GQ +SSEFED DSG   GT S+AQ I GS+  NASL     +G   LS
Sbjct: 181  SYASSPNTADWSGQTLSSEFEDGDSGDDPGTSSLAQPILGSVFYNASLPTHEASGFAGLS 240

Query: 236  RHP--QWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLT 293
            R+      AG   +HG+ +S+  +I  SS   +SV DQ     F   QP+GADFIT+KLT
Sbjct: 241  RNQLGSGLAGVHFSHGASTSVQDEIHGSS---SSVHDQ----KFGFEQPNGADFITNKLT 293

Query: 294  DARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEV 353
            DARL SD T+ N    G+ L   +D+  +T +SQ A Q  LEHNF+L++ Q QNC    V
Sbjct: 294  DARLDSDRTVQNFAARGDGLSPALDIKGLTAASQRAVQGPLEHNFHLVHPQFQNCSSSHV 353

Query: 354  TVASVSQAGIKPKEE------LGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLD 407
               S +    K KE+       GELKKLDSFGRWMD+EIGGDCDDSLMASDSGNYWNTLD
Sbjct: 354  ADTSTAHIENKSKEDGANNDASGELKKLDSFGRWMDKEIGGDCDDSLMASDSGNYWNTLD 413

Query: 408  AENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTK 467
             +NDDKEVSSLS HMQL++DSL PSLSQEQLF+I DFSPDWAYS  ETKVLIIG FLG  
Sbjct: 414  TQNDDKEVSSLSRHMQLDIDSLAPSLSQEQLFTINDFSPDWAYSEDETKVLIIGTFLGGM 473

Query: 468  KLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYR 527
            + S++TKW CMFGEIEV AEVLT+NVIRC AP HA GRVPFY+T SNRLACSEVREFEYR
Sbjct: 474  EHSTNTKWCCMFGEIEVSAEVLTNNVIRCHAPLHAPGRVPFYVTCSNRLACSEVREFEYR 533

Query: 528  EKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRG 587
            EKPS+  + +A +  PED+V+ Q +LAK L+L  ERKW DC+IE+C+KCK+K+ IYS + 
Sbjct: 534  EKPSRVAFSMAVRSTPEDDVQFQIQLAKMLHLGQERKWLDCSIEECDKCKIKSDIYSKKD 593

Query: 588  DSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQG 647
            D + DW  ++ +   I G+  N RD LI+NLL++RL EWLV K+HEG +GP+V+D  GQG
Sbjct: 594  DIKNDWEELEMAKDFI-GNHVNPRDVLIKNLLKDRLFEWLVCKVHEGVRGPHVLDGKGQG 652

Query: 648  VVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAV 707
            V+HLAAALGYEWAM PII  GVSPNFRDARGRT LHWASYFGREETVI LVKLG +P AV
Sbjct: 653  VIHLAAALGYEWAMGPIIVAGVSPNFRDARGRTGLHWASYFGREETVIALVKLGTSPDAV 712

Query: 708  EDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAAEKA 767
            EDPTPAFPGGQTAADLASSRGHKGIAGYLAEA LSSHL SL+ +EN MD+V+A +AAEKA
Sbjct: 713  EDPTPAFPGGQTAADLASSRGHKGIAGYLAEAHLSSHLCSLSPSENVMDSVSANIAAEKA 772

Query: 768  NETAAQIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDVS 827
             +TA Q     DG   EQLSL+GSLAA+RKSAHAAALIQ A R RSFR R+  +S+DD+S
Sbjct: 773  AQTAVQ---NVDGVIEEQLSLKGSLAALRKSAHAAALIQAALRARSFRDRRLTRSNDDIS 829

Query: 828  EVSVDLVALGSLNKVSKMIHFEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVR 887
            E S+DLVALGSLNKVSKM HF+DYLH AA+KIQQKYRGWKGR+DFLKIR+ IVK+QAHVR
Sbjct: 830  EASLDLVALGSLNKVSKMGHFKDYLHSAAVKIQQKYRGWKGREDFLKIRSRIVKIQAHVR 889

Query: 888  GHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVGNSTANVASENEKTDEYEFLRIG 947
            GHQVRKQYKKVVWSV IVEKAILRWRR+GSGLRGFR+     N   E  KTDEY++LR+G
Sbjct: 890  GHQVRKQYKKVVWSVGIVEKAILRWRRKGSGLRGFRLEKPIGNAVPEVGKTDEYDYLRVG 949

Query: 948  RKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCDDGSGLLSQGEDSLNGPTK 1007
            R+QKFAGVEKAL RV+SMVR+PEARDQYMR+V+KF+N ++ D+GS  L Q E S     +
Sbjct: 950  RRQKFAGVEKALARVQSMVRHPEARDQYMRLVSKFDNLQIGDEGSSALQQAEKSEKLIKE 1009

Query: 1008 DNLHAYVAD 1016
            ++L +++AD
Sbjct: 1010 EDLGSFIAD 1018




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255556532|ref|XP_002519300.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541615|gb|EEF43164.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112060|ref|XP_002316071.1| predicted protein [Populus trichocarpa] gi|222865111|gb|EEF02242.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356564670|ref|XP_003550574.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449485221|ref|XP_004157104.1| PREDICTED: calmodulin-binding transcription activator 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460391|ref|XP_004147929.1| PREDICTED: calmodulin-binding transcription activator 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|365927834|gb|AEX07777.1| calmodulin-binding transcription factor SR4 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|218192235|gb|EEC74662.1| hypothetical protein OsI_10332 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242036649|ref|XP_002465719.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor] gi|241919573|gb|EER92717.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357113656|ref|XP_003558617.1| PREDICTED: calmodulin-binding transcription activator 1-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1017
TAIR|locus:21733681050 AT5G64220 [Arabidopsis thalian 0.600 0.581 0.401 3.2e-173
TAIR|locus:20195341016 AT1G67310 [Arabidopsis thalian 0.535 0.536 0.376 3.7e-131
TAIR|locus:2130125923 AT4G16150 [Arabidopsis thalian 0.581 0.640 0.313 3e-110
TAIR|locus:20604051032 SR1 "signal responsive 1" [Ara 0.713 0.703 0.312 1.3e-88
UNIPROTKB|Q9Y6Y1 1673 CAMTA1 "Calmodulin-binding tra 0.112 0.068 0.428 1.3e-31
UNIPROTKB|F1PDC5 1596 CAMTA1 "Uncharacterized protei 0.100 0.063 0.448 2.7e-29
UNIPROTKB|O94983 1202 CAMTA2 "Calmodulin-binding tra 0.113 0.095 0.416 1.2e-28
UNIPROTKB|F1RFY4 1201 CAMTA2 "Uncharacterized protei 0.113 0.095 0.416 3e-28
UNIPROTKB|F1P8J0 1204 CAMTA2 "Uncharacterized protei 0.113 0.095 0.416 5.4e-28
UNIPROTKB|E1BH04 1196 Bt.24734 "Uncharacterized prot 0.113 0.096 0.416 9.4e-28
TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1129 (402.5 bits), Expect = 3.2e-173, Sum P(2) = 3.2e-173
 Identities = 260/648 (40%), Positives = 371/648 (57%)

Query:   376 DSFGRWMDQEIGGDCDDSLMASDSGNY-WNTLDAENDDKEVSSLSHHMQLEMDSLGPSLS 434
             DSF RW+ +E+G + +D  M S SG   W +++ EN     ++ S        SL PSLS
Sbjct:   409 DSFSRWVSKELG-EMEDLQMQSSSGGIAWTSVECEN----AAAGS--------SLSPSLS 455

Query:   435 QEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVI 494
             ++Q F++ DF P W  + +E +V++IG FL + +  +   W CMFGE+EVPA++L D V+
Sbjct:   456 EDQRFTMIDFWPKWTQTDSEVEVMVIGTFLLSPQEVTSYSWSCMFGEVEVPADILVDGVL 515

Query:   495 RCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKI--APEDEVRLQTR 552
              C AP H  GRVPFYIT S+R +CSEVREF++   P       A+ I  A   E  L  R
Sbjct:   516 CCHAPPHEVGRVPFYITCSDRFSCSEVREFDFL--PGSTRKLNATDIYGANTIETSLHLR 573

Query:   553 LAKFLYLD---PERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDW-GRVDESPMAIEGDCP 608
                 L L     E   F+   E   K    + I  ++ + E    G +++    +E    
Sbjct:   574 FENLLALRCSVQEHHIFENVGEKRRKI---SKIMLLKDEKEPPLPGTIEKDLTELE---- 626

Query:   609 NSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATG 668
              ++++LI+    ++L  WL+ K+ E GKGPN++D+ GQGV+HLAAALGY+WA++PI+A G
Sbjct:   627 -AKERLIREEFEDKLYLWLIHKVTEEGKGPNILDEDGQGVLHLAAALGYDWAIKPILAAG 685

Query:   669 VSPNFRDARGRTALHWASYFGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRG 728
             VS NFRDA G +ALHWA++ GRE+TV +LV LGA  GA+ DP+P  P G+TAADLA   G
Sbjct:   686 VSINFRDANGWSALHWAAFSGREDTVAVLVSLGADAGALADPSPEHPLGKTAADLAYGNG 745

Query:   729 HKGIAGYLAEADLSSHLSSLTVNENGMDNVXXXXXXXXXXXXXXQIGVQSDGPAAEQLSL 788
             H+GI+G+LAE+ L+S+L  LTV+     +                    S G   E LS+
Sbjct:   746 HRGISGFLAESSLTSYLEKLTVDAKENSSADSSGAKAVLTVAERTATPMSYGDVPETLSM 805

Query:   789 RGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQXXXXXXXXXXXXXALG-SLNKVSKMIH 847
             + SL AV  +  AA  + Q FR++SF+ +Q  +             A+  +  K  K  H
Sbjct:   806 KDSLTAVLNATQAADRLHQVFRMQSFQRKQLSELGGDNKFDISDELAVSFAAAKTKKSGH 865

Query:   848 FEDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEK 907
                 +H AA++IQ+KYRGWK RK+FL IR  IVK+QAHVRGHQVRKQY+ ++WSV ++EK
Sbjct:   866 SSGAVHAAAVQIQKKYRGWKKRKEFLLIRQRIVKIQAHVRGHQVRKQYRAIIWSVGLLEK 925

Query:   908 AILX---XXXXXXXXXXXXXXNSTANVASENEKTDEYEFLRIGRKQKFAGVEKALERVKS 964
              IL                    T  V    ++ D+Y+FL+ GRKQ    ++KAL RVKS
Sbjct:   926 IILRWRRKGSGLRGFKRDTISKPTEPVCPAPQE-DDYDFLKEGRKQTEERLQKALTRVKS 984

Query:   965 MVRNPEARDQYMRMVAKFENFKM--CDDGSGLLSQGEDSLNGPTKDNL 1010
             M + PEAR QY R++   E F+       S L +  E++ N   +D+L
Sbjct:   985 MAQYPEARAQYRRLLTVVEGFRENEASSSSALKNNTEEAANYNEEDDL 1032


GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDC5 CAMTA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8J0 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GSA7CMTA3_ARATHNo assigned EC number0.40560.91930.9060yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1017
pfam03859119 pfam03859, CG-1, CG-1 domain 6e-67
smart01076118 smart01076, CG-1, CG-1 domains are highly conserve 1e-61
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-08
pfam0183384 pfam01833, TIG, IPT/TIG domain 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-04
cd0010289 cd00102, IPT, Immunoglobulin-like fold, Plexins, T 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.004
cd0060390 cd00603, IPT_PCSR, IPT domain of Plexins and Cell 0.004
pfam0061221 pfam00612, IQ, IQ calmodulin-binding motif 0.004
>gnl|CDD|217766 pfam03859, CG-1, CG-1 domain Back     alignment and domain information
 Score =  219 bits (560), Expect = 6e-67
 Identities = 80/119 (67%), Positives = 98/119 (82%)

Query: 18  ILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRK 77
           +L EA+ RWLRP EI  IL+N++K  +T +PP RPP+GSLFL++RK +RYFRKDG+ W+K
Sbjct: 1   LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60

Query: 78  KKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK 136
           KKDGKT +EAHEKLK G ++VL+CYYAHGEDN  FQRR YW+LD  LEHIVLVHY  VK
Sbjct: 61  KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119


CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238050 cd00102, IPT, Immunoglobulin-like fold, Plexins, Transcription factors (IPT) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|238337 cd00603, IPT_PCSR, IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins Back     alignment and domain information
>gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1017
KOG0520975 consensus Uncharacterized conserved protein, conta 100.0
PF03859118 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.86
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.85
PHA02791284 ankyrin-like protein; Provisional 99.78
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.76
PHA02859209 ankyrin repeat protein; Provisional 99.75
PHA02946446 ankyin-like protein; Provisional 99.73
PHA02878477 ankyrin repeat protein; Provisional 99.73
PHA02878477 ankyrin repeat protein; Provisional 99.72
PHA02791284 ankyrin-like protein; Provisional 99.72
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.72
PHA02798489 ankyrin-like protein; Provisional 99.71
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.71
PHA02743166 Viral ankyrin protein; Provisional 99.71
PHA02859209 ankyrin repeat protein; Provisional 99.71
PHA02874434 ankyrin repeat protein; Provisional 99.7
PHA03100480 ankyrin repeat protein; Provisional 99.69
PLN03192823 Voltage-dependent potassium channel; Provisional 99.69
PHA02875413 ankyrin repeat protein; Provisional 99.69
PHA02874434 ankyrin repeat protein; Provisional 99.69
PHA02875413 ankyrin repeat protein; Provisional 99.68
PHA03095471 ankyrin-like protein; Provisional 99.68
PHA03095471 ankyrin-like protein; Provisional 99.67
KOG0508 615 consensus Ankyrin repeat protein [General function 99.67
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.67
PHA02798489 ankyrin-like protein; Provisional 99.66
PHA02989494 ankyrin repeat protein; Provisional 99.66
PHA03100480 ankyrin repeat protein; Provisional 99.66
PHA02989494 ankyrin repeat protein; Provisional 99.66
PHA02876682 ankyrin repeat protein; Provisional 99.65
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.65
PHA02741169 hypothetical protein; Provisional 99.64
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.64
PHA02876682 ankyrin repeat protein; Provisional 99.64
PHA02743166 Viral ankyrin protein; Provisional 99.64
PHA02946446 ankyin-like protein; Provisional 99.64
PHA02795437 ankyrin-like protein; Provisional 99.63
PHA02741169 hypothetical protein; Provisional 99.62
PHA02884300 ankyrin repeat protein; Provisional 99.6
PHA02730672 ankyrin-like protein; Provisional 99.6
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.6
KOG0514452 consensus Ankyrin repeat protein [General function 99.6
PHA02736154 Viral ankyrin protein; Provisional 99.59
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.58
PHA02917 661 ankyrin-like protein; Provisional 99.57
PHA02884300 ankyrin repeat protein; Provisional 99.57
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.56
PHA02917 661 ankyrin-like protein; Provisional 99.56
KOG0508 615 consensus Ankyrin repeat protein [General function 99.55
PHA02736154 Viral ankyrin protein; Provisional 99.55
KOG0510 929 consensus Ankyrin repeat protein [General function 99.55
KOG0510 929 consensus Ankyrin repeat protein [General function 99.54
PHA02795437 ankyrin-like protein; Provisional 99.54
cd0117585 IPT_COE IPT domain of the COE family (Col/Olf-1/EB 99.54
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.52
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.51
PHA02730 672 ankyrin-like protein; Provisional 99.49
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.47
PLN03192823 Voltage-dependent potassium channel; Provisional 99.45
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.43
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.4
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.39
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.39
KOG0514452 consensus Ankyrin repeat protein [General function 99.38
PHA02792631 ankyrin-like protein; Provisional 99.38
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.37
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.36
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.36
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.36
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.34
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.31
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.3
PHA02792631 ankyrin-like protein; Provisional 99.29
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.29
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.28
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.26
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.23
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.21
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.19
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.19
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.19
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.18
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.18
KOG0520975 consensus Uncharacterized conserved protein, conta 99.17
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.09
PF0183385 TIG: IPT/TIG domain; InterPro: IPR002909 This fami 99.08
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.06
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.04
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.04
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.03
cd0117985 IPT_plexin_repeat2 Second repeat of the IPT domain 98.91
cd0010289 IPT Immunoglobulin-like fold, Plexins, Transcripti 98.88
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.86
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.69
cd0060390 IPT_PCSR IPT domain of Plexins and Cell Surface Re 98.6
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.57
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.55
smart0042990 IPT ig-like, plexins, transcription factors. 98.53
cd0118094 IPT_plexin_repeat1 First repeat of the IPT domain 98.52
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.48
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.42
cd0118199 IPT_plexin_repeat3 Third repeat of the IPT domain 98.34
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.33
PF1360630 Ank_3: Ankyrin repeat 98.31
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.27
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.23
cd0284981 CGTase_C_term Cgtase (cyclodextrin glycosyltransfe 98.21
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 98.2
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 98.2
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.15
PF1360630 Ank_3: Ankyrin repeat 98.13
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.12
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.09
KOG0522 560 consensus Ankyrin repeat protein [General function 98.05
KOG0522 560 consensus Ankyrin repeat protein [General function 98.0
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 97.99
COG5022 1463 Myosin heavy chain [Cytoskeleton] 97.9
cd0060481 IPT_CGTD IPT domain (domain D) of cyclodextrin gly 97.88
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.84
KOG2384223 consensus Major histocompatibility complex protein 97.81
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.75
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.72
PTZ00014821 myosin-A; Provisional 97.7
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.64
KOG0511 516 consensus Ankyrin repeat protein [General function 97.54
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 97.51
KOG2384223 consensus Major histocompatibility complex protein 97.46
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 97.25
KOG0511 516 consensus Ankyrin repeat protein [General function 97.17
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.02
COG5022 1463 Myosin heavy chain [Cytoskeleton] 96.76
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.43
smart0001526 IQ Short calmodulin-binding motif containing conse 96.14
cd00602101 IPT_TF IPT domain of eukaryotic transcription fact 96.1
smart0001526 IQ Short calmodulin-binding motif containing conse 95.99
KOG3610 1025 consensus Plexins (functional semaphorin receptors 95.91
KOG0162 1106 consensus Myosin class I heavy chain [Cytoskeleton 95.83
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.66
KOG2505591 consensus Ankyrin repeat protein [General function 95.53
cd0117697 IPT_RBP-Jkappa IPT domain of the recombination sig 95.18
KOG2505591 consensus Ankyrin repeat protein [General function 94.99
cd01178101 IPT_NFAT IPT domain of the NFAT family of transcri 94.95
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 94.91
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 94.52
cd01177102 IPT_NFkappaB IPT domain of the transcription facto 93.76
PF08549669 SWI-SNF_Ssr4: Fungal domain of unknown function (D 92.51
PTZ00014821 myosin-A; Provisional 91.7
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 91.28
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 90.34
KOG01641001 consensus Myosin class I heavy chain [Cytoskeleton 89.9
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 88.93
KOG2128 1401 consensus Ras GTPase-activating protein family - I 87.87
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 87.08
KOG3836605 consensus HLH transcription factor EBF/Olf-1 and r 86.53
KOG2128 1401 consensus Ras GTPase-activating protein family - I 86.04
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 82.25
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 81.09
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=9.4e-135  Score=1206.54  Aligned_cols=891  Identities=39%  Similarity=0.611  Sum_probs=624.9

Q ss_pred             CCCCCCcccHHHHHHHHHhhcCChHHHHHHHHcccccccCCCCCCCCCCCceeeeehhhhhhhhccCccceeccCCCchH
Q 001759            6 RYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVK   85 (1017)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~w~~~~e~~~~l~~~~~~~~~~~~~~~p~~g~~~~~~~~~~~~~~~dg~~w~~~~~~~~~~   85 (1017)
                      -|.+.+.||+..+++|++.|||+|+||++||+||++|.|+.+||+||.|||+||||||+|||||||||+|||||||||+|
T Consensus        16 ~~~sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~WkKkkDGKtir   95 (975)
T KOG0520|consen   16 PFKSLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHNWKKKKDGKTIR   95 (975)
T ss_pred             chhhhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchhhhhcCCCCcCh
Confidence            35556889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcccCCEeeEEEEecccccCccccceeeeeccCCCccEEEEeeeccccCCCCCCCCCCCCCccccccccCcccccc
Q 001759           86 EAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQ  165 (1017)
Q Consensus        86 e~h~~l~~~~~~~~~~~y~~~~~~~~f~rr~y~~~~~~~~~~v~vhy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (1017)
                      ||||||||||+|+||||||||++|||||||||||||+.++||||||||||++-+...+......+.+-|   ....|.. 
T Consensus        96 EaHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~~~~~~~~~~s~~s---d~~~S~~-  171 (975)
T KOG0520|consen   96 EAHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDAAKGAGEIFSSIIS---DKAWSLN-  171 (975)
T ss_pred             HHHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeecccccccccCcccccccccc---cccccHH-
Confidence            999999999999999999999999999999999999999999999999999433321122111111100   0000111 


Q ss_pred             cCCCCCccCCCCCCCccccccCCcccccccccccCCCCCCCCCccccccccccccchhhhhhccCCccccCCCCcccCCC
Q 001759          166 ANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSK  245 (1017)
Q Consensus       166 ~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~e~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (1017)
                              +..+..+|- +. + .  ++..+|++++++++.+..+....|.               .             
T Consensus       172 --------~~~~q~~~~-~~-~-~--~s~~~~v~~i~s~~~~~~~g~~~~~---------------s-------------  210 (975)
T KOG0520|consen  172 --------QLAGQLSPI-FH-N-H--SSVNEDVAEINSNQTGNALGSVFGN---------------S-------------  210 (975)
T ss_pred             --------HhhcccCcc-hh-c-c--cchHHHHHHHhhhccccccccccCc---------------c-------------
Confidence                    222222220 00 0 1  2457888876655554332222110               0             


Q ss_pred             CCCCCCCCCCCCcCCCC-cccccccccCCCCCcccCCCCCccccc--cccccccccc---cccccccCccccccccc--c
Q 001759          246 INHGSGSSMWPQIDNSS-RNATSVLDQHGHQNFYVGQPSGADFIT--HKLTDARLAS---DSTIANIGTCGERLITD--I  317 (1017)
Q Consensus       246 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~---~~~~~~~~~~~~~~~~~--~  317 (1017)
                         ..|...++..+..+ |..+...+.    ++++..|....+..  +.+.......   ...-+|.+..+...+.+  +
T Consensus       211 ---~~h~i~~~~~~s~~~~~~~p~s~~----s~~~~~~~~~~~~~~~~~~~~rs~~~s~~te~l~n~~~~~~~~g~s~s~  283 (975)
T KOG0520|consen  211 ---RNHRIRLHEVNSLDPLYKLPVSDD----SLNLSAPKPIDLPKGPTSVKQRSSSPSYFTEILGNAPSGLVSQGNSLSS  283 (975)
T ss_pred             ---hhhhhcccccCCccccccccccCC----ccccccCCCcccccCCcchhhcCCCCcchhhhcccCCCccccccccccc
Confidence               11111111111111 222222211    00000010000000  0000000000   00000000000000000  0


Q ss_pred             ---ccccccccccccchhhhccccccccccccCCCCCccc--cc----cccc----CCCCCcc--ccccccccCcchhhh
Q 001759          318 ---DVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVT--VA----SVSQ----AGIKPKE--ELGELKKLDSFGRWM  382 (1017)
Q Consensus       318 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~----~~~~----~~~~~~~--~~~~~~~~dsf~~w~  382 (1017)
                         ...+|+.........+...+|..+++...........  ..    ..+.    .....+.  .++|||+.|+|++||
T Consensus       284 ~l~~i~~~~~~~~~~~~~p~~~nf~~~ss~~s~~~~~~~g~g~~~~~~sa~~~~~P~~~~~~~~~~~~~l~sgdsf~~~~  363 (975)
T KOG0520|consen  284 SLQRISSFTGLDNAAYEQPNSQNFEPNSSLNSHVTGQSYGQGLQARSPSATSESRPITSAADAALSELGLKSGDSFSRWA  363 (975)
T ss_pred             chhhcccccccccccccCCccccccccccCCCCccccccCccccCCCcccccccCCcchhhccccccccccccccccchh
Confidence               0001111000000000000111111100000000000  00    0000    0111221  278999999999999


Q ss_pred             HhhhcCCcCCCCccCCCCCcccccccccccccccccccccccccccCCCCcCcCCceEEEEeecCccccCCceEEEEEcc
Q 001759          383 DQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGM  462 (1017)
Q Consensus       383 ~~~l~~~~~~~~~~ss~~~~w~~~~~~~~~~~~~~~~~~~~l~~~~~~~s~~~~q~f~I~d~sP~w~~~~ggtkVlV~G~  462 (1017)
                      + .+++ ..|..-.++.+..|..+.  ....+++++          +++|. .+|+|+|+||||+|+|+.||+||+|+|+
T Consensus       364 ~-t~~e-~~d~~q~~s~~~~~~p~~--~~~~~~~s~----------~~~S~-p~qlf~I~DfSP~Wsy~~ggvKVlV~G~  428 (975)
T KOG0520|consen  364 S-TFGE-ISDLGQDPSGEAVWTPEN--DPMGPPGSF----------LSPSS-PEQLFTITDFSPEWSYLDGGVKVLVTGF  428 (975)
T ss_pred             h-hhcc-cccCCCCCccccccccCC--CcCCCcccc----------cCCCC-CcceeeeeccCcccccCCCCcEEEEecC
Confidence            7 6766 444442233355676662  222233322          55663 3999999999999999999999999998


Q ss_pred             CCCCCCCCCCCceEEEeCCeecceeeeeCCeEEeecCCCCCceeeEEEecC-CCcccCcceeeeeecCCCCCCCCccccC
Q 001759          463 FLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGS-NRLACSEVREFEYREKPSKAGYPVASKI  541 (1017)
Q Consensus       463 ~~~~~~~~~~~~~~c~FGd~~vpae~~~~gvLrC~~Pph~pG~Vp~~Vt~~-n~~~cSEv~~FEyr~~~~~~~~~~~~~~  541 (1017)
                      +    .+.+...|+||||+++|||++|++|||||+||||.||+|+|||+|+ ++.+|||+++|+|...+....+..+ ..
T Consensus       429 ~----~~~~~~~ysc~Fg~~~VPAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s-~~  503 (975)
T KOG0520|consen  429 P----QDETRSNYSCMFGEQRVPAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLS-WE  503 (975)
T ss_pred             c----cccCCCceEEEeCCccccHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccc-cc
Confidence            3    3456899999999999999999999999999999999999999999 8999999999999999888776544 11


Q ss_pred             CCchHHHHHHHHHHhhccCCCc-ccccccccchhhhh--hHHHHhhcccCCCCcccc-ccccccccccC---CCchHHHH
Q 001759          542 APEDEVRLQTRLAKFLYLDPER-KWFDCTIEDCNKCK--LKNTIYSMRGDSEKDWGR-VDESPMAIEGD---CPNSRDKL  614 (1017)
Q Consensus       542 ~~~~e~~Lq~Rl~~LL~~~~~~-~~~~~~~~~~ek~~--l~~~i~~l~~~~~~~w~~-l~e~l~~~~~~---~~~~~~~l  614 (1017)
                      ....++.|+.||..|+...... .+....++..+...  +..++..+    .+.|.. +   +.....+   ..+.++.+
T Consensus       504 d~~~~~sl~~rl~~~~~r~~~~~~s~~~~~n~~~~~~~~l~skv~~l----~~~~~~r~---~~~~~~~~~~~~~~r~~l  576 (975)
T KOG0520|consen  504 DFLFQMSLLHRLETMLNRKQSILSSKPSTENTSDAESGNLASKVVHL----LNEWAYRL---LKSISENLSSSVNFRDML  576 (975)
T ss_pred             cchhhhHHHHHHHHHHHHhHhHhhccCCccccccccchhHHHHHHHH----HHHHHHHH---HhhHhhhccccCCCcchH
Confidence            3445566677777776622222 22333344444444  66777766    556666 4   3333222   27788999


Q ss_pred             HHHHHHhhHHHHHHHHHHhC-CCCCCccCCCCCcHHHHHHHcCChhhHHHHHhCCCCCCccCCCCCchhhHHHhcCCHHH
Q 001759          615 IQNLLRNRLCEWLVWKIHEG-GKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGREET  693 (1017)
Q Consensus       615 l~~al~~~l~e~Lv~~Lle~-Gad~n~~D~~G~TpLH~Aa~~G~~~iV~~LL~~Gadvn~~D~~G~TPLH~Aa~~G~~ei  693 (1017)
                      |..++++.++.||++++++. |...+..|.+|+..+|++|..|+.+.+.+.+..|..++++|..||||||||+.+|++.+
T Consensus       577 llhL~a~~lyawLie~~~e~~~~~~~eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l  656 (975)
T KOG0520|consen  577 LLHLLAELLYAWLIEKVIEWAGSGDLELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKL  656 (975)
T ss_pred             HHHHHHHHhHHHHHHHHhcccccCchhhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHH
Confidence            99999999999999999997 88889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHHhcCcHHHHHHHHHccCCCCCcCCccccCcc-chhHHHHHhHHHHHHHH
Q 001759          694 VIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGM-DNVAAALAAEKANETAA  772 (1017)
Q Consensus       694 V~~LL~~GAdvn~~dd~~~~d~~G~TPLhlAa~~G~~~iv~~LLe~Ga~~~~a~l~l~d~~~-G~Ta~~ia~~~~v~~L~  772 (1017)
                      +..|++.|++.++.++|++.++.|.|+..+|..+||.++..+|.++.+..++.++...+... +.++..-    ..+...
T Consensus       657 ~a~l~~lga~~~~~tdps~~~p~g~ta~~la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~----~~~t~~  732 (975)
T KOG0520|consen  657 VASLIELGADPGAVTDPSPETPGGKTAADLARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDK----AEKTSS  732 (975)
T ss_pred             HHHHHHhccccccccCCCCCCCCCCchhhhhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhhh----hhhccC
Confidence            99999999999999999999999999999999999999999999999888888887776321 2222222    122221


Q ss_pred             HcCCCCCCCchhhhhhhhchHHHHHhHHHHHHHHHHHHHHhhhhhhhcccCCch-----hHHHHHHHHhccccccccchh
Q 001759          773 QIGVQSDGPAAEQLSLRGSLAAVRKSAHAAALIQQAFRVRSFRHRQSIQSSDDV-----SEVSVDLVALGSLNKVSKMIH  847 (1017)
Q Consensus       773 e~~a~~~~~~~~~lslkdsL~AVR~A~~AA~rIQ~afR~~s~Rkr~L~~~~~~~-----~e~~~sila~q~~~r~~~~~~  847 (1017)
                      +.   +.+.+.+..+|+|+|+|+|+|+++|++||++||+++++++.+.....+.     .+.+.++.+.       .+-.
T Consensus       733 e~---s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~~~~~~~~a~~i~~~~~~~i~~~~~~~m~~~-------~a~~  802 (975)
T KOG0520|consen  733 EG---SPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRAQSFQKKQAREIMDATKEQISEELAVSMKAS-------SAFS  802 (975)
T ss_pred             CC---CCCCCccccccccccccccchHHHHHhhhhhhhhhhhhhhhHHHHHhhcchhhhhhhhhhhhcc-------cchh
Confidence            22   2233344556999999999999999999999999999988876654322     3333333332       2111


Q ss_pred             -h-HHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccc
Q 001759          848 -F-EDYLHFAAIKIQQKYRGWKGRKDFLKIRNHIVKLQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRRGSGLRGFRVG  925 (1017)
Q Consensus       848 -~-~~~~~~AAv~IQk~~Rg~~~Rk~fl~~R~~aV~IQa~~Rg~qaRK~yk~l~~Sv~~lek~i~rwrrkr~~Lr~~~~e  925 (1017)
                       + ++....||..||+.||||+.|++|+.+|+.+|+||+++||++.||+|+++.|||+.+||+++|||++++++|+|+.+
T Consensus       803 ~~~~r~~~~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~  882 (975)
T KOG0520|consen  803 MCDDRSDPAAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQVRKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGR  882 (975)
T ss_pred             cCccccchhHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhHhhhhheechhhhHHHHHHHHHHHhhhhhcccccc
Confidence             1 33567899999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             ccccccc-cccccccHHHHHHHHHHHHHHHHHHHHHHHHhhhhcHHHHHHHHHHHHHHHHhhhhh
Q 001759          926 NSTANVA-SENEKTDEYEFLRIGRKQKFAGVEKALERVKSMVRNPEARDQYMRMVAKFENFKMCD  989 (1017)
Q Consensus       926 ~~~~~~~-~~~~~~~~~d~L~~~rkq~e~~~~~A~~rVqs~~r~~~AR~qyrrl~~e~~~ak~~~  989 (1017)
                      ...+... +....++.++|+|+.++++++++++|+++||+|+|+++||+|||||+.-+++.|...
T Consensus       883 ~~~e~~~~a~t~~e~~yd~yKq~~~~~~~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~~~~~~~  947 (975)
T KOG0520|consen  883 ALFEEQETAATVIEDCYDFYKQLRKQTEERLTRAVVRVQSMFRSPKAQQQYRRLLLVYEQYQESY  947 (975)
T ss_pred             cchhccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhhh
Confidence            7554322 234558999999999999999999999999999999999999999998887777654



>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>smart00429 IPT ig-like, plexins, transcription factors Back     alignment and domain information
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and recombination signal J-kappa binding protein (RBP-Jkappa) Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa) Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors Back     alignment and domain information
>PF08549 SWI-SNF_Ssr4: Fungal domain of unknown function (DUF1750); InterPro: IPR013859 This is a fungal protein of unknown function Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription] Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1017
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
2cxk_A95 Crystal Structure Of The Tig Domain Of Human Calmod 2e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 9e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-04
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 2e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-04
1uoh_A226 Human Gankyrin Length = 226 6e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 9e-04
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 6/109 (5%) Query: 628 VWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASY 687 V + E G PN D G+ +H AA G++ ++ +++ G PN +D+ GRT LH+A+ Sbjct: 20 VKDLLENGADPNASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAE 79 Query: 688 FGREETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYL 736 G +E V +L+ GA DP G+T A+ GHK I L Sbjct: 80 NGHKEIVKLLLSKGA------DPNAKDSDGRTPLHYAAENGHKEIVKLL 122
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1017
2cxk_A95 Camta1, calmodulin binding transcription activator 1e-36
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 9e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-07
3muj_A138 Transcription factor COE3; immunoglobulin like fol 4e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-09
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-05
2rfa_A232 Transient receptor potential cation channel subfa 5e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-06
2rfa_A232 Transient receptor potential cation channel subfa 2e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-06
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 3e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-07
2pnn_A273 Transient receptor potential cation channel subfa 3e-07
2pnn_A273 Transient receptor potential cation channel subfa 9e-07
2pnn_A273 Transient receptor potential cation channel subfa 3e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-06
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-06
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 6e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-06
3mlp_A402 Transcription factor COE1; transcription factor, p 3e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-06
2uzx_B727 Hepatocyte growth factor receptor; signaling prote 2e-05
2etb_A256 Transient receptor potential cation channel subfam 3e-05
2etb_A256 Transient receptor potential cation channel subfam 4e-05
2etb_A256 Transient receptor potential cation channel subfam 7e-05
2etb_A256 Transient receptor potential cation channel subfam 9e-05
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 Back     alignment and structure
 Score =  132 bits (333), Expect = 1e-36
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 6/99 (6%)

Query: 434 SQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNV 493
           S      + D+SP+W+Y     KVLI G +       +   + C+F +I VPA ++   V
Sbjct: 2   SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQ-----EASNNYSCLFDQISVPASLIQPGV 56

Query: 494 IRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSK 532
           +RC  P+H  G V   +  +N++  + V  FEY+  PS 
Sbjct: 57  LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEYKSGPSS 94


>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A Length = 402 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A Length = 727 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1017
d2cxka182 b.1.18.1 (A:872-953) Calmodulin binding transcript 4e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
d2mysa2794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 9e-08
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 1e-07
d1cxla187 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotran 2e-07
d3bmva183 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotran 8e-07
d1qhoa181 b.1.18.2 (A:496-576) Five domain "maltogenic" alph 9e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d1uadc_92 b.1.18.18 (C:) Exocyst complex component Sec5, Ral 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1cyga183 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotran 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain
domain: Calmodulin binding transcription activator 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.7 bits (146), Expect = 4e-12
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 441 IRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPS 500
           + D+SP+W+Y     KVLI G +       +   + C+F +I VPA ++   V+RC  P+
Sbjct: 2   VTDYSPEWSYPEGGVKVLITGPWQ-----EASNNYSCLFDQISVPASLIQPGVLRCYCPA 56

Query: 501 HAAGRVPFYITGSNRLACSEVREFEYR 527
           H  G V   +  +N++  + V  FEY+
Sbjct: 57  HDTGLVTLQVAFNNQIISNSV-VFEYK 82


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} Length = 87 Back     information, alignment and structure
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Length = 83 Back     information, alignment and structure
>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 81 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 83 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1017
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.81
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.8
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.79
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.75
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.74
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.72
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.72
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.72
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.71
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.7
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.7
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.7
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.7
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.67
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.65
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.65
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.65
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.64
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.64
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.63
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.63
d2cxka182 Calmodulin binding transcription activator 1 {Huma 99.61
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.6
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.6
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.57
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.52
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.5
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.49
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.48
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.47
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 98.94
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 98.94
d1p7hl1103 T-cell transcription factor NFAT1 (NFATC2) {Human 98.75
d1qhoa181 Five domain "maltogenic" alpha-amylase (glucan 1,4 98.66
d1uadc_92 Exocyst complex component Sec5, Ral-binding domain 98.53
d1cxla187 Cyclomaltodextrin glycanotransferase, domain D {Ba 98.5
d3bmva183 Cyclomaltodextrin glycanotransferase, domain D {Th 98.4
d3brda1119 DNA-binding protein LAG-1 (CSL) {Caenorhabditis el 98.39
d1cyga183 Cyclomaltodextrin glycanotransferase, domain D {Ba 98.34
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 97.73
d1imhc1101 T-cell transcription factor NFAT5 (TONEBP) {Human 97.45
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 97.38
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 97.36
d1u36a_104 p50 subunit of NF-kappa B transcription factor {Hu 96.72
d1my7a_107 p65 subunit of NF-kappa B (NFKB), dimerization dom 96.61
d1gjia1100 p65 subunit of NF-kappa B (NFKB), dimerization dom 96.54
d1a3qa1101 p52 subunit of NF-kappa B (NFKB) {Human (Homo sapi 96.31
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 94.54
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=2.2e-18  Score=142.12  Aligned_cols=140  Identities=18%  Similarity=0.199  Sum_probs=124.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCH
Q ss_conf             89999999852899999999939999985589998299999992995447998848999874478998556688831999
Q 001759          612 DKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGRE  691 (1017)
Q Consensus       612 ~~ll~~a~~~~l~e~Li~~Lle~Ga~in~~D~~G~TpLHlAA~~G~~~~V~~LL~~Gadvn~~D~~G~TPLH~Aa~~G~~  691 (1017)
                      ...++.++..+. ..+++.|++.|++++..|..|.||||+|+..|+.+++++|+++|++++.++..|.||||+|+..++.
T Consensus        71 ~~~~~~~~~~~~-~~i~~~Ll~~~~d~~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~g~d~~~~~~~~~t~L~~a~~~~~~  149 (223)
T d1uoha_          71 WSPLHIAASAGR-DEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNL  149 (223)
T ss_dssp             CCHHHHHHHHTC-HHHHHHHHHTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCH
T ss_pred             CCCCCCCCCCCC-CCHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCCC
T ss_conf             233222222111-1016777406864675489999662698876989999999987899987689999501023213874


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9999999749999997899999999998999999639299999999806888876786555765034999975
Q 001759          692 ETVIMLVKLGAAPGAVEDPTPAFPGGQTAADLASSRGHKGIAGYLAEADLSSHLSSLTVNENGMDNVAAALAA  764 (1017)
Q Consensus       692 eiV~~LL~~GA~~~~~dd~~~~d~~G~TPLhlAa~~Gh~~iv~~Lle~Ga~~~la~l~l~d~~~G~Taa~ia~  764 (1017)
                      .++++|+..+.+++..+      ..|.||||+|+..|+.+++++|++.|     ++++.+|.. |.||++++.
T Consensus       150 ~~~~~L~~~~~~i~~~d------~~g~TpL~~Aa~~g~~~~v~~LL~~G-----ad~~~~d~~-g~tpl~~A~  210 (223)
T d1uoha_         150 KMIHILLYYKASTNIQD------TEGNTPLHLACDEERVEEAKLLVSQG-----ASIYIENKE-EKTPLQVAK  210 (223)
T ss_dssp             HHHHHHHHTTCCSCCCC------TTCCCHHHHHHHTTCHHHHHHHHHTT-----CCSCCCCTT-SCCHHHHCC
T ss_pred             CHHHHHCCCCCEEEECC------CCCCCEECCCCCCCCHHHHHHHHHCC-----CCCCCCCCC-CCCHHHHHH
T ss_conf             20233202232012036------88874112100258499999999877-----999887999-999999987



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]} Back     information, alignment and structure
>d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure