Citrus Sinensis ID: 001830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------101
MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVTDDPSIRSSNPLPAMESFGHSDLRSTKSQAPEQVPSSAPDPFSDDKARRRHTFHHLPNANISQQQQHSSPSAAQPSMNYGAYEMKSEPQASKIVHTYSGLSSQPTDYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDAVTPTDSPSNVSTHIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML
ccccEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEEccccccccccEEEEEEEccccccccEEEEEEEEcccccccccccEEEEEEccccccccccEEEEEcccccccccEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEccccccccccccccccEEEEcccccccEEEEEEEEEEEEcccccccccccccccccccccccccccEEEccccccccccEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEEcccccccccccEEEEEEEccccccEEEEEEEccccccccEEEEEEEEcccccccccccccccEEEEccccccccccccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEEEEccccEEEEEEEEcccccccccccccccEEEEEEccccccccEEEEEEEcccccccccccccEEEEEEEEEEEcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccEEEcHHHHHHHHHHHHEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccccccccc
cccEEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEccccccccEEEEEEEcccccccccEEEEEEEEccccccccccEEEEEEEccccccccccccEEccccccccccccEEEEEEEEEEEccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEccccccccEEEEEEcccccccEEEEEEEEccccccccEEEEEEEHHccccccccccccccEEEEccccccccccEEEEEEEEEccccccccHHHHHccccccccccccccccccccccccccEEEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEccccccccccccEEEEEEEcccccEEEEEEEEcccccccccEEEEEEEHHHHHHccccccccccEcccccccccccccccccccccEEEEEEEEEccccEEEccccccccccccccHHHHcccccEEEEEEEEEccccccccccccccccccEEEEEEcccEEEEEEEccccccccccEEEEEEEccccEEEEEEEEccccccccccccccccEEEEEEEEcccccEEEccEccEEcccccccccEEEEEEEEEEcHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccHccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEHHHHHcccccHHcccccccHHHHHHccccccccc
MSHLKLGVEVVSAyelmpkdgqgssnAFVELHFdgqkfrtttkekdltpvwnesfyfnisdphnlsnlaLDAYVynhnrttnsksflgkvrltgtsfvpysdavvlhyplekrsifsrvkgelglkvfvtddpsirssnplpamesfghsdlrstksqapeqvpssapdpfsddkarrrhtfhhlpnanisqqqqhsspsaaqpsmnygayemksepqaskivhtysglssqptdyalketspflgggqviggrvvrgdlrastYDLVEQMRYLFVRVVKardlpskdvtgsldpfvevkvgnyKGITKYYEkkqnpewnEVFAFSRERIQSSVLEVAVkdkdvvkddyVGLVRfdlnevptrvppdsplaAEWYRLEdrkgekkkGELMLAVWYGtqadeafpdawhsdavtptdspsnvsthirskvyhsprlwYVRVNVMEAQdlvisdknrfpdaYVKVQIGNQVLKTKSvqsrtlnpvwnedmmfvasepfedhliltvedrvgpnkdetigkvviplhsvekraddrivhtRWFNLEKSVSaaldgdnakkdkfssrlHLRVCLDggyhvldesthyssdlrptakqlwkpsigvlelgilnadglhpmktrdgrgtadtycvakyghkwVRTRTIINSLSAKyneqytwevydpatvltvgvfdnshiggssgskdvkigkVRIRISTLetgrvythsypllvlhpsgvkkmGELHLAIRFSYTSFANMMflysrpllpkmhyvrpltMAQQDMLRHQAVNIVAARlsraepplrKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWfgevcmwrnpiTTVLVHILFVMLVYFPELILPTVFLYMFMIGLwnyryrprypphmntrisyadavhpdeldeefdtfpttrspdivRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCyimrhprfrhktpsapinffrrlpartdsml
MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKfrtttkekdltpVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVfvtddpsirssNPLPAMESFGHSDLRSTksqapeqvpssapdpfsdDKARRRHTFHHlpnanisqqqqhsspSAAQPSMNYGAYEMKSEPQASKIVHTYSGLSSQPTDYALKETspflgggqviggrvvRGDLRASTYDLVEQMRYLFVRVVkardlpskdvtgsldpfvevkvgnYKGITKYYEKKQNPEWNEVFAFSRERIQSSVlevavkdkdvvkddyvglvrfdlnevptrvppdsplaaEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDAVtptdspsnvsthirskvyhsprlWYVRVNVMEAQDLVISDKNRFPDAYVKVQignqvlktksvqsrtlnpVWNEDMMFVASEPFEDHLILTVEdrvgpnkdetigkvviplhsvekraddrivhtrWFNLEKsvsaaldgdnakkdkfssrlHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILnadglhpmktrdgrgtADTYcvakyghkwvrtRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDnshiggssgskdvkigkVRIRIStletgrvythsypllVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAArlsraepplrkEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDEldeefdtfpttrspdivrMRYDRLRSVAGRiqtvvgdvatqgERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHprfrhktpsapinffrrlpartdsml
MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVTDDPSIRSSNPLPAMESFGHSDLRSTKSQAPEQVPSSAPDPFSDDKARRRHTFHHLPNANIsqqqqhsspsaaqpsMNYGAYEMKSEPQASKIVHTYSGLSSQPTDYALKETSPFLgggqviggrvvrgDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAvkdkdvvkddYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDAVTPTDSPSNVSTHIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML
*******VEVVSAYE***********AFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVT*********************************************************************************************************YALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRV****PLAAEWYRLE********GELMLAVWYGTQADEAFPDAWHS**************HIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSAAL********KFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKT**APINFF***********
**HLKLGVEVVSAYELMPKD**GSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLH**LE******RVKGELGLKVFVTDDPSIRSSNPLPAMESFGHSD**********QVPSSAPDPFSDDKARRRHTFHHLPNANISQQQQ*************************KIVHTYSGLSSQPTDYALKETSPFLGG***********DLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLED*****KKGELMLAVWYGTQADEA****************************HSPRLWYVRVNVMEAQDL******RFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSA**********KFSSRLHLRVCLDGGYH*******************WKPSIGVLELGILNADG*************DTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPS***KMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRY*************************************RYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPART*SML
MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVTDDPSIRSSNPLPAMESFGH**********************SDDKARRRHTFHHLPNAN**************PSMNYGAYEMKSEPQASKIVHTYSGLSSQPTDYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDA************HIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML
*SHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVTDDP**********************************************************************************************************************************TYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSD**************IRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSV********AKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPH*N**I*Y******DELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGELGLKVFVTDDPSIRSSNPLPAMESFGHSDLRSTKSQAPEQVPSSAPDPFSDDKARRRHTFHHLPNANISQQQQHSSPSAAQPSMNYGAYEMKSEPQASKIVHTYSGLSSQPTDYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDAVTPTDSPSNVSTHIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1008 2.2.26 [Sep-21-2011]
Q6DN14999 Multiple C2 and transmemb yes no 0.620 0.625 0.208 1e-19
Q5RJH2878 Multiple C2 and transmemb no no 0.607 0.697 0.213 8e-16
O43581403 Synaptotagmin-7 OS=Homo s no no 0.213 0.533 0.281 1e-14
Q6DN12878 Multiple C2 and transmemb no no 0.683 0.784 0.200 2e-14
A0JJX5569 Synaptotagmin-4 OS=Arabid no no 0.276 0.490 0.291 3e-14
Q9R0N7403 Synaptotagmin-7 OS=Mus mu no no 0.213 0.533 0.277 2e-13
O43374 803 Ras GTPase-activating pro no no 0.248 0.311 0.239 2e-12
C9J798 803 Putative Ras GTPase-activ no no 0.248 0.311 0.239 2e-12
Q3TZZ7845 Extended synaptotagmin-2 no no 0.25 0.298 0.263 6e-12
Q9ZVT9 1020 C2 and GRAM domain-contai no no 0.139 0.138 0.331 9e-12
>sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 160/766 (20%), Positives = 301/766 (39%), Gaps = 141/766 (18%)

Query: 271 MRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGI-TKYYEKKQNPEWNEVFAFSRER 329
           M  L + + + + L ++D  G+ DP+V+ K+G  +   +K   K  NP W E      + 
Sbjct: 260 MYQLDITLRRGQSLAARDRGGTSDPYVKFKIGGKEVFRSKIIHKNLNPVWEEKACILVDH 319

Query: 330 IQSSVLEVAVKDKDV-VKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLED--------- 379
           ++   L + V D D  ++DD++G    DL ++    P D  L  +     D         
Sbjct: 320 LREP-LYIKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLS 378

Query: 380 -----RKGEKKKGELML------------------------AVWYGTQADEAFPDAWHSD 410
                ++GE +   +++                        ++++ T    A P      
Sbjct: 379 VILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKSLFWRTCGRPALPVLGFCR 438

Query: 411 AVTPTDSPSNVSTHIRS----KVYHSPRLW--YVRVNVMEAQDLVISDKNRFPDAYVKVQ 464
           A        NV    +S     ++    LW   V + ++E +DL   D N   D YVK +
Sbjct: 439 AELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGLSDPYVKFR 498

Query: 465 IGNQVLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLH 524
           +G+Q  K+K +  +TLNP W E   F   E     + +T  D+    +D+ IG+  + L 
Sbjct: 499 LGHQKYKSK-IMPKTLNPQWREQFDFHLYEERGGVIDITAWDKDAGKRDDFIGRCQVDLS 557

Query: 525 SVEKRADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGG--YHVLDESTH 582
           ++ +       H     LE+                   L L V L       + D S +
Sbjct: 558 ALSREQ----THKLELQLEEG---------------EGHLVLLVTLTASATVSISDLSVN 598

Query: 583 YSSDLRPTAKQLWKPS----------IGVLELGILNADGLHPMKTRDGRGTADTYCVAKY 632
              D +   + L + S          +G L++ ++ A+GL      D  G +D +CV + 
Sbjct: 599 SLEDQKEREEILKRYSPLRIFHNLKDVGFLQVKVIRAEGLMAA---DVTGKSDPFCVVEL 655

Query: 633 GHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIR 692
            +  + T T+  +L+ ++N+ +T+ + D  +VL V V+D         S D  +GKV I 
Sbjct: 656 NNDRLLTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDR----DRSADF-LGKVAIP 710

Query: 693 ISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPK-MHYV 751
           + +++ G     +Y L     +G  K G ++L I   + +    +    R L+PK   Y+
Sbjct: 711 LLSIQNGE--QKAYVLKNKQLTGPTK-GVIYLEIDVIFNAVKASL----RTLIPKEQKYI 763

Query: 752 RPLT-MAQQDMLRHQAVNIVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLM 810
                +++Q +LR                                         NF R+ 
Sbjct: 764 EEENRLSKQLLLR-----------------------------------------NFIRMK 782

Query: 811 SVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRY 870
                L  A  +      W +P  ++   +LF+ +V+  EL +  + L + ++  WNY +
Sbjct: 783 RCVMVLVNAAYYVNSCFDWDSPPRSLAAFVLFLFVVWNFELYM--IPLVLLLLLTWNY-F 839

Query: 871 RPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDV 930
                     R +  + +  DE +E+      +     +   Y  ++ V   +Q ++ +V
Sbjct: 840 LIISGKDNRQRDTVVEDMLEDEEEEDDKDDKDSEKKGFINKIY-AIQEVCVSVQNILDEV 898

Query: 931 ATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAG 976
           A+ GERI+   +W  P  + + ++   V   +LY  P + + L+ G
Sbjct: 899 ASFGERIKNTFNWTVPFLSWLAIVALCVFTAILYCIPLRYIVLVWG 944





Homo sapiens (taxid: 9606)
>sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 Back     alignment and function description
>sp|O43581|SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens GN=SYT7 PE=1 SV=3 Back     alignment and function description
>sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 Back     alignment and function description
>sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 Back     alignment and function description
>sp|Q9R0N7|SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus GN=Syt7 PE=1 SV=1 Back     alignment and function description
>sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 Back     alignment and function description
>sp|C9J798|RAS4B_HUMAN Putative Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=5 SV=2 Back     alignment and function description
>sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1008
2555415481017 synaptotagmin, putative [Ricinus communi 1.0 0.991 0.832 0.0
359474216988 PREDICTED: uncharacterized protein LOC10 0.978 0.997 0.771 0.0
2254541641018 PREDICTED: multiple C2 and transmembrane 0.998 0.988 0.769 0.0
1478653831020 hypothetical protein VITISV_018822 [Viti 0.998 0.986 0.766 0.0
3565397281006 PREDICTED: uncharacterized protein LOC10 0.993 0.995 0.752 0.0
3574816331007 Glutathione peroxidase [Medicago truncat 0.992 0.993 0.748 0.0
2240718441009 predicted protein [Populus trichocarpa] 0.992 0.991 0.762 0.0
255537443980 synaptotagmin, putative [Ricinus communi 0.967 0.994 0.746 0.0
3265311721016 predicted protein [Hordeum vulgare subsp 0.990 0.982 0.718 0.0
3571667921009 PREDICTED: uncharacterized protein LOC10 0.987 0.986 0.718 0.0
>gi|255541548|ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis] gi|223549018|gb|EEF50507.1| synaptotagmin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1788 bits (4631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 847/1017 (83%), Positives = 930/1017 (91%), Gaps = 9/1017 (0%)

Query: 1    MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNIS 60
            M++L+LGVEVV A++LMPKDGQGS++AFVE+HFD QKFRTTTKEKDL PVWNESFYFNIS
Sbjct: 1    MNNLRLGVEVVGAHDLMPKDGQGSASAFVEIHFDHQKFRTTTKEKDLNPVWNESFYFNIS 60

Query: 61   DPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVK 120
            DP+NLSNL L+AYVYNH +   +KS LGKVRLTGTSFVPYSDAVVLHYPLEKR +FSRVK
Sbjct: 61   DPNNLSNLTLEAYVYNHGKENTTKSCLGKVRLTGTSFVPYSDAVVLHYPLEKRGLFSRVK 120

Query: 121  GELGLKVFVTDDPSIRSSNPLPAMESFGHSDLRSTKSQAPEQ-VPSSAPDPFSDDKARRR 179
            GELGLKVFVTD+PSIRSSNPLPAM S   SD  ST+ Q PEQ +PSS P  FS+DK   R
Sbjct: 121  GELGLKVFVTDNPSIRSSNPLPAMNSSLFSDSHSTQGQQPEQQIPSSVPKVFSNDKTESR 180

Query: 180  HTFHHLPNANISQQQQ--------HSSPSAAQPSMNYGAYEMKSEPQASKIVHTYSGLSS 231
            HTFHHLPN +  Q Q         H   +AA  +M+YGA EM+SEPQA + V  +S  SS
Sbjct: 181  HTFHHLPNTSQPQSQPQPQPQMQQHVPVAAAMQTMSYGAQEMRSEPQAPRAVRMFSDSSS 240

Query: 232  QPTDYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTG 291
            QP DYALKETSPFLGGGQ++GGRV+R D  ASTYDLVEQM+YLFVRVVKAR+LPSKDVTG
Sbjct: 241  QPADYALKETSPFLGGGQIVGGRVIRRDRIASTYDLVEQMKYLFVRVVKARELPSKDVTG 300

Query: 292  SLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVG 351
            SLDP+VEV+VGNYKGITK++EKKQNPEWNEVFAF+R+R+QSSVLEV VKDKD+VKDD+VG
Sbjct: 301  SLDPYVEVRVGNYKGITKHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLVKDDFVG 360

Query: 352  LVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSDA 411
            +VRFD+NE+PTRVPPDSPLA EWYRLED+KG K KGELMLAVWYGTQADEAFPDAWHSDA
Sbjct: 361  IVRFDMNEIPTRVPPDSPLAPEWYRLEDKKGNKDKGELMLAVWYGTQADEAFPDAWHSDA 420

Query: 412  VTPTDSPSNVSTHIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQVLK 471
            VTPTDS S +S HIRSKVYHSPRLWYVRVNV+EAQDL++ DKNRFPD YVKVQIGNQ+LK
Sbjct: 421  VTPTDSSSAISAHIRSKVYHSPRLWYVRVNVIEAQDLIVPDKNRFPDTYVKVQIGNQILK 480

Query: 472  TKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEKRAD 531
            TK VQ+RT+NP+WNED+MFVA+EPFEDHL+L+VEDRVGPNKDE+IGKVVIPL+SVEKRAD
Sbjct: 481  TKMVQTRTMNPIWNEDLMFVAAEPFEDHLVLSVEDRVGPNKDESIGKVVIPLNSVEKRAD 540

Query: 532  DRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTA 591
            DRI+ +RWFNLEKS+SAA+D   AKKDKFSSRLHLRV LDGGYHVLDESTHYSSDLRPTA
Sbjct: 541  DRIIRSRWFNLEKSISAAMDEHQAKKDKFSSRLHLRVVLDGGYHVLDESTHYSSDLRPTA 600

Query: 592  KQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYN 651
            KQLWKPSIGVLELGILNADGLHPMKTRDG+GT+DTYCVAKYGHKWVRTRTIINSLS KYN
Sbjct: 601  KQLWKPSIGVLELGILNADGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTIINSLSPKYN 660

Query: 652  EQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVL 711
            EQYTWEVYDPATVLT+GVFDNSHIGGS+G++D+KIGKVRIRISTLETGRVYTHSYPLLVL
Sbjct: 661  EQYTWEVYDPATVLTIGVFDNSHIGGSNGNRDIKIGKVRIRISTLETGRVYTHSYPLLVL 720

Query: 712  HPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVA 771
            H SGVKKMGELH+AIRFSYTS ANMMFLY+RPLLPKMHY RPLT+ QQD+LRHQAVNIVA
Sbjct: 721  HSSGVKKMGELHMAIRFSYTSMANMMFLYTRPLLPKMHYTRPLTVMQQDLLRHQAVNIVA 780

Query: 772  ARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRN 831
            ARLSRAEPPLRKEVVEYMSD DSHLWSMRRSKANFFRLMSVFSGLF+ GKWFGEVCMW+N
Sbjct: 781  ARLSRAEPPLRKEVVEYMSDADSHLWSMRRSKANFFRLMSVFSGLFSVGKWFGEVCMWKN 840

Query: 832  PITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPD 891
            PITTVLVH+LFVMLV FPELILPTVFLYMF+IG WNYR+RPRYPPHMNTRIS ADAVHPD
Sbjct: 841  PITTVLVHLLFVMLVCFPELILPTVFLYMFLIGFWNYRFRPRYPPHMNTRISCADAVHPD 900

Query: 892  ELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAI 951
            ELDEEFDTFPTTRSP+IVRMRYDRLRSVAGRIQTVVGDVATQGER+Q+LLSWRDPRA  I
Sbjct: 901  ELDEEFDTFPTTRSPEIVRMRYDRLRSVAGRIQTVVGDVATQGERVQSLLSWRDPRATTI 960

Query: 952  FVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML 1008
            F+ FC VAAVVLY TPFQ+LAL+AG Y MRHPRFRH+TPS PINFFRRLPARTDSML
Sbjct: 961  FLTFCFVAAVVLYATPFQVLALVAGFYSMRHPRFRHRTPSIPINFFRRLPARTDSML 1017




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359474216|ref|XP_002272722.2| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454164|ref|XP_002271590.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865383|emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356539728|ref|XP_003538346.1| PREDICTED: uncharacterized protein LOC100777951 [Glycine max] Back     alignment and taxonomy information
>gi|357481633|ref|XP_003611102.1| Glutathione peroxidase [Medicago truncatula] gi|355512437|gb|AES94060.1| Glutathione peroxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224071844|ref|XP_002303582.1| predicted protein [Populus trichocarpa] gi|222841014|gb|EEE78561.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537443|ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis] gi|223549687|gb|EEF51175.1| synaptotagmin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|326531172|dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357166792|ref|XP_003580853.1| PREDICTED: uncharacterized protein LOC100833034 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1008
TAIR|locus:21397271011 AT4G11610 "AT4G11610" [Arabido 0.989 0.986 0.668 0.0
TAIR|locus:21271031006 AT4G00700 "AT4G00700" [Arabido 0.987 0.989 0.575 0.0
TAIR|locus:2095853773 AT3G57880 "AT3G57880" [Arabido 0.758 0.989 0.691 1.6e-308
TAIR|locus:2182305769 AT5G12970 "AT5G12970" [Arabido 0.757 0.993 0.680 1.5e-305
TAIR|locus:20094921029 AT1G22610 "AT1G22610" [Arabido 0.765 0.750 0.629 2e-303
TAIR|locus:2017627776 AT1G51570 [Arabidopsis thalian 0.759 0.987 0.676 3.2e-303
TAIR|locus:21627121036 AT5G48060 "AT5G48060" [Arabido 0.736 0.716 0.636 1.5e-296
TAIR|locus:20202801012 AT1G04150 "AT1G04150" [Arabido 0.968 0.964 0.509 1.5e-271
TAIR|locus:2098846972 AT3G61300 "AT3G61300" [Arabido 0.721 0.747 0.621 2.4e-259
TAIR|locus:20190701081 QKY "AT1G74720" [Arabidopsis t 0.721 0.672 0.513 1.2e-236
TAIR|locus:2139727 AT4G11610 "AT4G11610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3670 (1297.0 bits), Expect = 0., P = 0.
 Identities = 682/1020 (66%), Positives = 827/1020 (81%)

Query:     1 MSHLKLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNIS 60
             MS+LKLGV+V+ A+ L PKDGQG+SNA+VEL+FDGQK RTT K++DL PVWNESF+FNIS
Sbjct:     3 MSNLKLGVDVIGAHNLFPKDGQGTSNAYVELYFDGQKHRTTIKDRDLNPVWNESFFFNIS 62

Query:    61 DPHNLSNLALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVK 120
             DP  L  L L+A  Y+HNR+TN +SFLGKV L+GTSFVP+SDAVVLH+P+E+R IFSRV+
Sbjct:    63 DPSRLHYLNLEAQAYSHNRSTNGRSFLGKVSLSGTSFVPHSDAVVLHFPMERRGIFSRVR 122

Query:   121 GELGLKVFVTDDPSIRSS--------NPLPAMESFGHSDLRSTKSQAPEQVPSSAPDPFS 172
             GELGLKV++TD+ S++SS        N  PA+    + + RS K      +P+SA +   
Sbjct:   123 GELGLKVYITDEASLKSSAASNDHPDNLDPALPRAMNVEHRSDKRHVFYNLPNSAQE--- 179

Query:   173 DDKARRRHTFHHLPN--ANIXXXXXXXXXXXXXXXMNYGAYEMKSEP-QASKIVHTYSGL 229
                   +H     PN  +++                 +   EM+SEP + SK+VH +S  
Sbjct:   180 -----HQHQHPQGPNQSSSLAAEQDNHNEHHHHYVPKHQVDEMRSEPARPSKLVHAHSIA 234

Query:   230 SSQPTDYALKETSPFLXXXXXXXXXXXXXDLRA-STYDLVEQMRYLFVRVVKARDLPSKD 288
             S+QP D+ALKETSP L             D  A STYDLVE+M +L+VRVVKAR+LP  D
Sbjct:   235 SAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKARELPIMD 294

Query:   289 VTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAXXXXXXXXXX 348
             +TGS+DPFVEV+VGNYKGIT+++EK+Q+PEWN+VFAF++ER+Q+SVLEV           
Sbjct:   295 ITGSVDPFVEVRVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASVLEVVVKDKDLLKDD 354

Query:   349 YVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWH 408
             YVG VRFD+N+VP RVPPDSPLA +WYRLED+KGEK KGELMLAVW GTQADEAF DAWH
Sbjct:   355 YVGFVRFDINDVPLRVPPDSPLAPQWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWH 414

Query:   409 SDAVTPTDSPSNVSTHIRSKVYHSPRLWYVRVNVMEAQDLVISDKNRFPDAYVKVQIGNQ 468
             SDA  P D    +S  +RSKVYH+PRLWYVRVNV+EAQDL+ +DK RFPD YVK Q+GNQ
Sbjct:   415 SDAAMPVDCSPAISAVLRSKVYHAPRLWYVRVNVIEAQDLIPTDKTRFPDVYVKAQLGNQ 474

Query:   469 VLKTKSVQSRTLNPVWNEDMMFVASEPFEDHLILTVEDRVGPNKDETIGKVVIPLHSVEK 528
             V+KT+  Q+RTL  VWNED +FV +EPFEDHL+LTVEDRV P KDE +G+  IPL++VEK
Sbjct:   475 VMKTRPCQARTLGAVWNEDFLFVVAEPFEDHLVLTVEDRVAPGKDEIVGRTYIPLNTVEK 534

Query:   529 RADDRIVHTRWFNLEKSVSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLR 588
             RADD ++H RW+NLE+ V   +D D  K++KFS R+HLRVCL+GGYHVLDESTHYSSDLR
Sbjct:   535 RADDHMIHARWYNLERPV--IVDVDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLR 592

Query:   589 PTAKQLWKPSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSA 648
             P+A+ LW+  IGVLELGILNA GLHPMKTR+GRGT+DT+CV KYG KWVRTRT++++L  
Sbjct:   593 PSARPLWRQPIGVLELGILNAVGLHPMKTREGRGTSDTFCVGKYGQKWVRTRTMVDNLCP 652

Query:   649 KYNEQYTWEVYDPATVLTVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPL 708
             KYNEQYTWEV+DPATVLTVGVFDN  +G   G++DVKIGK+RIR+STLETGR+YTHSYPL
Sbjct:   653 KYNEQYTWEVFDPATVLTVGVFDNGQLG-EKGNRDVKIGKIRIRLSTLETGRIYTHSYPL 711

Query:   709 LVLHPSGVKKMGELHLAIRFSYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVN 768
             LVLHP+GVKKMGELH+A+RF+  SFANM++ YS+PLLPKMHYVRP ++ QQDMLRHQAVN
Sbjct:   712 LVLHPTGVKKMGELHMAVRFTCISFANMLYQYSKPLLPKMHYVRPFSVMQQDMLRHQAVN 771

Query:   769 IVAARLSRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCM 828
             IVAARL RAEPPLRKE++E+MSD DSHLWSMR+SKANFFR+M+VFSG+ A GKWF ++C 
Sbjct:   772 IVAARLGRAEPPLRKEIIEFMSDTDSHLWSMRKSKANFFRMMTVFSGVIAVGKWFSDICS 831

Query:   829 WRNPITTVLVHILFVMLVYFPELILPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAV 888
             WRNPITTVLVH+LF+MLV  PELILPT+FLYMF+IGLWNYR+RPRYPPHMNT+IS A+AV
Sbjct:   832 WRNPITTVLVHVLFLMLVCLPELILPTMFLYMFLIGLWNYRFRPRYPPHMNTKISQAEAV 891

Query:   889 HPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRA 948
             HPDELDEEFDTFPTTR+PD+VR+RYDRLRSVAGRIQTV+GD+ATQGER QALLSWRDPRA
Sbjct:   892 HPDELDEEFDTFPTTRNPDMVRLRYDRLRSVAGRIQTVIGDLATQGERFQALLSWRDPRA 951

Query:   949 AAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML 1008
              AIFVI C +AA+V ++TP Q++  LAG + MRHPRFRH+ PS P+NFFRRLPARTDSML
Sbjct:   952 TAIFVILCFIAAIVFFITPIQIVVALAGFFTMRHPRFRHRLPSVPVNFFRRLPARTDSML 1011




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2127103 AT4G00700 "AT4G00700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095853 AT3G57880 "AT3G57880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182305 AT5G12970 "AT5G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009492 AT1G22610 "AT1G22610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017627 AT1G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162712 AT5G48060 "AT5G48060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020280 AT1G04150 "AT1G04150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098846 AT3G61300 "AT3G61300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019070 QKY "AT1G74720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00000407001
SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (1002 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1008
pfam08372156 pfam08372, PRT_C, Plant phosphoribosyltransferase 1e-110
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-86
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 2e-66
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 1e-61
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 2e-60
pfam0016885 pfam00168, C2, C2 domain 4e-23
cd00030102 cd00030, C2, C2 domain 6e-23
cd00030102 cd00030, C2, C2 domain 3e-21
smart00239101 smart00239, C2, Protein kinase C conserved region 3e-21
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-20
pfam0016885 pfam00168, C2, C2 domain 3e-19
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 4e-18
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-18
cd00030102 cd00030, C2, C2 domain 1e-17
pfam0016885 pfam00168, C2, C2 domain 4e-17
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 4e-15
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-14
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 5e-14
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 8e-14
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 6e-13
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 8e-13
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 1e-12
cd00030102 cd00030, C2, C2 domain 1e-12
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 1e-12
pfam0016885 pfam00168, C2, C2 domain 2e-12
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 3e-12
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 3e-12
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-12
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 4e-12
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 5e-12
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 7e-12
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 1e-11
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 1e-11
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 2e-11
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 3e-11
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 4e-11
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 4e-11
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 9e-11
smart00239101 smart00239, C2, Protein kinase C conserved region 1e-10
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 2e-10
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-10
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 3e-10
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 4e-10
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 9e-10
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 9e-10
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 1e-09
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 1e-09
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 1e-09
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 2e-09
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-09
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 3e-09
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-09
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 5e-09
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 5e-09
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 8e-09
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 8e-09
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 1e-08
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 2e-08
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 2e-08
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 2e-08
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 3e-08
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 4e-08
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 5e-08
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 6e-08
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 6e-08
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 8e-08
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 9e-08
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 9e-08
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 9e-08
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 9e-08
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 9e-08
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 1e-07
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 2e-07
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 2e-07
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 2e-07
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 2e-07
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 2e-07
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 3e-07
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 3e-07
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 4e-07
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 4e-07
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 5e-07
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 7e-07
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-06
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 1e-06
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 1e-06
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 1e-06
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-06
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 1e-06
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 2e-06
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 2e-06
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-06
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 2e-06
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 2e-06
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 2e-06
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-06
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-06
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-06
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 3e-06
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 3e-06
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 3e-06
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 3e-06
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 4e-06
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 4e-06
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-06
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 4e-06
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 5e-06
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 6e-06
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 6e-06
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 7e-06
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 7e-06
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 8e-06
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 1e-05
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 1e-05
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 1e-05
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 1e-05
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 2e-05
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 2e-05
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 2e-05
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 2e-05
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 2e-05
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 2e-05
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-05
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 3e-05
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 4e-05
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 5e-05
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 5e-05
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 6e-05
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 6e-05
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 6e-05
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 7e-05
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 7e-05
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 8e-05
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 8e-05
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 8e-05
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 1e-04
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 1e-04
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 1e-04
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 1e-04
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 1e-04
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 1e-04
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 1e-04
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 2e-04
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-04
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 2e-04
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 2e-04
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 2e-04
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 2e-04
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 2e-04
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 3e-04
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 3e-04
cd08394127 cd08394, C2A_Munc13, C2 domain first repeat in Mun 3e-04
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 3e-04
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-04
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 4e-04
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 4e-04
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 4e-04
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 4e-04
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 5e-04
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 5e-04
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 5e-04
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 5e-04
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 6e-04
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 8e-04
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 8e-04
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 8e-04
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 0.001
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 0.001
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 0.001
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 0.001
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 0.001
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 0.001
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 0.001
pfam06398 360 pfam06398, Pex24p, Integral peroxisomal membrane p 0.001
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 0.001
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 0.002
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 0.002
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 0.002
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 0.002
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 0.002
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 0.002
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 0.003
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.003
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 0.003
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 0.003
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 0.003
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 0.004
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 0.004
cd08407138 cd08407, C2B_Synaptotagmin-13, C2 domain second re 0.004
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 0.004
>gnl|CDD|192017 pfam08372, PRT_C, Plant phosphoribosyltransferase C-terminal Back     alignment and domain information
 Score =  336 bits (865), Expect = e-110
 Identities = 126/156 (80%), Positives = 147/156 (94%)

Query: 853  LPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMR 912
            LPT+FLY+F+IGLWNYR+RPR+PPHM+TR+S+ADA HPDELDEEFDTFPT+R PD+VRMR
Sbjct: 1    LPTIFLYLFVIGLWNYRFRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPPDVVRMR 60

Query: 913  YDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLA 972
            YDRLRSVAGR+QTVVGD+ATQGER+QALLSWRDPRA AIFV+FCLVAAVVLYV PF+++A
Sbjct: 61   YDRLRSVAGRVQTVVGDIATQGERLQALLSWRDPRATAIFVLFCLVAAVVLYVVPFKVVA 120

Query: 973  LLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML 1008
            LLAG Y +RHPRFR + PS P+NFFRRLP+RTDSML
Sbjct: 121  LLAGFYYLRHPRFRSRMPSVPLNFFRRLPSRTDSML 156


This domain is found at the C-terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (pfam00168). Length = 156

>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|219008 pfam06398, Pex24p, Integral peroxisomal membrane peroxin Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1008
PF08372156 PRT_C: Plant phosphoribosyltransferase C-terminal; 100.0
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.95
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.95
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.94
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.93
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 99.88
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.88
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.87
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.86
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.86
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.85
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.84
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.84
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.82
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.8
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.8
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.8
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.8
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.8
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.8
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.8
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.8
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.8
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.79
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.79
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.79
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.78
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.78
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.78
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.78
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.78
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.77
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.77
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.77
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.77
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.76
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.76
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.76
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.76
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.76
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.75
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.75
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.75
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.75
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.75
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.75
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.75
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.75
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.75
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.75
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.74
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.74
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.74
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.74
PF04842683 DUF639: Plant protein of unknown function (DUF639) 99.74
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.74
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.74
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.74
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.73
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.73
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.73
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.73
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.73
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.73
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.72
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.72
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.72
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.72
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.71
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.71
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.71
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.71
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.71
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.71
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.71
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.71
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.71
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.7
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.7
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.7
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.7
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.7
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.7
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.7
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.7
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.69
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.69
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.69
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.69
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.69
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.69
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.69
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.68
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.68
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.68
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.68
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.68
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.67
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.67
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.67
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.67
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.67
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.67
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.67
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.67
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.67
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.66
KOG10111283 consensus Neurotransmitter release regulator, UNC- 99.66
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.66
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.66
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.66
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.66
PF11696 642 DUF3292: Protein of unknown function (DUF3292); In 99.65
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.65
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.65
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.65
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.65
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.65
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.65
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.64
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.64
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.64
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.64
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.64
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.64
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.64
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.64
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.64
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.63
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.63
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.63
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.63
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.63
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.62
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.62
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.61
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.61
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.61
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.61
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.61
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.6
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.6
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.6
PLN03008 868 Phospholipase D delta 99.6
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.6
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.6
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.59
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.59
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.59
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.59
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.59
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.59
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.59
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.59
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.59
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.58
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.58
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.57
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.57
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.57
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.57
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.57
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.56
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.56
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.56
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.56
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.55
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.55
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.55
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.55
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.55
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.55
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.55
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.54
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.54
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.54
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.54
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.54
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.54
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.53
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.53
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.53
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.53
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.53
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.53
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.52
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.52
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.51
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.5
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.5
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.5
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.48
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.48
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.46
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.46
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.45
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.44
PLN03008868 Phospholipase D delta 99.44
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.43
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.4
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 99.36
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.35
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.35
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.29
PF06398 359 Pex24p: Integral peroxisomal membrane peroxin; Int 99.29
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.25
PLN02270 808 phospholipase D alpha 99.23
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.21
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.15
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.1
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.07
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.02
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.02
PLN02223537 phosphoinositide phospholipase C 99.0
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.98
PLN02223537 phosphoinositide phospholipase C 98.96
PLN02952599 phosphoinositide phospholipase C 98.94
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.89
PLN02270808 phospholipase D alpha 98.89
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.87
PLN02230598 phosphoinositide phospholipase C 4 98.87
PLN02952599 phosphoinositide phospholipase C 98.86
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.85
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.81
PLN02228567 Phosphoinositide phospholipase C 98.81
PLN02222581 phosphoinositide phospholipase C 2 98.8
PLN02230598 phosphoinositide phospholipase C 4 98.8
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.77
PLN02222581 phosphoinositide phospholipase C 2 98.71
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.69
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.68
PLN02228567 Phosphoinositide phospholipase C 98.67
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.65
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.61
PLN02352 758 phospholipase D epsilon 98.51
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.47
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.4
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.22
PLN02352758 phospholipase D epsilon 98.2
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.15
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.0
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.97
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.93
KOG3837523 consensus Uncharacterized conserved protein, conta 97.83
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.64
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.57
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.42
PLN02964644 phosphatidylserine decarboxylase 97.31
PLN02964 644 phosphatidylserine decarboxylase 97.27
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 96.8
KOG3837523 consensus Uncharacterized conserved protein, conta 96.77
PF15627156 CEP76-C2: CEP76 C2 domain 95.95
KOG12651189 consensus Phospholipase C [Lipid transport and met 95.8
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.78
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.31
PF15627156 CEP76-C2: CEP76 C2 domain 95.3
PF08372156 PRT_C: Plant phosphoribosyltransferase C-terminal; 95.22
KOG1452442 consensus Predicted Rho GTPase-activating protein 95.02
KOG12651189 consensus Phospholipase C [Lipid transport and met 94.96
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 94.64
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.58
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 94.37
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 94.14
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 94.01
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 93.93
PF02453169 Reticulon: Reticulon; InterPro: IPR003388 Eukaryot 93.91
cd08397159 C2_PI3K_class_III C2 domain present in class III p 93.51
cd08397159 C2_PI3K_class_III C2 domain present in class III p 93.2
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.69
KOG1452442 consensus Predicted Rho GTPase-activating protein 92.19
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.12
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 92.02
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 91.61
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 88.8
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 88.59
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 85.52
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 85.49
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 85.38
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 85.37
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 85.01
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 84.98
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 82.1
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 81.98
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 81.9
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 81.18
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 80.91
>PF08372 PRT_C: Plant phosphoribosyltransferase C-terminal; InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins Back     alignment and domain information
Probab=100.00  E-value=7.3e-40  Score=305.11  Aligned_cols=156  Identities=75%  Similarity=1.349  Sum_probs=152.9

Q ss_pred             HHHHHHHHHHHHhhccccCCCCCCCCCCcccccccCCCCCCCCCCCCCCCCCChhHHHHHHHHHHHHHhhHHHHHHHHHH
Q 001830          853 LPTVFLYMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRSVAGRIQTVVGDVAT  932 (1008)
Q Consensus       853 lp~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~l~~~~~~vq~~l~~~a~  932 (1008)
                      +|.++++++++++|+|+++|+.|+|+|.++|+++..++||+|||+|+.|++++.+.++|||++||+++++|||.||++|+
T Consensus         1 lp~~~l~~~~~~~w~yr~rpr~p~~~d~~ls~~~~~~~deldEEfD~~ps~~~~~~lr~Rydrlr~va~rvQ~vlgd~At   80 (156)
T PF08372_consen    1 LPTVFLYLFLIGLWNYRFRPRHPPHMDTKLSHADSAHPDELDEEFDTFPSSRPPDSLRMRYDRLRSVAGRVQNVLGDVAT   80 (156)
T ss_pred             CchHHHHHHHHHHhccccCCCCCCCCCccccccccCCcchhhhhhcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccccCChhhHHHHHHHHHHHHHHHHHhhHHHHHHhhhhhhhcCCCCCCCCCCchhhhhhcCCCCcCCCC
Q 001830          933 QGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML 1008 (1008)
Q Consensus       933 ~~e~~~~l~~w~~p~~t~~~~~~~~~~~~~~~~iP~r~i~l~~g~~~~~~P~~~~~~~~~~~~~~~r~ps~~~~~~ 1008 (1008)
                      ++||++|+++|+||.+|.+++++|+++++++|++|+|+++++||+|++|||+||.++|+.+.|||+||||++|.||
T Consensus        81 ~gERl~allsWrdP~aT~lf~~~clv~avvly~vP~r~l~l~~gly~~r~P~~R~~~P~~~~nff~RlPs~~d~~l  156 (156)
T PF08372_consen   81 QGERLQALLSWRDPRATALFVVFCLVAAVVLYFVPFRVLVLIWGLYKLRHPRFRNPLPSPPLNFFRRLPSRSDSML  156 (156)
T ss_pred             HHHHHHHhhccCCccHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhcCccccCCCCcHHHHHHHHCCCchhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999987



It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (IPR000008 from INTERPRO).

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>PF04842 DUF639: Plant protein of unknown function (DUF639); InterPro: IPR006927 The sequences in this family are plant proteins of unknown function Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>PF11696 DUF3292: Protein of unknown function (DUF3292); InterPro: IPR021709 This eukaryotic family of proteins has no known function Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>PF06398 Pex24p: Integral peroxisomal membrane peroxin; InterPro: IPR010482 Peroxisomes play diverse roles in the cell, compartmentalising many activities related to lipid metabolism and functioning in the decomposition of toxic hydrogen peroxide Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF08372 PRT_C: Plant phosphoribosyltransferase C-terminal; InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF02453 Reticulon: Reticulon; InterPro: IPR003388 Eukaryotic proteins of the reticulon (RTN) family all share an association with the endoplasmic reticulum (ER) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1008
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 5e-10
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 7e-06
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 6e-10
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 6e-06
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 2e-07
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 7e-07
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 1e-06
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 5e-06
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 2e-05
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 2e-05
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 4e-05
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 2e-04
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 2e-04
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 88/326 (26%), Positives = 129/326 (39%), Gaps = 77/326 (23%) Query: 271 MRYLF------VRVVKARDLPSKDVTGSLDPFVEVKV---GNYKGITKYYEKKQNPEWNE 321 +RYL+ VR+++A DLP+KD G DP+V++ + K TK + K NP +NE Sbjct: 14 LRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNE 73 Query: 322 VFAFS---RERIQSSVLEVAXXXXXXXXXXYVGLVRFDLNEVPTRVPPDSPLAAEWYRLE 378 F FS E Q + +G V D PPD PL W + Sbjct: 74 TFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPL---WRDIL 130 Query: 379 DRKGEKKK-GELMLAVWYGTQADEAFPDAWHSDAVTPTDSPSNVSTHIRSKVYHSPRLWY 437 + EK GEL ++ Y P Sbjct: 131 EGGSEKADLGELNFSLCY------------------------------------LPTAGL 154 Query: 438 VRVNVMEAQDLVISDKNRFPDAYVKVQI---GNQVLKTK-SVQSRTLNPVWNEDMMF-VA 492 + V +++A +L D F D YVK + G ++ K K S++ TLNP +NE ++F VA Sbjct: 155 LTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVA 214 Query: 493 SEPFED-HLILTVED-------------RVGPNKDETIGKVVIPLHSVEKRADDRIVHTR 538 E E+ L + V D RVGP + G+ H E A+ R Sbjct: 215 PESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGRE----HWAEMLANPRKPVEH 270 Query: 539 WFNL--EKSVSAALDGDNAKKDKFSS 562 W L EK++S+ G +K +S Sbjct: 271 WHQLVEEKTLSSFTKGGKGLSEKENS 296
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1008
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-44
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-25
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-24
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 3e-18
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-38
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 5e-22
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 4e-15
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 4e-13
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-37
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 7e-21
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-16
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-14
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-13
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 8e-37
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 1e-21
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-17
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 6e-12
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 6e-36
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 5e-22
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 5e-17
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-16
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-34
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-20
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-14
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 4e-13
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-34
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-15
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-08
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-33
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 7e-33
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 4e-26
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-18
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 1e-31
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 3e-13
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 5e-07
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 5e-29
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 4e-20
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-18
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 2e-14
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-26
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 9e-24
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-17
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-14
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-24
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 5e-14
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-08
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 5e-05
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-23
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 2e-19
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 4e-15
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 1e-12
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 4e-23
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 3e-22
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-17
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-12
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-22
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 5e-21
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-14
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-13
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 6e-21
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 9e-18
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-14
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 8e-07
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 7e-21
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 6e-15
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 5e-14
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-04
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-20
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 1e-17
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-15
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 3e-20
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 3e-17
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 1e-13
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 5e-08
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 8e-20
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-17
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 7e-15
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 9e-20
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-19
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-18
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 9e-10
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 4e-19
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 8e-16
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-15
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 9e-07
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 6e-19
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-15
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-15
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-06
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 6e-19
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 5e-16
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 1e-15
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 4e-06
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 8e-18
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 4e-16
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-14
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 7e-06
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 1e-17
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 3e-16
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 4e-14
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 1e-17
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-16
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 5e-15
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 3e-17
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-13
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 7e-13
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-04
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 5e-17
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 5e-15
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-14
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 7e-17
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-13
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 2e-13
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 6e-04
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 7e-17
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 1e-13
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 3e-13
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 7e-17
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 4e-16
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-14
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 1e-16
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 5e-14
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-13
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-16
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-15
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 6e-14
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 5e-16
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 2e-13
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 5e-11
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-15
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 2e-12
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 5e-12
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 4e-06
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 1e-15
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 3e-14
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 1e-12
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 4e-04
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 6e-15
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 5e-13
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-10
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 1e-06
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-11
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-10
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 9e-09
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 1e-05
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 2e-04
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 2e-04
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 5e-08
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 2e-06
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 2e-04
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 7e-07
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 6e-06
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 8e-06
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-04
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
 Score =  154 bits (392), Expect = 5e-44
 Identities = 44/134 (32%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 262 ASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNE 321
           + +   V+ +  L V+V+KA DL + D +G  DPF  +++GN +  T    K  NPEWN+
Sbjct: 3   SGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNK 62

Query: 322 VFAFSRERIQSSVLEVAVKDKDVV-KDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDR 380
           VF F  + I   VLEV V D+D     D++G V   L  +    P         Y L+++
Sbjct: 63  VFTFPIKDIH-DVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQP-------NCYVLKNK 114

Query: 381 KGE-KKKGELMLAV 393
             E   KG + L +
Sbjct: 115 DLEQAFKGVIYLEM 128


>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1008
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 8e-21
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 6e-17
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 5e-07
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 3e-06
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 1e-20
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 9e-12
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 2e-10
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-19
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-13
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-11
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 1e-06
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-18
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 7e-16
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 9e-15
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 8e-12
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 3e-18
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 7e-14
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 2e-11
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 1e-10
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 7e-18
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-17
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 8e-14
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 3e-17
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 8e-14
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 8e-11
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 6e-06
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 3e-17
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-11
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-11
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-07
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 3e-16
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-12
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 8e-07
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 4e-16
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 7e-13
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-10
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-09
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 4e-15
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 2e-13
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 8e-09
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 2e-08
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 2e-14
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 1e-11
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 6e-10
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 3e-05
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 8e-14
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 1e-10
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 1e-06
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 3e-05
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 1e-13
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 3e-10
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-04
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 2e-13
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 5e-11
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-07
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 7e-13
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 4e-11
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 7e-06
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 7e-13
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-06
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 1e-05
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 5e-05
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-12
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 1e-08
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-08
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 4e-06
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 2e-08
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 6e-07
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 7e-06
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Unc-13 homolog A
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 87.1 bits (215), Expect = 8e-21
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 9/119 (7%)

Query: 271 MRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERI 330
           M  L V V KA+   +++     + +V +KV N K  T    +   P W + F F   R+
Sbjct: 1   MSLLCVGVKKAKFDGAQE---KFNTYVTLKVQNVKSTTIAV-RGSQPSWEQDFMFEINRL 56

Query: 331 QSSVLEVAVKDKDVVKDDYVGLVRFDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKKGEL 389
              +  V V +K ++ D  VG V   L  +      +     EW  L D +      E+
Sbjct: 57  DLGLT-VEVWNKGLIWDTMVGTVWIPLRTIRQ---SNEEGPGEWLTL-DSQAIMADSEI 110


>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1008
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.93
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.91
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.9
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.9
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.88
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.87
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.87
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.87
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.86
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.86
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.86
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.86
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.85
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.85
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.85
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.85
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.85
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.84
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.84
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.84
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.83
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.83
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.83
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.82
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.81
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.8
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.8
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.8
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.79
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.79
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.78
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.78
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.78
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.77
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.72
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.72
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.72
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.71
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.59
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.56
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 95.4
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 94.99
d2yrba1142 Fantom {Human (Homo sapiens) [TaxId: 9606]} 91.45
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=2.9e-25  Score=158.43  Aligned_cols=123  Identities=26%  Similarity=0.460  Sum_probs=94.7

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEECCEEEEEEEECCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCC
Q ss_conf             82139999998622999986689999877099999999999964323889963153789996479955999999699889
Q 001830          597 PSIGVLELGILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVLTVGVFDNSHIG  676 (1008)
Q Consensus       597 ~~~g~L~v~i~~a~~L~~~~~~~~~g~~Dpyv~i~~~~~~~~T~~~~~t~nP~w~e~~~~~v~~~~~~l~i~v~d~~~~~  676 (1008)
                      .++|.|+|+|++|++|++.   |..|++||||++.++++.++|+++++|.||.|||.|.|.+.++.+.|.|+|||++.++
T Consensus         3 ~~~G~L~V~v~~A~~L~~~---d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~~~~~L~i~V~d~~~~~   79 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAA---DFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDK   79 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCS---SSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESCTTCEEEEEEEEEETTE
T ss_pred             CCCEEEEEEEEEEECCCCC---CCCCCCCEEEEEECCCEEEEEEEECCCEEEEEEEEEEEEEECCCCEEEEEEEECCCCC
T ss_conf             8619999999982789887---8899969599997698588777407740578989999998436750089999936984


Q ss_pred             CCCCCCCCEEEEEEEECCCCCCCCEEEEEEEEEECCCCCCCCCCEEEEEEEEEE
Q ss_conf             999999833199999766323898587669536628999843639999999973
Q 001830          677 GSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRFSY  730 (1008)
Q Consensus       677 ~~~~~~~~~lG~~~i~l~~l~~~~~~~~~~~L~~~~~~~~~~~G~i~l~~~~~~  730 (1008)
                           +|++||++.|+|.++..+.  .+||.|......+.. .|+|+++++|.+
T Consensus        80 -----~d~~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~~-~G~i~l~~~~i~  125 (126)
T d2ep6a1          80 -----PPDFLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQAF-KGVIYLEMDLIY  125 (126)
T ss_dssp             -----EEEECCBCEEEGGGCCSSC--CEECCCBCSCTTSCC-SSEEEEEEEEEE
T ss_pred             -----CCCEEEEEEEEHHHCCCCC--CEEEECCCCCCCCCE-EEEEEEEEEEEE
T ss_conf             -----7625899999989988999--649984154899754-299999999997



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure