Citrus Sinensis ID: 001896
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 998 | ||||||
| 359472765 | 1000 | PREDICTED: copper-transporting ATPase RA | 0.996 | 0.995 | 0.809 | 0.0 | |
| 224137820 | 1010 | heavy metal ATPase [Populus trichocarpa] | 0.991 | 0.980 | 0.800 | 0.0 | |
| 297738009 | 952 | unnamed protein product [Vitis vinifera] | 0.953 | 1.0 | 0.832 | 0.0 | |
| 224071055 | 1008 | heavy metal ATPase [Populus trichocarpa] | 0.993 | 0.984 | 0.796 | 0.0 | |
| 356558246 | 996 | PREDICTED: copper-transporting ATPase RA | 0.987 | 0.989 | 0.798 | 0.0 | |
| 307136407 | 1007 | heavy metal ATPase [Cucumis melo subsp. | 0.996 | 0.988 | 0.780 | 0.0 | |
| 449433505 | 1007 | PREDICTED: copper-transporting ATPase RA | 0.996 | 0.988 | 0.777 | 0.0 | |
| 15241582 | 1001 | copper-transporting ATPase RAN1 [Arabido | 0.991 | 0.989 | 0.768 | 0.0 | |
| 14194135 | 1001 | AT5g44790/K23L20_14 [Arabidopsis thalian | 0.991 | 0.989 | 0.768 | 0.0 | |
| 356530268 | 986 | PREDICTED: copper-transporting ATPase RA | 0.987 | 1.0 | 0.787 | 0.0 |
| >gi|359472765|ref|XP_002276004.2| PREDICTED: copper-transporting ATPase RAN1-like [Vitis vinifera] gi|147778109|emb|CAN69730.1| hypothetical protein VITISV_011925 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1616 bits (4184), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 811/1002 (80%), Positives = 891/1002 (88%), Gaps = 7/1002 (0%)
Query: 2 MALSNRDLQLTELNGGG-----SSDGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMT 56
MA S LQLT + GG D D ED LL+ Y + +GMR IQV VTGMT
Sbjct: 1 MAPSFGGLQLTPFSSGGRKTLPDDDAGDLEDVRLLDAYKEDDSGLEEGMRGIQVRVTGMT 60
Query: 57 CAACSNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAE 116
CAACSNSVEGAL + GV +ASVALLQN+ADVVFDP LV +EDIKNAIEDAGF+AEI++E
Sbjct: 61 CAACSNSVEGALRDVNGVLRASVALLQNRADVVFDPKLVGEEDIKNAIEDAGFDAEIMSE 120
Query: 117 SSTSGPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTV 176
S + KP GT++GQ+TIGGMTCA CVNSVEGILR LPGVKRAVVALATSLGEVEYDPT+
Sbjct: 121 PSRT--KPHGTLLGQFTIGGMTCAVCVNSVEGILRKLPGVKRAVVALATSLGEVEYDPTI 178
Query: 177 ISKDDIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFD 236
ISKDDI NAIEDAGFEASFVQSS QDKI+L VTG+ E+DA LEGIL++ +GVRQF FD
Sbjct: 179 ISKDDIVNAIEDAGFEASFVQSSEQDKIILGVTGISNEMDALILEGILTSIRGVRQFLFD 238
Query: 237 KISGELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNMFRLFIS 296
+ GELEVLFDPE +SSRSLVDGI G SN KF++ V NP+ RMTS+D EE+SNMFRLF S
Sbjct: 239 RTLGELEVLFDPEVISSRSLVDGIEGGSNAKFKLHVKNPYTRMTSKDLEESSNMFRLFTS 298
Query: 297 SLFLSIPVFFIRVICPHIPLVYALLLWRCGPFLMGDWLNWALVSVVQFVIGKRFYTAAGR 356
SLFLSIPVF IRV+CPHIPLV +LLL RCGPFLMGDWL WALVS+VQFVIGKRFY AAGR
Sbjct: 299 SLFLSIPVFLIRVVCPHIPLVDSLLLLRCGPFLMGDWLKWALVSLVQFVIGKRFYIAAGR 358
Query: 357 ALRNGSTNMDVLVALGTSAAYFYSVGALLYGVVTGFWSPTYFETSAMLITFVLFGKYLEI 416
ALRNGS NMDVLVALGTSA+YFYSV ALLYG VTGFWSPTYFE SAMLITFVL GKYLE
Sbjct: 359 ALRNGSANMDVLVALGTSASYFYSVCALLYGAVTGFWSPTYFEASAMLITFVLLGKYLES 418
Query: 417 LAKGKTSDAIKKLVELAPATALLVVKDKVGKCIEEREIDALLIQSGDTLKVLPGTKLPAD 476
LAKGKTSDAIKKLVELAPATALL+VKDK G+ IEE+EIDA+LIQ GD LKVLPGTK+PAD
Sbjct: 419 LAKGKTSDAIKKLVELAPATALLLVKDKGGRFIEEQEIDAMLIQPGDVLKVLPGTKVPAD 478
Query: 477 GIVVWGTSYVNESMVTGEAVPVLKEINSPVIGGTINLHGVLHIQATKVGSDAVLSQIISL 536
GIV+WG+SYVNESMVTGE+ PV KE+NSPVIGGT+NL+G LHIQATKVGS+AVLSQIISL
Sbjct: 479 GIVMWGSSYVNESMVTGESAPVSKEVNSPVIGGTMNLYGALHIQATKVGSNAVLSQIISL 538
Query: 537 VETAQMSKAPIQKFADFVASIFVPIVVTLALFTWLCWYVAGVLGAYPEQWLPENGTHFVF 596
VETAQMSKAPIQKFADFVASIFVP VV ++L T L WYV+G LGAYP+QWLPENG +FVF
Sbjct: 539 VETAQMSKAPIQKFADFVASIFVPTVVAMSLLTLLGWYVSGTLGAYPKQWLPENGNYFVF 598
Query: 597 ALMFSISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQKIKYVIFDKTG 656
ALMF+ISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQK+KYV+FDKTG
Sbjct: 599 ALMFAISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQKVKYVVFDKTG 658
Query: 657 TLTQGRATVTTAKVFTKMDRGEFLTLVASAEASSEHPLAKAVVEYARHFHFFDDPSLNPD 716
TLTQG+ATVTTAKVFT MD GEFLTLVASAEASSEHPLA A+VEYARHFHFF++PS D
Sbjct: 659 TLTQGKATVTTAKVFTGMDHGEFLTLVASAEASSEHPLAVAIVEYARHFHFFEEPSTTKD 718
Query: 717 GQSHSKESTGSGWLLDVSDFSALPGRGIQCFISGKQVLVGNRKLLNESGITIPDHVESFV 776
Q HS+E+ SGWLLDVS+FSALPGRG+QCFI GK+VLVGNRKLL ESG+TIP VE+F+
Sbjct: 719 AQDHSRETRFSGWLLDVSEFSALPGRGVQCFIKGKRVLVGNRKLLTESGVTIPTDVENFL 778
Query: 777 VELEESARTGILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTAHA 836
V LEESA+TG+LVAYDD +GV+G+ADP+KREAAVVVEGLLKMGV PVMVTGDNWRTA A
Sbjct: 779 VNLEESAKTGVLVAYDDTAVGVLGVADPLKREAAVVVEGLLKMGVIPVMVTGDNWRTARA 838
Query: 837 VAREIGIQDVMADVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTD 896
VA+E+GIQDV A+VMPAGKA+ + SFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTD
Sbjct: 839 VAKEVGIQDVRAEVMPAGKAEVIHSFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTD 898
Query: 897 IAIEAADYVLMRNSLEDVIIAIDLSRKTFARIRLNYIFAMAYNVIAIPIAAGVFFPSLGI 956
IAIEAADYVLMR++LEDVI AIDLSRKTF+RIRLNY+FAMAYNVIAIPIAAGVFFP LGI
Sbjct: 899 IAIEAADYVLMRSNLEDVITAIDLSRKTFSRIRLNYVFAMAYNVIAIPIAAGVFFPWLGI 958
Query: 957 KLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTILEITVE 998
KLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTILEITVE
Sbjct: 959 KLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTILEITVE 1000
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224137820|ref|XP_002326448.1| heavy metal ATPase [Populus trichocarpa] gi|222833770|gb|EEE72247.1| heavy metal ATPase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297738009|emb|CBI27210.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224071055|ref|XP_002303349.1| heavy metal ATPase [Populus trichocarpa] gi|222840781|gb|EEE78328.1| heavy metal ATPase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356558246|ref|XP_003547418.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|307136407|gb|ADN34216.1| heavy metal ATPase [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|449433505|ref|XP_004134538.1| PREDICTED: copper-transporting ATPase RAN1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15241582|ref|NP_199292.1| copper-transporting ATPase RAN1 [Arabidopsis thaliana] gi|12229667|sp|Q9S7J8.1|HMA7_ARATH RecName: Full=Copper-transporting ATPase RAN1; AltName: Full=Protein HEAVY METAL ATPASE 7; AltName: Full=Protein RESPONSIVE TO ANTAGONIST 1 gi|4760370|gb|AAD29109.1|AF082565_1 ATP dependent copper transporter [Arabidopsis thaliana] gi|4760380|gb|AAD29115.1| ATP dependent copper transporter [Arabidopsis thaliana] gi|6850337|gb|AAC79141.2| ATP dependent copper transporter (RAN1) [Arabidopsis thaliana] gi|9758383|dbj|BAB08832.1| ATP dependent copper transporter [Arabidopsis thaliana] gi|332007780|gb|AED95163.1| copper-transporting ATPase RAN1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14194135|gb|AAK56262.1|AF367273_1 AT5g44790/K23L20_14 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356530268|ref|XP_003533704.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 998 | ||||||
| TAIR|locus:2156354 | 1001 | RAN1 "RESPONSIVE-TO-ANTAGONIST | 0.991 | 0.989 | 0.751 | 0.0 | |
| TAIR|locus:2031361 | 995 | HMA5 "heavy metal atpase 5" [A | 0.933 | 0.936 | 0.472 | 3.9e-227 | |
| DICTYBASE|DDB_G0284141 | 985 | atp7a "copper-transporting ATP | 0.329 | 0.334 | 0.513 | 1.6e-190 | |
| UNIPROTKB|F1MKI1 | 1505 | ATP7B "Uncharacterized protein | 0.634 | 0.420 | 0.376 | 2.2e-180 | |
| UNIPROTKB|F1N8W2 | 1390 | ATP7B "Uncharacterized protein | 0.602 | 0.432 | 0.372 | 9.5e-175 | |
| UNIPROTKB|F1P5C8 | 1440 | ATP7B "Uncharacterized protein | 0.618 | 0.428 | 0.369 | 1.1e-172 | |
| UNIPROTKB|E1C2H7 | 1414 | ATP7B "Uncharacterized protein | 0.640 | 0.451 | 0.360 | 2e-172 | |
| ZFIN|ZDB-GENE-060825-45 | 1500 | atp7a "ATPase, Cu++ transporti | 0.395 | 0.263 | 0.440 | 1.4e-169 | |
| FB|FBgn0030343 | 1254 | ATP7 "ATP7" [Drosophila melano | 0.606 | 0.482 | 0.371 | 4.6e-166 | |
| WB|WBGene00000834 | 1238 | cua-1 [Caenorhabditis elegans | 0.610 | 0.491 | 0.377 | 5.2e-165 |
| TAIR|locus:2156354 RAN1 "RESPONSIVE-TO-ANTAGONIST 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3867 (1366.3 bits), Expect = 0., P = 0.
Identities = 758/1008 (75%), Positives = 863/1008 (85%)
Query: 2 MALSNRDLQLTELNXXXXXXXXXXXXXWLLNNYDG---------KKERIGD--GMRRIQV 50
MA S RDLQLT + LL++Y K E D G+R+IQV
Sbjct: 1 MAPSRRDLQLTPVTGGSSSQISDMEEVGLLDSYHNEANADDILTKIEEGRDVSGLRKIQV 60
Query: 51 GVTGMTCAACSNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFE 110
GVTGMTCAACSNSVE ALM + GV KASVALLQN+ADVVFDP+LVK+EDIK AIEDAGFE
Sbjct: 61 GVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGFE 120
Query: 111 AEILAESSTSGPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEV 170
AEILAE T Q T+VGQ+TIGGMTCAACVNSVEGILR LPGVKRAVVAL+TSLGEV
Sbjct: 121 AEILAEEQT-----QATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSLGEV 175
Query: 171 EYDPTVISKDDIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGV 230
EYDP VI+KDDI NAIEDAGFE S VQS+ QDK++L+V G+L ELDA LEGIL+ GV
Sbjct: 176 EYDPNVINKDDIVNAIEDAGFEGSLVQSNQQDKLVLRVDGILNELDAQVLEGILTRLNGV 235
Query: 231 RQFRFDKISGELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM 290
RQFR D+ISGELEV+FDPE +SSRSLVDGI GKF++RVM+P+ R++S+D+ E SNM
Sbjct: 236 RQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPYERLSSKDTGEASNM 295
Query: 291 FRLFISSLFLSIPVFFIRVICPHIPLVYALLLWRCGPFLMGDWLNWALVSVVQFVIGKRF 350
FR FISSL LSIP+FFI+VICPHI L ALL+WRCGPF+MGDWL WALVSV+QFVIGKRF
Sbjct: 296 FRRFISSLVLSIPLFFIQVICPHIALFDALLVWRCGPFMMGDWLKWALVSVIQFVIGKRF 355
Query: 351 YTAAGRALRNGSTNMDVLVALGTSAAYFYSVGALLYGVVTGFWSPTYFETSAMLITFVLF 410
Y AA RALRNGSTNMDVLVALGTSA+YFYSVGALLYG VTGFWSPTYF+ SAMLITFVL
Sbjct: 356 YVAAWRALRNGSTNMDVLVALGTSASYFYSVGALLYGAVTGFWSPTYFDASAMLITFVLL 415
Query: 411 GKYLEILAKGKTSDAIKKLVELAPATALLVVKDKVGKCIEEREIDALLIQSGDTLKVLPG 470
GKYLE LAKGKTSDA+KKLV+L PATA+L+ + K GK + EREIDALLIQ GDTLKV PG
Sbjct: 416 GKYLESLAKGKTSDAMKKLVQLTPATAILLTEGKGGKLVGEREIDALLIQPGDTLKVHPG 475
Query: 471 TKLPADGIVVWGTSYVNESMVTGEAVPVLKEINSPVIGGTINLHGVLHIQATKVGSDAVL 530
K+PADG+VVWG+SYVNESMVTGE+VPV KE++SPVIGGTIN+HG LH++ATKVGSDAVL
Sbjct: 476 AKIPADGVVVWGSSYVNESMVTGESVPVSKEVDSPVIGGTINMHGALHMKATKVGSDAVL 535
Query: 531 SQIISLVETAQMSKAPIQKFADFVASIFVPIVVTLALFTWLCWYVAGVLGAYPEQWLPEN 590
SQIISLVETAQMSKAPIQKFAD+VASIFVP+V+TLALFT + W + G +GAYP++WLPEN
Sbjct: 536 SQIISLVETAQMSKAPIQKFADYVASIFVPVVITLALFTLVGWSIGGAVGAYPDEWLPEN 595
Query: 591 GTHFVFALMFSISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQKIKYV 650
GTHFVF+LMFSISVVVIACPCALGLATPTAVMVATGVGA NGVLIKGGDALE+A K+KYV
Sbjct: 596 GTHFVFSLMFSISVVVIACPCALGLATPTAVMVATGVGATNGVLIKGGDALEKAHKVKYV 655
Query: 651 IFDKTGTLTQGRATVTTAKVFTKMDRGEFLTLVASAEASSEHPLAKAVVEYARHFHFFDD 710
IFDKTGTLTQG+ATVTT KVF++MDRGEFLTLVASAEASSEHPLAKA+V YARHFHFFD+
Sbjct: 656 IFDKTGTLTQGKATVTTTKVFSEMDRGEFLTLVASAEASSEHPLAKAIVAYARHFHFFDE 715
Query: 711 PSLNPDGQSHSKESTGSGWLLDVSDFSALPGRGIQCFISGKQVLVGNRKLLNESGITIPD 770
+ DG++++K+ SGWLLD SDFSALPG+GIQC ++ K +LVGNRKL++E+ I IPD
Sbjct: 716 ST--EDGETNNKDLQNSGWLLDTSDFSALPGKGIQCLVNEKMILVGNRKLMSENAINIPD 773
Query: 771 HVESFVVELEESARTGILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDN 830
HVE FV +LEES +TG++VAY+ L+GVMGIADP+KREAA+VVEGLL+MGVRP+MVTGDN
Sbjct: 774 HVEKFVEDLEESGKTGVIVAYNGKLVGVMGIADPLKREAALVVEGLLRMGVRPIMVTGDN 833
Query: 831 WRTAHAVAREIGIQDVMADVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAAADVGMA 890
WRTA AVA+E+GI+DV A+VMPAGKAD +RS QKDGS VAMVGDGINDSPALAAADVGMA
Sbjct: 834 WRTARAVAKEVGIEDVRAEVMPAGKADVIRSLQKDGSTVAMVGDGINDSPALAAADVGMA 893
Query: 891 IGAGTDIAIEAADYVLMRNSLEDVIIAIDLSRKTFARIRLNYIFAMAYNVIAIPIAAGVF 950
IGAGTD+AIEAADYVLMRN+LEDVI AIDLSRKT RIRLNY+FAMAYNV++IPIAAGVF
Sbjct: 894 IGAGTDVAIEAADYVLMRNNLEDVITAIDLSRKTLTRIRLNYVFAMAYNVVSIPIAAGVF 953
Query: 951 FPSLGIKLPPWAAGACMAXXXXXXXXXXXXXRRYKKPRLTTILEITVE 998
FP L ++LPPWAAGACMA RRYKKPRLTT+L+IT E
Sbjct: 954 FPVLRVQLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTVLKITTE 1001
|
|
| TAIR|locus:2031361 HMA5 "heavy metal atpase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0284141 atp7a "copper-transporting ATPase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MKI1 ATP7B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N8W2 ATP7B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5C8 ATP7B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C2H7 ATP7B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060825-45 atp7a "ATPase, Cu++ transporting, alpha polypeptide" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030343 ATP7 "ATP7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000834 cua-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_290004 | SubName- Full=Putative uncharacterized protein; (1010 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 998 | |||
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 0.0 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 0.0 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 0.0 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 1e-158 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 1e-135 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 1e-107 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 7e-92 | |
| pfam00122 | 222 | pfam00122, E1-E2_ATPase, E1-E2 ATPase | 8e-57 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 3e-53 | |
| COG2216 | 681 | COG2216, KdpB, High-affinity K+ transport system, | 4e-50 | |
| TIGR01497 | 675 | TIGR01497, kdpB, K+-transporting ATPase, B subunit | 3e-47 | |
| PRK14010 | 673 | PRK14010, PRK14010, potassium-transporting ATPase | 6e-47 | |
| PRK01122 | 679 | PRK01122, PRK01122, potassium-transporting ATPase | 1e-45 | |
| TIGR01647 | 754 | TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e | 2e-31 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 3e-24 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 2e-22 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 1e-21 | |
| PRK10517 | 902 | PRK10517, PRK10517, magnesium-transporting ATPase | 2e-18 | |
| TIGR01524 | 867 | TIGR01524, ATPase-IIIB_Mg, magnesium-translocating | 2e-18 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 3e-17 | |
| TIGR01523 | 1053 | TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu | 8e-17 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 8e-17 | |
| PRK15122 | 903 | PRK15122, PRK15122, magnesium-transporting ATPase; | 1e-16 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 5e-16 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 1e-14 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 2e-13 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 2e-13 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 5e-13 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 5e-13 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 2e-12 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 4e-10 | |
| TIGR00003 | 66 | TIGR00003, TIGR00003, copper ion binding protein | 4e-10 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 1e-09 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 6e-09 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 8e-09 | |
| COG4087 | 152 | COG4087, COG4087, Soluble P-type ATPase [General f | 1e-08 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 3e-08 | |
| PRK13748 | 561 | PRK13748, PRK13748, putative mercuric reductase; P | 2e-07 | |
| TIGR00003 | 66 | TIGR00003, TIGR00003, copper ion binding protein | 6e-07 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 4e-06 | |
| TIGR02052 | 92 | TIGR02052, MerP, mercuric transport protein peripl | 4e-06 | |
| TIGR02052 | 92 | TIGR02052, MerP, mercuric transport protein peripl | 5e-06 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 2e-05 | |
| PRK13748 | 561 | PRK13748, PRK13748, putative mercuric reductase; P | 3e-05 | |
| TIGR00099 | 256 | TIGR00099, Cof-subfamily, Cof subfamily of IIB sub | 4e-05 | |
| COG0560 | 212 | COG0560, SerB, Phosphoserine phosphatase [Amino ac | 2e-04 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 3e-04 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 5e-04 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 0.001 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 0.001 | |
| pfam08282 | 254 | pfam08282, Hydrolase_3, haloacid dehalogenase-like | 0.001 | |
| pfam12710 | 122 | pfam12710, HAD, haloacid dehalogenase-like hydrola | 0.002 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 0.004 |
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
Score = 751 bits (1940), Expect = 0.0
Identities = 317/619 (51%), Positives = 410/619 (66%), Gaps = 48/619 (7%)
Query: 346 IGKRFYTAAGRALRNGSTNMDVLVALGTSAAYFYSVGALLYGVV-TGFWSPTYFETSAML 404
G+ FY +A +ALR+ + NMD L+ALGT+ AY YS+ ALL V TG T+F+ SAML
Sbjct: 1 AGRPFYKSAWKALRHKTPNMDTLIALGTTVAYGYSLVALLANQVLTGLHVHTFFDASAML 60
Query: 405 ITFVLFGKYLEILAKGKTSDAIKKLVELAPATALLVVKDKVGKCIEEREIDALLIQSGDT 464
ITF+L G++LE+LAKG+ SDA+ KL +L P+TA L+ D E E+ L+Q GD
Sbjct: 61 ITFILLGRWLEMLAKGRASDALSKLAKLQPSTATLLTDDG-----EIEEVPVELLQPGDI 115
Query: 465 LKVLPGTKLPADGIVVWGTSYVNESMVTGEAVPVLKEINSPVIGGTINLHGVLHIQATKV 524
++VLPG K+P DG V+ G S V+ES+VTGE++PV K++ PVI GT+N G L ++AT
Sbjct: 116 VRVLPGEKIPVDGTVIEGESEVDESLVTGESLPVPKKVGDPVIAGTVNGTGSLVVRATAT 175
Query: 525 GSDAVLSQIISLVETAQMSKAPIQKFADFVASIFVPIVVTLALFTWLCWYVAGVLGAYPE 584
G D L+QI+ LV AQ SKAPIQ+ AD VA FVP+V+ +AL T++ W + G
Sbjct: 176 GEDTTLAQIVRLVRQAQQSKAPIQRLADKVAGYFVPVVIAIALITFVIWLILG------- 228
Query: 585 QWLPENGTHFVFALMFSISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERA 644
FVFAL +++V++IACPCALGLATPT + VATG+ A NGVLIK GDALERA
Sbjct: 229 -------ADFVFALEVAVTVLIIACPCALGLATPTVIAVATGLAAKNGVLIKDGDALERA 281
Query: 645 QKIKYVIFDKTGTLTQGRATVTTAKVFTKMDRGEFLTLVASAEASSEHPLAKAVVEYARH 704
I V+FDKTGTLTQG+ TVT VF + DR E L L A+ EA SEHPLAKA+V YA+
Sbjct: 282 ANIDTVVFDKTGTLTQGKPTVTDVHVFGESDRDELLALAAALEAGSEHPLAKAIVSYAKA 341
Query: 705 FHFFDDPSLNPDGQSHSKESTGSGWLLDVSDFSALPGRGIQCFISGKQVLVGNRKLLNES 764
L VSDF A+PG G++ + G + +GN KLL E+
Sbjct: 342 KGIT---------------------LSQVSDFKAIPGIGVEGTVEGHTIQLGNEKLLGEN 380
Query: 765 GITIPDHVESFVVELEESARTGILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPV 824
G+ VE E T +LVA + L GV+ +AD +K EA V++ L + G+ PV
Sbjct: 381 GLKTDGEVE------EGGGTTSVLVAVNGELAGVLALADQLKPEAKEVIQALKRRGIEPV 434
Query: 825 MVTGDNWRTAHAVAREIGIQDVMADVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAA 884
M+TGDN +TA AVA+E+GI++V A+V+P KA ++ Q+ G +VAMVGDGIND+PALA
Sbjct: 435 MLTGDNRKTAKAVAKELGIENVRAEVLPDDKAALIKKLQEKGKVVAMVGDGINDAPALAQ 494
Query: 885 ADVGMAIGAGTDIAIEAADYVLMRNSLEDVIIAIDLSRKTFARIRLNYIFAMAYNVIAIP 944
ADVG+AIGAGTD+AIEAAD VL+RN L DV AIDLSRKT RI+ N ++A YNVIAIP
Sbjct: 495 ADVGIAIGAGTDVAIEAADVVLLRNDLNDVATAIDLSRKTLRRIKQNLLWAFGYNVIAIP 554
Query: 945 IAAGVFFPSLGIKLPPWAA 963
IAAGV +P GI L P A
Sbjct: 555 IAAGVLYP-AGILLSPAVA 572
|
This model describes the P-type ATPase primarily responsible for translocating copper ions accross biological membranes. These transporters are found in prokaryotes and eukaryotes. This model encompasses those species which pump copper ions out of cells or organelles (efflux pumps such as CopA of Escherichia coli ) as well as those which pump the ion into cells or organelles either for the purpose of supporting life in extremely low-copper environments (for example CopA of Enterococcus hirae ) or for the specific delivery of copper to a biological complex for which it is a necessary component (for example FixI of Bradyrhizobium japonicum, or CtaA and PacS of Synechocystis). The substrate specificity of these transporters may, to a varying degree, include silver ions (for example, CopA from Archaeoglobus fulgidus). Copper transporters from this family are well known as the genes which are mutated in two human disorders of copper metabolism, Wilson's and Menkes' diseases. The sequences contributing to the seed of this model are all experimentally characterized. The copper P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the cadmium-ATPases (TIGR01512) are well separated, and thus we further type the copper-ATPases as IB1 (and the cadmium-ATPases as IB2). Several sequences which have not been characterized experimentally fall just below the cutoffs for both of these models. A sequence from Enterococcus faecalis scores very high against this model, but yet is annotated as an "H+/K+ exchanging ATPase". BLAST of this sequence does not hit anything else annotated in this way. This error may come from the characterization paper published in 1987. Accession GP|7415611 from Saccharomyces cerevisiae appears to be mis-annotated as a cadmium resistance protein. Accession OMNI|NTL01HS00542 from Halobacterium which scores above trusted for this model is annotated as "molybdenum-binding protein" although no evidence can be found for this classification [Cellular processes, Detoxification, Transport and binding proteins, Cations and iron carrying compounds]. Length = 572 |
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215733 pfam00122, E1-E2_ATPase, E1-E2 ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 998 | |||
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 100.0 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 100.0 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 100.0 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 100.0 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 100.0 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 100.0 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 100.0 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 100.0 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 100.0 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 100.0 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 100.0 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 100.0 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 100.0 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 100.0 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 100.0 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 100.0 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 100.0 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 100.0 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 100.0 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 100.0 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 100.0 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 100.0 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 100.0 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 100.0 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 100.0 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 100.0 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 100.0 | |
| PF00122 | 230 | E1-E2_ATPase: E1-E2 ATPase p-type cation-transport | 100.0 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.95 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 99.62 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.53 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.45 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.18 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.18 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.17 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 99.16 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.09 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.09 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.04 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.04 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.01 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.0 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 98.96 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 98.96 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 98.95 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.95 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 98.94 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.91 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.89 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 98.84 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 98.82 | |
| PLN02887 | 580 | hydrolase family protein | 98.78 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.77 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 98.77 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.72 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 98.65 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.56 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.51 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.51 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 98.49 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.47 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.44 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.36 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.35 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 98.33 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 98.29 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.28 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 98.26 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.26 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.21 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.2 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.18 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.12 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 98.08 | |
| PRK06769 | 173 | hypothetical protein; Validated | 98.07 | |
| PRK08238 | 479 | hypothetical protein; Validated | 98.07 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.06 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 98.06 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.05 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.04 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 97.99 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.95 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.95 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 97.92 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.83 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.82 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 97.8 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 97.75 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 97.74 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.73 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.72 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.7 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.65 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.65 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.61 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.6 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.58 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 97.58 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.55 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 97.5 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 97.48 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 97.48 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 97.46 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.46 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.45 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 97.43 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.43 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.4 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 97.36 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 97.35 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 97.34 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 97.31 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 97.29 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 97.28 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.24 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.23 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 97.21 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.21 | |
| PLN02940 | 382 | riboflavin kinase | 97.19 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.17 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.13 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.06 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 97.02 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 97.0 | |
| PLN02580 | 384 | trehalose-phosphatase | 96.99 | |
| PLN02811 | 220 | hydrolase | 96.98 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 96.97 | |
| KOG4383 | 1354 | consensus Uncharacterized conserved protein [Funct | 96.97 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 96.93 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 96.92 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 96.92 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 96.82 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 96.79 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.78 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 96.78 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.78 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 96.72 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 96.66 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 96.66 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.65 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.61 | |
| PLN03017 | 366 | trehalose-phosphatase | 96.58 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.56 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 96.55 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 96.54 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.54 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 96.49 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 96.45 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 96.39 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 96.3 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.28 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.27 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 96.09 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 96.04 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 96.0 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 95.99 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 95.97 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 95.76 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 95.7 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 95.66 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 95.65 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 95.58 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 95.54 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 95.37 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 95.04 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 94.95 | |
| PLN02151 | 354 | trehalose-phosphatase | 94.81 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 94.69 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 94.69 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 94.46 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 94.03 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 93.95 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 93.81 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 93.48 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 93.17 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 92.94 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 92.05 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 91.82 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 91.21 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 90.94 | |
| PF00873 | 1021 | ACR_tran: AcrB/AcrD/AcrF family; InterPro: IPR0010 | 90.77 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 90.52 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 90.43 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 89.6 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 89.08 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 88.43 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 88.42 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 88.42 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 88.25 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 86.85 | |
| KOG4383 | 1354 | consensus Uncharacterized conserved protein [Funct | 86.26 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 85.45 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 85.03 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 85.0 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 84.8 | |
| COG0841 | 1009 | AcrB Cation/multidrug efflux pump [Defense mechani | 84.65 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 84.14 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 83.86 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 82.39 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 82.39 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 80.89 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 80.06 |
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-155 Score=1320.05 Aligned_cols=903 Identities=50% Similarity=0.778 Sum_probs=831.1
Q ss_pred CCCCChhHHHHHHHhhcCCCCeeEEEEeecccEEEEEECCCCCChHHHHHHHHhcCccchhccccCCCCCCCCcceeeee
Q 001896 53 TGMTCAACSNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTSGPKPQGTIVGQY 132 (998)
Q Consensus 53 ~gm~C~~C~~~ie~~l~~~~gv~~~~v~l~~~~~~v~~~~~~~~~~~i~~~i~~~Gy~~~~~~~~~~~~~~~~~~~~~~l 132 (998)
.||+|..|.+.++++++..+|+.++.+++.++++.+.|+ ...+++.+.+.+++.||++...+++.... .+..+
T Consensus 1 ~gmtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~-~~~~~~~i~~~ied~gf~~~~~~~~~~~~------~~~~l 73 (951)
T KOG0207|consen 1 KGMTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYD-NIVSPESIKETIEDMGFEASLLSDSEITA------SKCYL 73 (951)
T ss_pred CCccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEe-eccCHHHHHHHhhcccceeeecccCcccc------ceeEE
Confidence 499999999999999999999999999999999999999 88999999999999999998876654322 25689
Q ss_pred eeccccChhhhhhHHhhhcCCCCceeeeeecCCCeEEEEeCCCCCCHHHHHHHHHhcCCceeeeccCC---ccceeeeec
Q 001896 133 TIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKDDIANAIEDAGFEASFVQSSG---QDKILLQVT 209 (998)
Q Consensus 133 ~i~gm~C~~C~~~ie~~l~~~~GV~~~~v~~~~~~~~v~~d~~~~~~~~i~~~i~~~G~~~~~~~~~~---~~~~~~~v~ 209 (998)
++.||+|.+|...+|+.+++.+||.++.+.+..+++++.|||..++...+.+.+++.||.+.+.++.. ..++.|.+.
T Consensus 74 ~v~GmtC~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s~~~~~e~ie~~gf~a~~i~~~~~~~~~~i~L~v~ 153 (951)
T KOG0207|consen 74 SVNGMTCASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTSPDSIAESIEDLGFSAELIESVNGNSNQKIYLDVL 153 (951)
T ss_pred EecCceeHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccCchhHHHHHHhcCccceehhcccCCCCCcEEEEee
Confidence 99999999999999999999999999999999999999999999999999999999999999876532 257899999
Q ss_pred CccchhhhhHHHhhhhcCCCceeEEeecCCCeEEEEecCCCCCcccccccccccCCCcccccccCccc---cccccchHH
Q 001896 210 GVLCELDAHFLEGILSNFKGVRQFRFDKISGELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFA---RMTSRDSEE 286 (998)
Q Consensus 210 gm~c~~ca~~ie~~l~~~~GV~~~~vn~~~~~~~V~y~~~~~~~~~i~~~i~~~g~~~~~~~~~~~~~---~~~~~~~~~ 286 (998)
||.|.+|+..||+.+.+++||.+++++..++++.|.|||..++++++.+.+|..+ +.+.+..... ....+...+
T Consensus 154 g~~c~s~~~~ie~~l~~l~gV~~~sv~~~t~~~~V~~~~~~~~pr~i~k~ie~~~---~~~~~~~~~~~~~~~~l~~~~e 230 (951)
T KOG0207|consen 154 GMTCASCVSKIESILERLRGVKSFSVSLATDTAIVVYDPEITGPRDIIKAIEETG---FEASVRPYGDTTFKNSLKHKEE 230 (951)
T ss_pred cccccchhhhhHHHHhhccCeeEEEEeccCCceEEEecccccChHHHHHHHHhhc---ccceeeeccccchhhhhhhhhH
Confidence 9999999999999999999999999999999999999999999999999999988 4333322111 112234567
Q ss_pred HHHHHHHHHHHHHhHHHHHHHHhhcCchhhHHHHhhhccCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHcCCCChh
Q 001896 287 TSNMFRLFISSLFLSIPVFFIRVICPHIPLVYALLLWRCGPFLMGDWLNWALVSVVQFVIGKRFYTAAGRALRNGSTNMD 366 (998)
Q Consensus 287 ~~~~~~~~~~al~l~l~v~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~g~~~~~~~~~~l~~~~~~md 366 (998)
.+.|++.|++++.+++|++++.+.+++.......+.....++++..++.++|+++++|..||+||..||++|++|+.|||
T Consensus 231 i~~w~~~fl~s~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~~vqf~~G~~fy~~A~ksL~~g~~nMd 310 (951)
T KOG0207|consen 231 IRKWKRPFLISLGFSLPVSFAMIICPPLAWILALLVPFLPGLSYGNSLSFVLATPVQFVGGRPFYLAAYKSLKRGSANMD 310 (951)
T ss_pred HHhcchHHHHHHHHHHHHHHHHHHhccchhhhhhhccccccchhhhHHHhhhheeeEEecceeeHHHHHHHHhcCCCCce
Confidence 89999999999999999999888877654422222222556889999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhcCCCCCchhhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhcCCCeEEEEEecCCC
Q 001896 367 VLVALGTSAAYFYSVGALLYGVVTGFWSPTYFETSAMLITFVLFGKYLEILAKGKTSDAIKKLVELAPATALLVVKDKVG 446 (998)
Q Consensus 367 ~Li~l~~~~a~~~s~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~e~~~~~k~~~~l~~l~~~~~~~~~v~~~~r~g 446 (998)
+|+++++.+||+||+++++....... +..||+++.|++.|+++|+|+|..++.|+...+.+|.++.|.++.++ .+|
T Consensus 311 vLv~L~t~aay~~S~~~~~~~~~~~~-~~tfFdt~~MLi~fi~lgr~LE~~Ak~kts~alskLmsl~p~~a~ii---~~g 386 (951)
T KOG0207|consen 311 VLVVLGTTAAYFYSIFSLLAAVVFDS-PPTFFDTSPMLITFITLGRWLESLAKGKTSEALSKLMSLAPSKATII---EDG 386 (951)
T ss_pred eehhhHHHHHHHHHHHHHHHHHHccC-cchhccccHHHHHHHHHHHHHHHHhhccchHHHHHHhhcCcccceEe---ecC
Confidence 99999999999999998887666533 78999999999999999999999999999999999999999999998 666
Q ss_pred cceeEEEEeCCCCCCCCEEEEcCCCcccccEEEEecceeeecccccCcCcccccCCCCceecceeeeeceEEEEEEEecC
Q 001896 447 KCIEEREIDALLIQSGDTLKVLPGTKLPADGIVVWGTSYVNESMVTGEAVPVLKEINSPVIGGTINLHGVLHIQATKVGS 526 (998)
Q Consensus 447 ~~~~~~~i~~~~l~~GDii~v~~G~~iPaDg~vl~G~~~Vdes~LTGEs~pv~k~~g~~v~aGt~~~~g~~~~~v~~~g~ 526 (998)
+ ++++||.+.|++||+|.|.||++||+||+|++|++.||||.+|||++||.|++|+.|.+||+|.+|.+.++++++|.
T Consensus 387 ~--~e~eI~v~lvq~gdivkV~pG~kiPvDG~Vv~Gss~VDEs~iTGEs~PV~Kk~gs~ViaGsiN~nG~l~VkaT~~g~ 464 (951)
T KOG0207|consen 387 S--EEKEIPVDLVQVGDIVKVKPGEKIPVDGVVVDGSSEVDESLITGESMPVPKKKGSTVIAGSINLNGTLLVKATKVGG 464 (951)
T ss_pred C--cceEeeeeeeccCCEEEECCCCccccccEEEeCceeechhhccCCceecccCCCCeeeeeeecCCceEEEEEEeccc
Confidence 4 37999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHHHHHHhhccCChHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhh-cCCCCCcccCCCCccHHHHHHHHhhhh
Q 001896 527 DAVLSQIISLVETAQMSKAPIQKFADFVASIFVPIVVTLALFTWLCWYVAGV-LGAYPEQWLPENGTHFVFALMFSISVV 605 (998)
Q Consensus 527 ~t~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~i~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~isvl 605 (998)
||.+++|.+++++++.+|+|+|+++|+++.||+|.++++++++|++|.+.+. ...++..|. ..+..++.++++++
T Consensus 465 dttla~IvkLVEEAQ~sKapiQq~aDkia~yFvP~Vi~lS~~t~~~w~~~g~~~~~~~~~~~----~~~~~a~~~aisVl 540 (951)
T KOG0207|consen 465 DTTLAQIVKLVEEAQLSKAPIQQLADKIAGYFVPVVIVLSLATFVVWILIGKIVFKYPRSFF----DAFSHAFQLAISVL 540 (951)
T ss_pred cchHHHHHHHHHHHHcccchHHHHHHHhhhcCCchhhHHHHHHHHHHHHHccccccCcchhh----HHHHHHHHhhheEE
Confidence 9999999999999999999999999999999999999999999999999876 334455554 57889999999999
Q ss_pred hhhccccchhhHHHHHHHHHHHHHhcCcEEecchHHHhhcCCcEEEecCCCccccCceEEEEEEecCC-CCHHHHHHHHH
Q 001896 606 VIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQKIKYVIFDKTGTLTQGRATVTTAKVFTK-MDRGEFLTLVA 684 (998)
Q Consensus 606 v~~~P~aL~la~p~~~~~~~~~~~k~gilvk~~~~le~lg~v~~i~fDKTGTLT~~~~~v~~i~~~~~-~~~~~~l~~~~ 684 (998)
+++|||+|++|+|++++.|...++++|+++|+++++|.+.++++++||||||||+|++.|.++....+ .+..+++.+++
T Consensus 541 viACPCaLgLATPtAvmvatgvgA~nGvLIKGge~LE~~hkv~tVvFDKTGTLT~G~~~V~~~~~~~~~~~~~e~l~~v~ 620 (951)
T KOG0207|consen 541 VIACPCALGLATPTAVMVATGVGATNGVLIKGGEALEKAHKVKTVVFDKTGTLTEGKPTVVDFKSLSNPISLKEALALVA 620 (951)
T ss_pred EEECchhhhcCCceEEEEEechhhhcceEEcCcHHHHHHhcCCEEEEcCCCceecceEEEEEEEecCCcccHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999877 78999999999
Q ss_pred HhhccCCChHHHHHHHHHHhcCCCCCCCCCCCCCCcccccCCCcccccccceeeecCCe--EEEEEcCeEEEEeeHhhhh
Q 001896 685 SAEASSEHPLAKAVVEYARHFHFFDDPSLNPDGQSHSKESTGSGWLLDVSDFSALPGRG--IQCFISGKQVLVGNRKLLN 762 (998)
Q Consensus 685 ~~~~~~~hp~~~ai~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g--i~~~~~g~~~~~g~~~~~~ 762 (998)
+.|.+++||+++|+++|++..... .....+.++++.+|.| +.+.++|+.+.+|+++|+.
T Consensus 621 a~Es~SeHPig~AIv~yak~~~~~-------------------~~~~~~~~~~~~pg~g~~~~~~~~~~~i~iGN~~~~~ 681 (951)
T KOG0207|consen 621 AMESGSEHPIGKAIVDYAKEKLVE-------------------PNPEGVLSFEYFPGEGIYVTVTVDGNEVLIGNKEWMS 681 (951)
T ss_pred HHhcCCcCchHHHHHHHHHhcccc-------------------cCccccceeecccCCCcccceEEeeeEEeechHHHHH
Confidence 999999999999999999987310 1112346778888988 6788899999999999999
Q ss_pred hcCCCCChhhHHHHHHHHHcCCeEEEEEECCeEEEEEEecCCCcHhHHHHHHHHHhCCCEEEEEcCCCHHHHHHHHHHhC
Q 001896 763 ESGITIPDHVESFVVELEESARTGILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTAHAVAREIG 842 (998)
Q Consensus 763 ~~~~~~~~~~~~~~~~~~~~g~~~i~va~~~~~lG~i~l~d~~r~~~~~~i~~l~~~gi~~~i~tgd~~~~a~~ia~~~g 842 (998)
+++...+++.++..++.+..|++++++++|+++.|++.++|++|||+..+|..||++|++++|+|||+..+|+++|+++|
T Consensus 682 r~~~~~~~~i~~~~~~~e~~g~tvv~v~vn~~l~gv~~l~D~vr~~a~~av~~Lk~~Gi~v~mLTGDn~~aA~svA~~VG 761 (951)
T KOG0207|consen 682 RNGCSIPDDILDALTESERKGQTVVYVAVNGQLVGVFALEDQVRPDAALAVAELKSMGIKVVMLTGDNDAAARSVAQQVG 761 (951)
T ss_pred hcCCCCchhHHHhhhhHhhcCceEEEEEECCEEEEEEEeccccchhHHHHHHHHHhcCceEEEEcCCCHHHHHHHHHhhC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cceEEEecCcccHHHHHHHHhhcCCEEEEEcCCCCCHHHHhcCCeEEEecCchHHHHHhcCEEEecCChhHHHHHHHHHH
Q 001896 843 IQDVMADVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRNSLEDVIIAIDLSR 922 (998)
Q Consensus 843 i~~~~~~~~p~~K~~~v~~l~~~g~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l~~~i~~~r 922 (998)
++++++++.|+||.++|+.+|+++..|+|||||+||+|||.+|||||++|.|++.|.++||+++++|++.+++.+++++|
T Consensus 762 i~~V~aev~P~~K~~~Ik~lq~~~~~VaMVGDGINDaPALA~AdVGIaig~gs~vAieaADIVLmrn~L~~v~~ai~LSr 841 (951)
T KOG0207|consen 762 IDNVYAEVLPEQKAEKIKEIQKNGGPVAMVGDGINDAPALAQADVGIAIGAGSDVAIEAADIVLMRNDLRDVPFAIDLSR 841 (951)
T ss_pred cceEEeccCchhhHHHHHHHHhcCCcEEEEeCCCCccHHHHhhccceeeccccHHHHhhCCEEEEccchhhhHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhhccccCCCCccHHHHHHHhhhhhHHHhhhcccccccCCCC--ccccccc
Q 001896 923 KTFARIRLNYIFAMAYNVIAIPIAAGVFFPSLGIKLPPWAAGACMALSSVSVVCSSLLLRRYKKPR--LTTILEI 995 (998)
Q Consensus 923 ~~~~~i~~n~~~~~~~n~~~i~~a~g~~~~~~g~~l~p~~a~~~m~~ss~~v~~~s~~l~~~~~~~--~~~~~~~ 995 (998)
+++++||+|+.|++.||+++||+|+|.|.|| |+.|+||+|.++|.+||+.|++|||.|++|++|. ..++.|.
T Consensus 842 kt~~rIk~N~~~A~~yn~~~IpIAagvF~P~-~~~L~Pw~A~lama~SSvsVv~sSllLk~~k~p~~~~~~~~e~ 915 (951)
T KOG0207|consen 842 KTVKRIKLNFVWALIYNLVGIPIAAGVFAPF-GIVLPPWMASLAMAASSVSVVLSSLLLKRYKKPTINKLYRYEA 915 (951)
T ss_pred HHHhhHHHHHHHHHHHHHhhhhhheecccCC-ccccCchHHHHHHHhhhHHHhhhHHHHhhccccccccceeccc
Confidence 9999999999999999999999999999998 4999999999999999999999999999999996 4444443
|
|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >KOG4383 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PF00873 ACR_tran: AcrB/AcrD/AcrF family; InterPro: IPR001036 The Escherichia coli acrA and acrB genes encode a multi-drug efflux system that is believed to protect the bacterium against hydrophobic inhibitors [] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >KOG4383 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 998 | ||||
| 3j09_A | 723 | High Resolution Helical Reconstruction Of The Bacte | 1e-126 | ||
| 3j08_A | 645 | High Resolution Helical Reconstruction Of The Bacte | 1e-124 | ||
| 3rfu_A | 736 | Crystal Structure Of A Copper-Transporting Pib-Type | 1e-114 | ||
| 3a1c_A | 287 | Crystal Structure Of The P- And N-Domains Of Copa, | 2e-56 | ||
| 3a1e_A | 287 | Crystal Structure Of The P- And N-Domains Of His462 | 1e-55 | ||
| 2b8e_A | 273 | Copa Atp Binding Domain Length = 273 | 9e-51 | ||
| 3sky_A | 274 | 2.1a Crystal Structure Of The Phosphate Bound Atp B | 9e-51 | ||
| 3skx_A | 280 | Crystal Structure Of The Atp Binding Domain Of Arch | 1e-50 | ||
| 1mhs_A | 920 | Model Of Neurospora Crassa Proton Atpase Length = 9 | 2e-26 | ||
| 2kij_A | 124 | Solution Structure Of The Actuator Domain Of The Co | 2e-23 | ||
| 2ew9_A | 149 | Solution Structure Of Apowln5-6 Length = 149 | 1e-22 | ||
| 2ew9_A | 149 | Solution Structure Of Apowln5-6 Length = 149 | 5e-14 | ||
| 3dxs_X | 74 | Crystal Structure Of A Copper Binding Domain From H | 3e-22 | ||
| 3dxs_X | 74 | Crystal Structure Of A Copper Binding Domain From H | 3e-06 | ||
| 2iye_A | 263 | Structure Of Catalytic Cpx-atpase Domain Copb-b Len | 6e-21 | ||
| 2yj3_A | 263 | Conformational Changes In The Catalytic Domain Of T | 2e-20 | ||
| 2yj4_A | 263 | Conformational Changes In The Catalytic Domain Of T | 2e-20 | ||
| 3b8c_A | 885 | Crystal Structure Of A Plasma Membrane Proton Pump | 5e-20 | ||
| 2voy_I | 128 | Cryoem Model Of Copa, The Copper Transporting Atpas | 8e-20 | ||
| 2hc8_A | 113 | Structure Of The A. Fulgidus Copa A-Domain Length = | 1e-19 | ||
| 2rop_A | 202 | Solution Structure Of Domains 3 And 4 Of Human Atp7 | 3e-17 | ||
| 2rop_A | 202 | Solution Structure Of Domains 3 And 4 Of Human Atp7 | 7e-09 | ||
| 3ba6_A | 994 | Structure Of The Ca2e1p Phosphoenzyme Intermediate | 3e-17 | ||
| 2dqs_A | 995 | Crystal Structure Of The Calcium Pump With Amppcp I | 4e-17 | ||
| 1kju_A | 994 | Ca2+-Atpase In The E2 State Length = 994 | 4e-17 | ||
| 3tlm_A | 992 | Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp | 5e-17 | ||
| 2rml_A | 147 | Solution Structure Of The N-Terminal Soluble Domain | 9e-16 | ||
| 1p6t_A | 151 | Structure Characterization Of The Water Soluble Reg | 1e-15 | ||
| 2zxe_A | 1028 | Crystal Structure Of The Sodium - Potassium Pump In | 1e-13 | ||
| 3ixz_A | 1034 | Pig Gastric H+K+-Atpase Complexed With Aluminium Fl | 6e-13 | ||
| 3b8e_A | 998 | Crystal Structure Of The Sodium-Potassium Pump Leng | 2e-12 | ||
| 3n23_A | 992 | Crystal Structure Of The High Affinity Complex Betw | 2e-12 | ||
| 2koy_A | 141 | Structure Of The E1064a Mutant Of The N-Domain Of W | 5e-12 | ||
| 1aw0_A | 72 | Fourth Metal-Binding Domain Of The Menkes Copper- T | 2e-11 | ||
| 2ggp_B | 72 | Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex | 4e-11 | ||
| 2ggp_B | 72 | Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex | 5e-07 | ||
| 1fvs_A | 72 | Solution Structure Of The Yeast Copper Transporter | 4e-11 | ||
| 1fvs_A | 72 | Solution Structure Of The Yeast Copper Transporter | 5e-07 | ||
| 1yju_A | 75 | Solution Structure Of The Apo Form Of The Sixth Sol | 3e-10 | ||
| 1yju_A | 75 | Solution Structure Of The Apo Form Of The Sixth Sol | 2e-09 | ||
| 2arf_A | 165 | Solution Structure Of The Wilson Atpase N-Domain In | 1e-09 | ||
| 1yjr_A | 75 | Solution Structure Of The Apo Form Of The Sixth Sol | 1e-09 | ||
| 1yjr_A | 75 | Solution Structure Of The Apo Form Of The Sixth Sol | 7e-09 | ||
| 2kmv_A | 185 | Solution Structure Of The Nucleotide Binding Domain | 2e-08 | ||
| 1q8l_A | 84 | Second Metal Binding Domain Of The Menkes Atpase Le | 1e-07 | ||
| 1q8l_A | 84 | Second Metal Binding Domain Of The Menkes Atpase Le | 5e-06 | ||
| 1s6o_A | 76 | Solution Structure And Backbone Dynamics Of The Apo | 1e-07 | ||
| 1s6o_A | 76 | Solution Structure And Backbone Dynamics Of The Apo | 5e-06 | ||
| 2ldi_A | 71 | Nmr Solution Structure Of Ziaan Sub Mutant Length = | 4e-07 | ||
| 2ldi_A | 71 | Nmr Solution Structure Of Ziaan Sub Mutant Length = | 1e-05 | ||
| 2k1r_A | 73 | The Solution Nmr Structure Of The Complex Between M | 1e-06 | ||
| 1kvi_A | 79 | Solution Structure Of The Reduced Form Of The First | 1e-06 | ||
| 1y3k_A | 77 | Solution Structure Of The Apo Form Of The Fifth Dom | 2e-06 | ||
| 1p8g_A | 73 | The Solution Structure Of Apo Copz From Bacillus Su | 2e-06 | ||
| 1p8g_A | 73 | The Solution Structure Of Apo Copz From Bacillus Su | 3e-04 | ||
| 2qif_A | 69 | Crystal Structure Of A Metallochaperone With A Tetr | 3e-06 | ||
| 2qif_A | 69 | Crystal Structure Of A Metallochaperone With A Tetr | 5e-04 | ||
| 2ofh_X | 111 | Solution Structure Of The N-Terminal Domain Of The | 4e-06 | ||
| 2ofh_X | 111 | Solution Structure Of The N-Terminal Domain Of The | 5e-05 | ||
| 2ofg_X | 111 | Solution Structure Of The N-Terminal Domain Of The | 4e-06 | ||
| 2ofg_X | 111 | Solution Structure Of The N-Terminal Domain Of The | 5e-05 | ||
| 3cjk_B | 75 | Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le | 5e-06 | ||
| 1kqk_A | 80 | Solution Structure Of The N-Terminal Domain Of A Po | 8e-06 | ||
| 2voy_J | 118 | Cryoem Model Of Copa, The Copper Transporting Atpas | 8e-06 | ||
| 2voy_A | 80 | Cryoem Model Of Copa, The Copper Transporting Atpas | 9e-06 | ||
| 2l3m_A | 71 | Solution Structure Of The Putative Copper-Ion-Bindi | 1e-05 | ||
| 2l3m_A | 71 | Solution Structure Of The Putative Copper-Ion-Bindi | 2e-05 | ||
| 1opz_A | 76 | A Core Mutation Affecting The Folding Properties Of | 3e-05 | ||
| 1opz_A | 76 | A Core Mutation Affecting The Folding Properties Of | 7e-05 | ||
| 1afi_A | 72 | Structure Of The Reduced Form Of Merp, The Periplas | 2e-04 |
| >pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 | Back alignment and structure |
|
| >pdb|3J08|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 645 | Back alignment and structure |
| >pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase Length = 736 | Back alignment and structure |
| >pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|2B8E|A Chain A, Copa Atp Binding Domain Length = 273 | Back alignment and structure |
| >pdb|3SKY|A Chain A, 2.1a Crystal Structure Of The Phosphate Bound Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 274 | Back alignment and structure |
| >pdb|3SKX|A Chain A, Crystal Structure Of The Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 280 | Back alignment and structure |
| >pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 | Back alignment and structure |
| >pdb|2KIJ|A Chain A, Solution Structure Of The Actuator Domain Of The Copper- Transporting Atpase Atp7a Length = 124 | Back alignment and structure |
| >pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 | Back alignment and structure |
| >pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 | Back alignment and structure |
| >pdb|3DXS|X Chain X, Crystal Structure Of A Copper Binding Domain From Hma7, A P- Type Atpase Length = 74 | Back alignment and structure |
| >pdb|3DXS|X Chain X, Crystal Structure Of A Copper Binding Domain From Hma7, A P- Type Atpase Length = 74 | Back alignment and structure |
| >pdb|2IYE|A Chain A, Structure Of Catalytic Cpx-atpase Domain Copb-b Length = 263 | Back alignment and structure |
| >pdb|2YJ3|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 | Back alignment and structure |
| >pdb|2YJ4|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 | Back alignment and structure |
| >pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 | Back alignment and structure |
| >pdb|2VOY|I Chain I, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 128 | Back alignment and structure |
| >pdb|2HC8|A Chain A, Structure Of The A. Fulgidus Copa A-Domain Length = 113 | Back alignment and structure |
| >pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 | Back alignment and structure |
| >pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 | Back alignment and structure |
| >pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 | Back alignment and structure |
| >pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 | Back alignment and structure |
| >pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 | Back alignment and structure |
| >pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 | Back alignment and structure |
| >pdb|2RML|A Chain A, Solution Structure Of The N-Terminal Soluble Domains Of Bacillus Subtilis Copa Length = 147 | Back alignment and structure |
| >pdb|1P6T|A Chain A, Structure Characterization Of The Water Soluble Region Of P- Type Atpase Copa From Bacillus Subtilis Length = 151 | Back alignment and structure |
| >pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 | Back alignment and structure |
| >pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 | Back alignment and structure |
| >pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 | Back alignment and structure |
| >pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 | Back alignment and structure |
| >pdb|2KOY|A Chain A, Structure Of The E1064a Mutant Of The N-Domain Of Wilson Disease Associated Protein Length = 141 | Back alignment and structure |
| >pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 | Back alignment and structure |
| >pdb|2GGP|B Chain B, Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex Length = 72 | Back alignment and structure |
| >pdb|2GGP|B Chain B, Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex Length = 72 | Back alignment and structure |
| >pdb|1FVS|A Chain A, Solution Structure Of The Yeast Copper Transporter Domain Ccc2a In The Apo And Cu(I) Load States Length = 72 | Back alignment and structure |
| >pdb|1FVS|A Chain A, Solution Structure Of The Yeast Copper Transporter Domain Ccc2a In The Apo And Cu(I) Load States Length = 72 | Back alignment and structure |
| >pdb|1YJU|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain Of Menkes Protein Length = 75 | Back alignment and structure |
| >pdb|1YJU|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain Of Menkes Protein Length = 75 | Back alignment and structure |
| >pdb|2ARF|A Chain A, Solution Structure Of The Wilson Atpase N-Domain In The Presence Of Atp Length = 165 | Back alignment and structure |
| >pdb|1YJR|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain A69p Mutant Of Menkes Protein Length = 75 | Back alignment and structure |
| >pdb|1YJR|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain A69p Mutant Of Menkes Protein Length = 75 | Back alignment and structure |
| >pdb|2KMV|A Chain A, Solution Structure Of The Nucleotide Binding Domain Of The Human Menkes Protein In The Atp-Free Form Length = 185 | Back alignment and structure |
| >pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 | Back alignment and structure |
| >pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 | Back alignment and structure |
| >pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 | Back alignment and structure |
| >pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 | Back alignment and structure |
| >pdb|2LDI|A Chain A, Nmr Solution Structure Of Ziaan Sub Mutant Length = 71 | Back alignment and structure |
| >pdb|2LDI|A Chain A, Nmr Solution Structure Of Ziaan Sub Mutant Length = 71 | Back alignment and structure |
| >pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 | Back alignment and structure |
| >pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 | Back alignment and structure |
| >pdb|1Y3K|A Chain A, Solution Structure Of The Apo Form Of The Fifth Domain Of Menkes Protein Length = 77 | Back alignment and structure |
| >pdb|1P8G|A Chain A, The Solution Structure Of Apo Copz From Bacillus Subtilis Length = 73 | Back alignment and structure |
| >pdb|1P8G|A Chain A, The Solution Structure Of Apo Copz From Bacillus Subtilis Length = 73 | Back alignment and structure |
| >pdb|2QIF|A Chain A, Crystal Structure Of A Metallochaperone With A Tetranuclear Cu(I) Cluster Length = 69 | Back alignment and structure |
| >pdb|2QIF|A Chain A, Crystal Structure Of A Metallochaperone With A Tetranuclear Cu(I) Cluster Length = 69 | Back alignment and structure |
| >pdb|2OFH|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 | Back alignment and structure |
| >pdb|2OFH|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 | Back alignment and structure |
| >pdb|2OFG|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 | Back alignment and structure |
| >pdb|2OFG|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 | Back alignment and structure |
| >pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 | Back alignment and structure |
| >pdb|1KQK|A Chain A, Solution Structure Of The N-Terminal Domain Of A Potential Copper-Translocating P-Type Atpase From Bacillus Subtilis In The Cu(I)loaded State Length = 80 | Back alignment and structure |
| >pdb|2VOY|J Chain J, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 118 | Back alignment and structure |
| >pdb|2VOY|A Chain A, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 80 | Back alignment and structure |
| >pdb|2L3M|A Chain A, Solution Structure Of The Putative Copper-Ion-Binding Protein From Bacillus Anthracis Str. Ames Length = 71 | Back alignment and structure |
| >pdb|2L3M|A Chain A, Solution Structure Of The Putative Copper-Ion-Binding Protein From Bacillus Anthracis Str. Ames Length = 71 | Back alignment and structure |
| >pdb|1OPZ|A Chain A, A Core Mutation Affecting The Folding Properties Of A Soluble Domain Of The Atpase Protein Copa From Bacillus Subtilis Length = 76 | Back alignment and structure |
| >pdb|1OPZ|A Chain A, A Core Mutation Affecting The Folding Properties Of A Soluble Domain Of The Atpase Protein Copa From Bacillus Subtilis Length = 76 | Back alignment and structure |
| >pdb|1AFI|A Chain A, Structure Of The Reduced Form Of Merp, The Periplasmic Protein From The Bacterial Mercury Detoxification System, Nmr, 20 Structures Length = 72 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 998 | |||
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 0.0 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 1e-17 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 6e-17 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 0.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 0.0 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 1e-128 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 1e-119 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 1e-114 | |
| 2kij_A | 124 | Copper-transporting ATPase 1; actuator, menkes dis | 5e-59 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 1e-54 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 3e-29 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 4e-22 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 4e-54 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 2e-49 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 1e-28 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 2e-48 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-23 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-23 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 2e-04 | |
| 2hc8_A | 113 | PACS, cation-transporting ATPase, P-type; copper, | 1e-42 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 2e-36 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 6e-16 | |
| 2arf_A | 165 | Wilson disease ATPase; P-type ATPase,ATP7B, copper | 3e-31 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 7e-28 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 2e-24 | |
| 2kmv_A | 185 | Copper-transporting ATPase 1; menkes, nucleotide b | 5e-27 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 1e-26 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 6e-24 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 2e-26 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 2e-08 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 3e-26 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 9e-25 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 4e-26 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 5e-24 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 7e-26 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 1e-25 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 1e-25 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 4e-24 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 2e-25 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 1e-24 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 3e-25 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 1e-24 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 3e-25 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 6e-25 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 8e-25 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 2e-23 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 1e-24 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 4e-24 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 2e-24 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 1e-23 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 2e-24 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 2e-23 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 2e-24 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 4e-24 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 2e-23 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 7e-22 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 2e-23 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 6e-23 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 3e-23 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 6e-22 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 7e-22 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 1e-21 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 8e-19 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 3e-18 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 2e-18 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 1e-17 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 2e-18 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 2e-17 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 3e-18 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 1e-16 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 4e-18 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 4e-18 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 3e-13 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 5e-18 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 3e-13 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 1e-16 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 2e-16 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 1e-15 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 4e-11 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 2e-14 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 1e-13 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 5e-13 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 9e-12 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 4e-12 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 3e-11 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 6e-11 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 8e-09 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 3e-08 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-08 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 7e-08 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 2e-06 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 3e-06 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 2e-05 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 4e-06 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 1e-05 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 1e-05 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 1e-05 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 2e-05 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 3e-05 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 3e-05 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 3e-05 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 4e-05 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 5e-05 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 6e-05 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 8e-05 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 8e-05 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 1e-04 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 2e-04 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 2e-04 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 2e-04 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 8e-04 |
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
Score = 853 bits (2207), Expect = 0.0
Identities = 291/787 (36%), Positives = 437/787 (55%), Gaps = 74/787 (9%)
Query: 203 KILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISGELEVLFDPEALSSRSLVDGI-- 260
+ ++VTG+ C + +E + + +GV + R + + + FD + + ++ I
Sbjct: 3 ERTVRVTGMTCAMCVKSIETAVGSLEGVEEVRVNLATETAFIRFDEKRIDFETIKRVIED 62
Query: 261 AGRSNGKFQIRVMNPFARMTSRDSEETSNMFRLFISSLFLSIPVFFIRVICPHIPLVYAL 320
G + S + E S M R + F + + F+ H
Sbjct: 63 LGYG--------VVDEQAAVSAEVEHLSRMKRKLYVAAFAGVLLLFL----AHFI----- 105
Query: 321 LLWRCGPFLMGDWLNWALVSVVQFVIGKRFYTAAGRALRNGSTNMDVLVALGTSAAYFYS 380
D++ + F G + AA ALR + NMDV+ ++G AA+ S
Sbjct: 106 ------SLPYEDFVQLLIALPAIFYSGSSIFKAAFSALRRRTLNMDVMYSMGVGAAFLAS 159
Query: 381 VGALLYGVVTGFWSPTYFETSAMLITFVLFGKYLEILAKGKTSDAIKKLVELAPATALLV 440
V + + + +++ETS +L+ F+L G+ LE AK +T +AIKKLV L TA+ V
Sbjct: 160 VLSTAGVLPREY---SFYETSVLLLAFLLLGRTLEARAKSRTGEAIKKLVGLQAKTAV-V 215
Query: 441 VKDKVGKCIEEREIDALLIQSGDTLKVLPGTKLPADGIVVWGTSYVNESMVTGEAVPVLK 500
++D +E + + GD + V PG K+P DG+VV G SYV+ESM++GE VPVLK
Sbjct: 216 IRDG-----KEIAVPVEEVAVGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPVLK 270
Query: 501 EINSPVIGGTINLHGVLHIQATKVGSDAVLSQIISLVETAQMSKAPIQKFADFVASIFVP 560
V G TIN GVL I+AT+VG + +L+QI+ LVE A SK PIQ+ AD V + F+P
Sbjct: 271 SKGDEVFGATINNTGVLKIRATRVGGETLLAQIVKLVEDAMGSKPPIQRLADKVVAYFIP 330
Query: 561 IVVTLALFTWLCWYVAGVLGAYPEQWLPENGTHFVFALMFSISVVVIACPCALGLATPTA 620
V+ +A+ ++ WY +FA I+V+V+ACPCA GLATPTA
Sbjct: 331 TVLLVAISAFIYWYFIA-------------HAPLLFAFTTLIAVLVVACPCAFGLATPTA 377
Query: 621 VMVATGVGANNGVLIKGGDALERAQKIKYVIFDKTGTLTQGRATVTTAKVFTKMDRGEFL 680
+ V G GA G+LIK DALE A+K+ VIFDKTGTLT+G+ VT D E L
Sbjct: 378 LTVGMGKGAELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLN-GDERELL 436
Query: 681 TLVASAEASSEHPLAKAVVEYARHFHFFDDPSLNPDGQSHSKESTGSGWLLDVSDFSALP 740
L A AE SEHP+A+A+V+ A E L + +
Sbjct: 437 RLAAIAERRSEHPIAEAIVKKA-------------------LEHGIE--LGEPEKVEVIA 475
Query: 741 GRGIQCFISGKQVLVGNRKLLNESGITIPDHVESFVVELEESARTGILVAYDDNLIGVMG 800
G G+ +LVGN++L+ + G+ + + VE + +LE A+T ++VA + + G++
Sbjct: 476 GEGVV----ADGILVGNKRLMEDFGVAVSNEVELALEKLEREAKTAVIVARNGRVEGIIA 531
Query: 801 IADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTAHAVAREIGIQDVMADVMPAGKADAVR 860
++D +K A V+ L +MG++ M+TGDNWR+A A++RE+ + V+A+V+P K++ V+
Sbjct: 532 VSDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQKSEEVK 591
Query: 861 SFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRNSLEDVIIAIDL 920
Q +VA VGDGIND+PALA AD+G+A+G+G+D+A+E+ D VL+R+ L DV+ AI L
Sbjct: 592 KLQAKE-VVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIRDDLRDVVAAIQL 650
Query: 921 SRKTFARIRLNYIFAMAYNVIAIPIAAGVFFPSLGIKLPPWAAGACMALSSVSVVCSSLL 980
SRKT ++I+ N +A+ YNVI IP AAG+ +P G+ P AG MA+SSVSVV +SLL
Sbjct: 651 SRKTMSKIKQNIFWALIYNVILIPAAAGLLYPIFGVVFRPEFAGLAMAMSSVSVVANSLL 710
Query: 981 LRRYKKP 987
LR Y P
Sbjct: 711 LRNYVPP 717
|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F Length = 113 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A Length = 165 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* Length = 185 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Length = 156 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Length = 188 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Length = 189 | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} Length = 191 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Length = 195 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Length = 180 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Length = 162 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Length = 164 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Length = 225 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Length = 176 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 998 | |||
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 100.0 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 100.0 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 100.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 100.0 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 100.0 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 100.0 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 100.0 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 100.0 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 100.0 | |
| 2hc8_A | 113 | PACS, cation-transporting ATPase, P-type; copper, | 99.94 | |
| 2kij_A | 124 | Copper-transporting ATPase 1; actuator, menkes dis | 99.93 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.83 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.81 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.8 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.77 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.76 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.71 | |
| 2kmv_A | 185 | Copper-transporting ATPase 1; menkes, nucleotide b | 99.68 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 99.67 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.66 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.6 | |
| 2arf_A | 165 | Wilson disease ATPase; P-type ATPase,ATP7B, copper | 99.56 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.38 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.38 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.34 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.29 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.29 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.24 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.24 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.22 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.14 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.13 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.11 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.1 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.08 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.07 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.06 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.03 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.01 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.0 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.98 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 98.95 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.95 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.93 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.93 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.92 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.92 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 98.92 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.91 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.91 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.91 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.91 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.9 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.9 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.9 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.9 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.89 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.89 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.89 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.89 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.88 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.87 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 98.87 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.87 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.87 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.87 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.87 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 98.86 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.86 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.86 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.85 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.85 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.85 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.83 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.83 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.83 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.82 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.82 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 98.82 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.82 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.81 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.81 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.8 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.79 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.78 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.78 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.78 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.78 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.78 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.78 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.78 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.75 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.72 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.72 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.72 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.71 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.71 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.7 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.69 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.68 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.67 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.66 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.66 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.65 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 98.63 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.63 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.61 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 98.61 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 98.61 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.6 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.58 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.56 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 98.54 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 98.53 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.51 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.51 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 98.49 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.48 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.47 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.45 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.43 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.4 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 98.39 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.38 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 98.34 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.31 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.3 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 98.3 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.26 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.26 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.25 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.24 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.24 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 98.24 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.23 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.23 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.21 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.21 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.2 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.2 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.2 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.19 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.19 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 98.19 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.18 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.17 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.16 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.14 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.14 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 98.13 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.12 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 98.12 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.11 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.11 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.1 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.08 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.08 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.07 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.07 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.06 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.06 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.06 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 98.03 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.03 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.03 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 98.02 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 98.01 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 97.98 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 97.97 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.95 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 97.94 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 97.92 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.91 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 97.86 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 97.83 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.82 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.79 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.79 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 97.78 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.75 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.75 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 97.74 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.71 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 97.7 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 97.62 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 97.6 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.6 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.6 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.59 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 97.56 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 97.56 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.51 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 97.49 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.48 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.36 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.35 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.32 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 97.32 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 97.31 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.24 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.16 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.1 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 96.98 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.89 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 96.86 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 96.76 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 96.75 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 96.64 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 96.51 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.42 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.37 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 96.22 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 96.09 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 96.04 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 95.99 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 95.87 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 95.84 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 95.84 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 95.5 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 95.15 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 94.63 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 94.63 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 93.84 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 93.7 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 93.09 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 93.06 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 93.02 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 91.55 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 91.17 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 90.88 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 88.57 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 88.34 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 88.3 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 88.03 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 87.49 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 83.87 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 81.58 |
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.9e-119 Score=1087.66 Aligned_cols=656 Identities=40% Similarity=0.621 Sum_probs=606.6
Q ss_pred cchHHHHHHHHHHHHHHHhHHHHHHHHhhcCchhhHHHHhhhccCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHcC
Q 001896 282 RDSEETSNMFRLFISSLFLSIPVFFIRVICPHIPLVYALLLWRCGPFLMGDWLNWALVSVVQFVIGKRFYTAAGRALRNG 361 (998)
Q Consensus 282 ~~~~~~~~~~~~~~~al~l~l~v~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~g~~~~~~~~~~l~~~ 361 (998)
.+.++.+.+++++++++++++|+++++|....++. .-.+++..|+.++|++|+++|+|||||++||++|+++
T Consensus 73 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~l~~~v~~~~g~~f~~~a~~~l~~~ 144 (736)
T 3rfu_A 73 VVSPEYLDMRRRFWIALMLTIPVVILEMGGHGLKH--------FISGNGSSWIQLLLATPVVLWGGWPFFKRGWQSLKTG 144 (736)
T ss_dssp -CCHHHHHHHHHHHHHHHHHHHHHHHHHSCCCTTS--------SCSTTHHHHHHHHHHHHHHHTTTHHHHHHHHHHHTTS
T ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh--------hccccHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhc
Confidence 45567888999999999999999988775322110 0123567899999999999999999999999999999
Q ss_pred CCChhHHHHHHHHHHHHHHHHHHHHhhhcC-------CCCCchhhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhcCC
Q 001896 362 STNMDVLVALGTSAAYFYSVGALLYGVVTG-------FWSPTYFETSAMLITFVLFGKYLEILAKGKTSDAIKKLVELAP 434 (998)
Q Consensus 362 ~~~md~Li~l~~~~a~~~s~~~~~~~~~~~-------~~~~~~~~~~~~l~~~~~~~~~~e~~~~~k~~~~l~~l~~~~~ 434 (998)
++|||+|+++++.+||+||++.++.....+ .....||++++++++++++|+++|.++++|+++.+++|.++.|
T Consensus 145 ~~~md~Lv~l~~~~a~~~S~~~~~~~~~~~~~~~~~~~~~~~yfe~a~~ii~~~llg~~le~~a~~~~~~ai~~L~~l~p 224 (736)
T 3rfu_A 145 QLNMFTLIAMGIGVAWIYSMVAVLWPGVFPHAFRSQEGVVAVYFEAAAVITTLVLLGQVLELKAREQTGSAIRALLKLVP 224 (736)
T ss_dssp CCCHHHHHHHHHHHHHHHHHHHHHCGGGSCSSSSCSSSCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCSSHHHHHTCCCC
T ss_pred CCChHHHHHHHHHHHHHHHHHHHhcccccccccccccCccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence 999999999999999999999988532221 1235799999999999999999999999999999999999999
Q ss_pred CeEEEEEecCCCcceeEEEEeCCCCCCCCEEEEcCCCcccccEEEEecceeeecccccCcCcccccCCCCceecceeeee
Q 001896 435 ATALLVVKDKVGKCIEEREIDALLIQSGDTLKVLPGTKLPADGIVVWGTSYVNESMVTGEAVPVLKEINSPVIGGTINLH 514 (998)
Q Consensus 435 ~~~~v~~~~r~g~~~~~~~i~~~~l~~GDii~v~~G~~iPaDg~vl~G~~~Vdes~LTGEs~pv~k~~g~~v~aGt~~~~ 514 (998)
++++++. +|| ++++|++++|+|||+|+|++||+|||||+|++|++.||||+|||||.|+.|++|+.|++||++.+
T Consensus 225 ~~a~vv~--~dg---~~~~v~~~~l~~GDiv~v~~Ge~IPaDg~vl~G~~~VDES~LTGES~Pv~K~~gd~v~~Gt~~~~ 299 (736)
T 3rfu_A 225 ESAHRIK--EDG---SEEEVSLDNVAVGDLLRVRPGEKIPVDGEVQEGRSFVDESMVTGEPIPVAKEASAKVIGATINQT 299 (736)
T ss_dssp CEEEEEE--TTE---EEEEEETTTCCTTCEECCCSSEECCSCEEECSSCEEEECSSSTTCSSCEEECTTCEECTTCEEES
T ss_pred CEEEEEe--cCC---EEEEEEHhhCCCCCEEEECCCCcccccEEEEECceEeeecccCCccccEEeccCCcCCCceEecc
Confidence 9999883 377 68999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceEEEEEEEecChhHHHHHHHHHHHhhccCChHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhcCCCCCcccCCCCccH
Q 001896 515 GVLHIQATKVGSDAVLSQIISLVETAQMSKAPIQKFADFVASIFVPIVVTLALFTWLCWYVAGVLGAYPEQWLPENGTHF 594 (998)
Q Consensus 515 g~~~~~v~~~g~~t~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~ 594 (998)
|.++++|+++|.+|.+++|.+++++++.+|+|+|+.+|+++.+|+|+++++++++|++|++.+. ...|
T Consensus 300 G~~~~~v~~~G~~T~l~~I~~lv~~a~~~k~~~q~~~d~~a~~~v~~vl~ia~~~~~~w~~~~~------------~~~~ 367 (736)
T 3rfu_A 300 GSFVMKALHVGSDTMLARIVQMVSDAQRSRAPIQRLADTVSGWFVPAVILVAVLSFIVWALLGP------------QPAL 367 (736)
T ss_dssp CCCCEEECCCSTTSHHHHHHHHHHHHHSSCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCS------------SSST
T ss_pred ceEEEEEEEechhhHHHHHHHHHHHhhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCC------------CchH
Confidence 9999999999999999999999999999999999999999999999999999999999987642 1135
Q ss_pred HHHHHHHhhhhhhhccccchhhHHHHHHHHHHHHHhcCcEEecchHHHhhcCCcEEEecCCCccccCceEEEEEEecCCC
Q 001896 595 VFALMFSISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGDALERAQKIKYVIFDKTGTLTQGRATVTTAKVFTKM 674 (998)
Q Consensus 595 ~~~~~~~isvlv~~~P~aL~la~p~~~~~~~~~~~k~gilvk~~~~le~lg~v~~i~fDKTGTLT~~~~~v~~i~~~~~~ 674 (998)
..++.+++++++++|||+|++++|+++..++.+++|+|+++|+++++|++|++|+||||||||||+|+|+|.++. .++.
T Consensus 368 ~~~l~~ai~vlviacPcaL~la~p~a~~~~~~~~a~~gilvk~~~alE~l~~v~~i~fDKTGTLT~g~~~v~~i~-~~~~ 446 (736)
T 3rfu_A 368 SYGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQSGVLIKNAEALERMEKVNTLVVDKTGTLTEGHPKLTRIV-TDDF 446 (736)
T ss_dssp THHHHHHHHHHHHHCCSTHHHHHHHHHHHHHHHHHHTTEEESCHHHHHHHTSCCEEEECCBTTTBCSSCEEEEEE-ESSS
T ss_pred HHHHHHHHHhHHHhhhhHHHHHHHHHHHHHHHHHhhcceeechHHHHHHhcCCCEEEEeCCCCCcCCceEEEEEE-ecCC
Confidence 678999999999999999999999999999999999999999999999999999999999999999999999998 6678
Q ss_pred CHHHHHHHHHHhhccCCChHHHHHHHHHHhcCCCCCCCCCCCCCCcccccCCCcccccccceeeecCCeEEEEEcCeEEE
Q 001896 675 DRGEFLTLVASAEASSEHPLAKAVVEYARHFHFFDDPSLNPDGQSHSKESTGSGWLLDVSDFSALPGRGIQCFISGKQVL 754 (998)
Q Consensus 675 ~~~~~l~~~~~~~~~~~hp~~~ai~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gi~~~~~g~~~~ 754 (998)
++++++.+++++|..++||+++|+++++++.+. ......+|++.+|+|+.+.++|+.+.
T Consensus 447 ~~~~~l~~aa~le~~s~hPla~Aiv~~a~~~~~---------------------~~~~~~~f~~~~g~gv~~~~~g~~~~ 505 (736)
T 3rfu_A 447 VEDNALALAAALEHQSEHPLANAIVHAAKEKGL---------------------SLGSVEAFEAPTGKGVVGQVDGHHVA 505 (736)
T ss_dssp CHHHHHHHHHHHHHSSCCHHHHHHHHHHHTTCC---------------------CCCCCSCCCCCTTTEEEECSSSSCEE
T ss_pred CHHHHHHHHHHHhhcCCChHHHHHHHHHHhcCC---------------------CccCcccccccCCceEEEEECCEEEE
Confidence 899999999999999999999999999987631 12345678889999999999999999
Q ss_pred EeeHhhhhhcCCCCChhhHHHHHHHHHcCCeEEEEEECCeEEEEEEecCCCcHhHHHHHHHHHhCCCEEEEEcCCCHHHH
Q 001896 755 VGNRKLLNESGITIPDHVESFVVELEESARTGILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTA 834 (998)
Q Consensus 755 ~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~i~va~~~~~lG~i~l~d~~r~~~~~~i~~l~~~gi~~~i~tgd~~~~a 834 (998)
+|+++++.+.+.+.+ ...+..+++..+|++++++++|++++|+++++|++|++++++|++||++|++++|+|||+..++
T Consensus 506 ~G~~~~~~~~~~~~~-~~~~~~~~~~~~G~~vl~va~d~~~~G~i~i~D~i~~~~~~aI~~L~~~Gi~v~mlTGd~~~~a 584 (736)
T 3rfu_A 506 IGNARLMQEHGGDNA-PLFEKADELRGKGASVMFMAVDGKTVALLVVEDPIKSSTPETILELQQSGIEIVMLTGDSKRTA 584 (736)
T ss_dssp EESHHHHHHHCCCCH-HHHHHHHHHHHTTCEEEEEEETTEEEEEEEEECCBCSSHHHHHHHHHHHTCEEEEECSSCHHHH
T ss_pred EcCHHHHHHcCCChh-HHHHHHHHHHhcCCeEEEEEECCEEEEEEEeeccchhhHHHHHHHHHHCCCeEEEECCCCHHHH
Confidence 999999998887643 3556677889999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhCcceEEEecCcccHHHHHHHHhhcCCEEEEEcCCCCCHHHHhcCCeEEEecCchHHHHHhcCEEEecCChhHH
Q 001896 835 HAVAREIGIQDVMADVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRNSLEDV 914 (998)
Q Consensus 835 ~~ia~~~gi~~~~~~~~p~~K~~~v~~l~~~g~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l 914 (998)
..+++++|+++++++++|++|.++|+.++++|+.|+|+|||.||+|||++||||||||++++.++++||+++++++++++
T Consensus 585 ~~ia~~lgi~~v~a~~~P~~K~~~v~~l~~~g~~V~~vGDG~ND~paL~~AdvGIAmg~g~d~a~~~AD~vl~~~~~~~i 664 (736)
T 3rfu_A 585 EAVAGTLGIKKVVAEIMPEDKSRIVSELKDKGLIVAMAGDGVNDAPALAKADIGIAMGTGTDVAIESAGVTLLHGDLRGI 664 (736)
T ss_dssp HHHHHHHTCCCEECSCCHHHHHHHHHHHHHHSCCEEEEECSSTTHHHHHHSSEEEEESSSCSHHHHHCSEEECSCCSTTH
T ss_pred HHHHHHcCCCEEEEecCHHHHHHHHHHHHhcCCEEEEEECChHhHHHHHhCCEEEEeCCccHHHHHhCCEEEccCCHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccCCCCccHHHHHHHhhhhhHHHhhhcccccccC
Q 001896 915 IIAIDLSRKTFARIRLNYIFAMAYNVIAIPIAAGVFFPSLGIKLPPWAAGACMALSSVSVVCSSLLLRRYK 985 (998)
Q Consensus 915 ~~~i~~~r~~~~~i~~n~~~~~~~n~~~i~~a~g~~~~~~g~~l~p~~a~~~m~~ss~~v~~~s~~l~~~~ 985 (998)
++++++||+++++|+||+.|+++||++++|+|+|+++|++|+.|+|++|+++|.+||++|++|||||++++
T Consensus 665 ~~ai~~sr~t~~~i~qnl~~a~~yN~~~iplAag~l~p~~G~~l~P~~aa~~m~~Ssv~Vv~nslrl~~~~ 735 (736)
T 3rfu_A 665 AKARRLSESTMSNIRQNLFFAFIYNVLGVPLAAGVLYPLTGLLLSPMIAAAAMALSSVSVIINALRLKRVT 735 (736)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSTTTSSCCCCHHHHHHHHHHHHHHHHHHHHTCCCTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhhHHHHHHHHHhhHHHHHHHHHHhcccC
Confidence 99999999999999999999999999999999999999999989999999999999999999999998764
|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F | Back alignment and structure |
|---|
| >2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 998 | ||||
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 8e-30 | |
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 4e-28 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 4e-21 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-18 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-04 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 2e-20 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 3e-18 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 4e-20 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 3e-19 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 5e-20 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 7e-19 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 0.004 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 8e-20 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 2e-18 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 3e-19 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 1e-18 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 5e-19 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-16 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 1e-18 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 1e-17 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 0.002 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 1e-18 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-18 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.004 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 8e-17 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 1e-16 | |
| d2a29a1 | 136 | d.220.1.1 (A:316-451) Potassium-transporting ATPas | 2e-16 | |
| d2b8ea2 | 113 | d.220.1.1 (A:435-547) Cation-transporting ATPase { | 2e-16 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 5e-13 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 1e-11 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 1e-12 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 3e-12 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-11 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 8e-11 | |
| d2feaa1 | 226 | c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio | 2e-11 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-11 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 3e-10 | |
| d1rkua_ | 206 | c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona | 3e-11 | |
| d2b30a1 | 283 | c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod | 4e-10 | |
| d1k1ea_ | 177 | c.108.1.5 (A:) Probable phosphatase YrbI {Haemophi | 8e-09 | |
| d1j97a_ | 210 | c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon | 9e-08 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 2e-07 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 2e-07 | |
| d1nrwa_ | 285 | c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu | 4e-07 | |
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 5e-07 | |
| d1nnla_ | 217 | c.108.1.4 (A:) Phosphoserine phosphatase {Human (H | 2e-06 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 3e-06 | |
| d2rbka1 | 260 | c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B | 4e-06 | |
| d1nf2a_ | 267 | c.108.1.10 (A:) Hypothetical protein TM0651 {Therm | 4e-06 | |
| d1wpga1 | 115 | b.82.7.1 (A:125-239) Calcium ATPase, transduction | 6e-06 | |
| d1rlma_ | 269 | c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc | 1e-04 |
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Cation-transporting ATPase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 112 bits (282), Expect = 8e-30
Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 1/130 (0%)
Query: 789 VAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTAHAVAREIGIQDVMA 848
V +D G D +K A V+ L +MG++ M+TGDNWR+A A++RE+ + V+A
Sbjct: 6 VIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIA 65
Query: 849 DVMPAGKADAVRSFQKDGSIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMR 908
+V+P K++ V+ Q +VA VGDGIND+PALA AD+G+A+G+G+D+A+E+ D VL+R
Sbjct: 66 EVLPHQKSEEVKKLQA-KEVVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIR 124
Query: 909 NSLEDVIIAI 918
+ L DV+ AI
Sbjct: 125 DDLRDVVAAI 134
|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} Length = 136 | Back information, alignment and structure |
|---|
| >d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Length = 177 | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 | Back information, alignment and structure |
|---|
| >d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 115 | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 998 | |||
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.94 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 99.94 | |
| d1wpga1 | 115 | Calcium ATPase, transduction domain A {Rabbit (Ory | 99.86 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.62 | |
| d2b8ea2 | 113 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.47 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.43 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.43 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.42 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.42 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.41 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.4 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.4 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.4 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.4 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.39 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.38 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.38 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.38 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.38 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.38 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.36 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.36 | |
| d2a29a1 | 136 | Potassium-transporting ATPase B chain, KdpB {Esche | 99.34 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.33 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.24 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.22 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.22 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.17 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.15 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.15 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 99.14 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.1 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.09 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.08 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.03 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.02 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.02 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.01 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.0 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 98.99 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.98 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.91 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 98.87 | |
| d1wpga4 | 472 | Calcium ATPase, transmembrane domain M {Rabbit (Or | 98.83 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.82 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.79 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 98.78 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.75 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.72 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 98.51 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.41 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.2 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.06 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.02 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.0 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.0 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.95 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 97.83 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.67 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 97.6 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.58 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.58 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.45 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.16 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 97.16 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.11 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.02 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 97.02 | |
| d1q3ia_ | 214 | Sodium/potassium-transporting ATPase alpha chain { | 96.56 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 96.45 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 96.35 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 96.17 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 96.11 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 96.08 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 96.01 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 95.98 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 95.95 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 95.66 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 95.55 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 95.33 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 95.01 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 94.65 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 94.38 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 94.33 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 92.25 |
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Cation-transporting ATPase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.94 E-value=9.2e-28 Score=224.73 Aligned_cols=132 Identities=45% Similarity=0.775 Sum_probs=116.8
Q ss_pred EEEEECCeEEEEEEecCCCcHhHHHHHHHHHhCCCEEEEEcCCCHHHHHHHHHHhCcceEEEecCcccHHHHHHHHhhcC
Q 001896 787 ILVAYDDNLIGVMGIADPVKREAAVVVEGLLKMGVRPVMVTGDNWRTAHAVAREIGIQDVMADVMPAGKADAVRSFQKDG 866 (998)
Q Consensus 787 i~va~~~~~lG~i~l~d~~r~~~~~~i~~l~~~gi~~~i~tgd~~~~a~~ia~~~gi~~~~~~~~p~~K~~~v~~l~~~g 866 (998)
..+..|++..+.++++|++|++++++|+.||++|++++|+|||+..++.++|+++||+++|++++|++|..+++.+|+.
T Consensus 4 ~~~~~d~~~~~~~g~~D~lr~~a~~~I~~L~~~Gi~v~ilTGD~~~~a~~ia~~lgI~~v~~~~~p~~k~~~v~~~q~~- 82 (135)
T d2b8ea1 4 TAVIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQKSEEVKKLQAK- 82 (135)
T ss_dssp CEEEEECCCCCBCSCCCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHHTCSEEECSCCHHHHHHHHHHHTTT-
T ss_pred EEEEECCceEEEEecCCCCCccHHHHHHHHHHcCCEEEEEcCcchhhhhHHHhhhhhhhhccccchhHHHHHHHHHHcC-
Confidence 3566677777789999999999999999999999999999999999999999999999999999999999999999875
Q ss_pred CEEEEEcCCCCCHHHHhcCCeEEEecCchHHHHHhcCEEEecCChhHHHHHHH
Q 001896 867 SIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRNSLEDVIIAID 919 (998)
Q Consensus 867 ~~v~~vGDg~nD~~al~~A~vgia~~~~~~~~~~~ad~vl~~~~~~~l~~~i~ 919 (998)
+.|+|+|||.||+|||++|||||+|+++++.++++||+++++++|+.++.+|+
T Consensus 83 ~~v~~vGDg~nD~~aL~~Advgia~~~~~~~~~~aADivl~~~~l~~i~~aI~ 135 (135)
T d2b8ea1 83 EVVAFVGDGINDAPALAQADLGIAVGSGSDVAVESGDIVLIRDDLRDVVAAIQ 135 (135)
T ss_dssp SCEEEEECSSSSHHHHHHSSEEEEECCC--------SEEESSCCTHHHHHHHC
T ss_pred CEEEEEeCCCCcHHHHHhCCeeeecCccCHHHHHhCCEEEECCCHHHHHHHhC
Confidence 57999999999999999999999999999999999999999999999998874
|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|