Citrus Sinensis ID: 001918

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------
MDIGEDSLRFGSVPVTTSRNMSSSSSVFLSANQSPFFSPRSPTCQLSESARSDARCDGIHLSADPLSSSSGIPEPESIANVRFTTSDISAAAAACTASDFQKFGRVSSPAGVSNSNISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWSKSASLEERRKERQWEGGSRKGKEPVVWKESEKEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTSP
ccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHccccHHcHHHHHccccHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHcccccccEEccccccHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHccccccHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHccccccccccEEEEEccccccccccccEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccc
ccccccccccccccccccccccccccHEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHccEEEEEEEcHHccccccHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccHHHHHcccccccccccEEcccccccccccccccccccccccccccEEEccccccccHcccccccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHcccccccccHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHccccccccEEEEEEccccccccccEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHccccccccEEEcHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEccc
mdigedslrfgsvpvttsrnmsssssvflsanqspffsprsptcqlsesarsdarcdgihlsadplssssgipepesianvrfttSDISAAAAACTasdfqkfgrvsspagvsnsnisSYSLAHDNGYAGLRENHRkhgrsygmsytpVSVSLSCNRLRSCDVfiglhgckpSLMRFANWLRAELEVQGMscfvsdrarcrnSRKHAIVERAMDISSFGVVILTRksfrnpysiEELRYfsgkknlvpiffdlspgdclvRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLsrvdewkleaqegncrDCILRAVTLLAMKLGRRSVVERLTKWREkvdkeefpfprnenfigrkkelSELEFILFgditgdserDYFELKARTRRKNlrigwsksaSLEERRKERqweggsrkgkepvvwkESEKEIEMqsteapqrqktkssgryprrkrstkilygkgiacvtgdsgigkTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDvdvgiencsdksriKSFEEQEEAAICRVRKELMRNIPFLVIIDNLesekdwwddklvmdllprfggethiiistrlprvmnleplklsyLSGVEAMSLmqgsvkdypitEVDALRVIEEKVGRLTMGLAVVGAILselpinpsrlldtinrmplrdlswngreshslrRNTFLFQLFEVCFSifdhadgprSLATRMVLAggwfapaaiPVSLLALAAhkipekhkgtHLWRKLLLSLtcgftssytkrSEAEASSMLLRFNIARsstrqgyiHFNDLVKLYARKRGVTGVAHAMVQAVISrgsithhsghIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLdkslcwrpvqtnaqlnPSLWQELALTRATVLETRAKLMLrggqfdmgddLIRKAVFIRtsisgedhpdtIAARETLSKLTRLLANVQIHTSP
mdigedslrfgsvpvttsrnmsSSSSVFLSANQSPFFSPRSPTCQLSESARSDARCDGIHLSadplssssgipEPESIANVRFTTSDISAAAAACTASDFQKFGRVSSPAGVSNSNISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAiveramdissfgvVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLeaqegncrdCILRAVTLlamklgrrsvverltkwrekvdkeefpfprnenfigrkkelseLEFILFgditgdserDYFELKartrrknlrigwsksasleerrkerqweggsrkgkepvvwkesekeiemqsteapqrqktkssgryprrkrstkilygkgiacvtgdsgiGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIistrlprvmnlEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAIlselpinpsrlldTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLrggqfdmgddLIRKAVFIRtsisgedhpdtiAARETLSKLTRLLAnvqihtsp
MDIGEDSLRFGSVPVTTsrnmsssssvflsanqsPFFSPRSPTCQLSESARSDARCDGIHLSADPLssssgipepesiANVRFttsdisaaaaactasDFQKFGRVSSPAGVSNSNISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWSKSASLEERRKERQWEGGSRKGKEPVVWKESEKEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDlkvvelkvsellylvkevvlPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTSP
**********************************************************************************FTT*DISAAAAACTASDF***************************Y************SYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTR**NLRIG**************************************************************KILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTK*******SMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISG******IAARETLSKLTRLLAN*******
******************************ANQSPFFS*************************************************************************************************************************SCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRA**RNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDS******************************************************************KTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRD**********LRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIP***K**HLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLL**V******
MDIGEDSLRFGSVPV***************ANQSP******************ARCDGIHLSADPLSSSSGIPEPESIANVRFTTSDISAAAAACTASDFQKFGRVSSPAGVSNSNISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWSKSA****************************************************RKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTSP
*****************************SANQSPFFSP********************************************TTSDISAAAAACTASDFQKFGRVSSPAGVSNSNISSYSLAH****************SYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRR*******************************PVVWKESEKEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIGEDSLRFGSVPVTTSRNMSSSSSVFLSANQSPFFSPRSPTCQLSESARSDARCDGIHLSADPLSSSSGIPEPESIANVRFTTSDISAAAAACTASDFQKFGRVSSPAGVSNSNISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWSKSASLEERRKERQWEGGSRKGKEPVVWKESEKEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query996
2254690451009 PREDICTED: uncharacterized protein LOC10 1.0 0.987 0.810 0.0
1477746921011 hypothetical protein VITISV_005477 [Viti 1.0 0.985 0.809 0.0
255537517999 nucleoside-triphosphatase, putative [Ric 1.0 0.996 0.799 0.0
2240719471005 tir-nbs resistance protein [Populus tric 0.995 0.987 0.820 0.0
2977356621001 unnamed protein product [Vitis vinifera] 0.939 0.935 0.775 0.0
449452298999 PREDICTED: uncharacterized protein LOC10 1.0 0.996 0.758 0.0
449524014999 PREDICTED: LOW QUALITY PROTEIN: uncharac 1.0 0.996 0.758 0.0
356495691999 PREDICTED: uncharacterized protein LOC10 0.998 0.995 0.736 0.0
356539674999 PREDICTED: uncharacterized protein LOC10 0.998 0.995 0.738 0.0
356527642996 PREDICTED: uncharacterized protein LOC10 0.994 0.994 0.722 0.0
>gi|225469045|ref|XP_002267070.1| PREDICTED: uncharacterized protein LOC100245966 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1684 bits (4362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 818/1009 (81%), Positives = 904/1009 (89%), Gaps = 13/1009 (1%)

Query: 1    MDIGEDSLRFGSVPVTTSRNMSSSSSVFLSANQSPFFSPRSPTCQLSESARSDARCDGIH 60
            MD+GE+S RF S+P TTSRN+SSSSS F SANQSPFFSPRSPTCQLSES  SD  CD I 
Sbjct: 1    MDLGEESSRFLSLPATTSRNLSSSSSTFFSANQSPFFSPRSPTCQLSESTLSDIPCDNIQ 60

Query: 61   LSADPLS---------SSSGIPEPESIANVRFTTSDISAAAAACTASDFQKFGRVSSPAG 111
            LSADPLS         SSSG P+P+S+ NVRFT S++S    +  +SDFQKF RVS   G
Sbjct: 61   LSADPLSTVLSADPLSSSSGNPDPQSLKNVRFTLSNMSIIPGSHVSSDFQKFNRVSPSTG 120

Query: 112  VSNSN-ISSYSLAHDNGYAGLRENHRKHGRSYGMSYTPVSVSLSCNRLRSCDVFIGLHGC 170
            +SNS  +S++S  H NGY+   E  +K GRS+G+S+ P S S S NRLRSCDVFIGLHG 
Sbjct: 121  ISNSTTMSNHSHGHGNGYSQHTEKQKKLGRSHGISFAPTSASFSSNRLRSCDVFIGLHGR 180

Query: 171  KPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRN 230
            KP L+RFANWLRAELEVQGMSCFVSDRARCRNSRKH IVERAMD+S+FGVVILTRKSFRN
Sbjct: 181  KPPLLRFANWLRAELEVQGMSCFVSDRARCRNSRKHGIVERAMDVSTFGVVILTRKSFRN 240

Query: 231  PYSIEELRYFSGKKNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWK 290
            PY+IEELR+FSGKKNLVP+FFDL P DCLVRDIVEKRGE+WEK+GGELW+LYGGLE EWK
Sbjct: 241  PYTIEELRFFSGKKNLVPLFFDLGPDDCLVRDIVEKRGEMWEKHGGELWLLYGGLENEWK 300

Query: 291  EAVNGLSRVDEWKLEAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFP 350
            EAVNGLSRVD+WKLEAQ+G  RDCILRAVTLLA++LGRRSVVERLTKWREK +KEEFPFP
Sbjct: 301  EAVNGLSRVDDWKLEAQDGKWRDCILRAVTLLAIRLGRRSVVERLTKWREKAEKEEFPFP 360

Query: 351  RNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWSKSASLEERRKER 410
            RNENFIGRKKELSELEFILFGD++G+SE+DYFELKAR RRKNL IGWSK +S+EERR+E+
Sbjct: 361  RNENFIGRKKELSELEFILFGDVSGESEKDYFELKARPRRKNLTIGWSKGSSVEERRREQ 420

Query: 411  QWEGGSRKGKEPVVWKESEKEIEMQSTEAPQRQ---KTKSSGRYPRRKRSTKILYGKGIA 467
              E G RKGK+ VVWKESEKEIEMQS+E PQRQ   ++K+ G+Y R +RS KILYGKGIA
Sbjct: 421  HMESGHRKGKQAVVWKESEKEIEMQSSELPQRQYSLRSKNGGKYGRSRRSAKILYGKGIA 480

Query: 468  CVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSD 527
            CV+G+SGIGKT+LLLEFAYRYHQRYKMVLWVGG SRYIRQNYLNLWSFL+VDVGIENCS+
Sbjct: 481  CVSGESGIGKTDLLLEFAYRYHQRYKMVLWVGGGSRYIRQNYLNLWSFLEVDVGIENCSE 540

Query: 528  KSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHI 587
            KSRIKSFEE EEAAI RVRKELMRNIPFLV++DNLESEKDWWD KL+MDLLPRFGG+TH 
Sbjct: 541  KSRIKSFEEHEEAAISRVRKELMRNIPFLVVLDNLESEKDWWDQKLIMDLLPRFGGDTHF 600

Query: 588  IISTRLPRVMNLEPLKLSYLSGVEAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAV 647
            IISTRLPR+MNLEPLKLSYLSGVEAMSLMQGSVKDYPI E+DALRVIEEK+GRLT+GLA+
Sbjct: 601  IISTRLPRIMNLEPLKLSYLSGVEAMSLMQGSVKDYPIVEIDALRVIEEKLGRLTLGLAI 660

Query: 648  VGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGP 707
            VGAILSELPINPSRLLDTINRMPLRDL+W+GRE H LRRNTFLFQLFEVCFSIFDHADGP
Sbjct: 661  VGAILSELPINPSRLLDTINRMPLRDLTWSGREGHLLRRNTFLFQLFEVCFSIFDHADGP 720

Query: 708  RSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRS 767
            RSLATRMV   GWFAP+AIP+ LLALAA+K+PEKH+GT LW+K L SLTCG TSSYTKRS
Sbjct: 721  RSLATRMVQVSGWFAPSAIPIFLLALAANKVPEKHQGTRLWKKFLHSLTCGLTSSYTKRS 780

Query: 768  EAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSG 827
            EAEASSMLLRFNIARSST+QGY+HFN+L+KLYA K+GVTGVA AMVQAVI RGSI+ HS 
Sbjct: 781  EAEASSMLLRFNIARSSTKQGYLHFNELIKLYALKKGVTGVAQAMVQAVIGRGSISQHSE 840

Query: 828  HIWTACFLLFGFGNDLKVVELKVSELLYLVKEVVLPVAIRTFITFSRCSAALELLRLCTN 887
            H+W ACFLLFGFGND  VVELKVSELL+LVKEVVLP+AIRTFITFSRCSAALELLRLCTN
Sbjct: 841  HLWAACFLLFGFGNDPIVVELKVSELLFLVKEVVLPLAIRTFITFSRCSAALELLRLCTN 900

Query: 888  ALEAADHALVTPVEKLLDKSLCWRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQ 947
            ALEAAD A VTPVEK LD SLCW+P+QTNAQLNP LWQELAL+RATVLETRAKLMLRGGQ
Sbjct: 901  ALEAADQAFVTPVEKWLDSSLCWKPIQTNAQLNPCLWQELALSRATVLETRAKLMLRGGQ 960

Query: 948  FDMGDDLIRKAVFIRTSISGEDHPDTIAARETLSKLTRLLANVQIHTSP 996
            FD+ DDLIRKAVFIRTSI G+DHPDTI+ARETLSKLTRLLANVQIHTSP
Sbjct: 961  FDIADDLIRKAVFIRTSICGDDHPDTISARETLSKLTRLLANVQIHTSP 1009

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147774692|emb|CAN74345.1| hypothetical protein VITISV_005477 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537517|ref|XP_002509825.1| nucleoside-triphosphatase, putative [Ricinus communis] gi|223549724|gb|EEF51212.1| nucleoside-triphosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224071947|ref|XP_002303599.1| tir-nbs resistance protein [Populus trichocarpa] gi|222841031|gb|EEE78578.1| tir-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735662|emb|CBI18349.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452298|ref|XP_004143896.1| PREDICTED: uncharacterized protein LOC101216244 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524014|ref|XP_004169018.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228162 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356495691|ref|XP_003516707.1| PREDICTED: uncharacterized protein LOC100778407 [Glycine max] Back     alignment and taxonomy information
>gi|356539674|ref|XP_003538320.1| PREDICTED: uncharacterized protein LOC100808415 [Glycine max] Back     alignment and taxonomy information
>gi|356527642|ref|XP_003532417.1| PREDICTED: uncharacterized protein LOC100815488 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query996
TAIR|locus:2117899964 AT4G23440 [Arabidopsis thalian 0.853 0.881 0.747 0.0
TAIR|locus:2156445973 AT5G56220 [Arabidopsis thalian 0.689 0.706 0.400 1.8e-157
UNIPROTKB|G5EHR0 1042 MGCH7_ch7g754 "Uncharacterized 0.186 0.178 0.238 2.8e-05
TAIR|locus:2117899 AT4G23440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3353 (1185.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 650/869 (74%), Positives = 748/869 (86%)

Query:   137 KHGRSY-GMSYTPVS-VSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFV 194
             ++GR +   SYT  S VS+S NRLR CDVFIGL+G KPSL+RFA+WLRAELE QGMSCF+
Sbjct:   106 RYGRGHESSSYTQTSSVSVSYNRLRCCDVFIGLYGQKPSLLRFADWLRAELEFQGMSCFM 165

Query:   195 SDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIEELRYFSGKKNLVPIFFDLS 254
             SDR RCR+SRK  IVERAMD +SFGV+ILTRK+F+NPY+IEELR+F+ KKNLVP+FFDLS
Sbjct:   166 SDRGRCRSSRKQRIVERAMDGASFGVIILTRKAFKNPYTIEELRFFANKKNLVPVFFDLS 225

Query:   255 PGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKLEAQEGNCRDC 314
             PG+CLVRDIVEKRG+LWEK+GGELWVLYGG+EKEWKEAV+GLSRVD+WKLEA EGN RDC
Sbjct:   226 PGECLVRDIVEKRGDLWEKHGGELWVLYGGIEKEWKEAVHGLSRVDDWKLEAHEGNWRDC 285

Query:   315 ILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDIT 374
             + RAVTLLAM+LGRRS+VERLTKWR+K +KEEFP+PRNE+F+GRKKELSELEF+LFGD+ 
Sbjct:   286 VFRAVTLLAMRLGRRSIVERLTKWRDKAEKEEFPYPRNESFVGRKKELSELEFVLFGDVA 345

Query:   375 GDSERDYFELKAR-TRRK-NLRIGWSKSASLEERRKERQWEGGSRKGKEPVVWKESEKEI 432
             GDSERDYFELKAR TRRK N+ +GW+KS S EERRK         KGKE VVWKESEKEI
Sbjct:   346 GDSERDYFELKARPTRRKKNVTLGWNKSGSAEERRK---------KGKEKVVWKESEKEI 396

Query:   433 EMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYRYHQRY 492
             EMQSTE P R + K  GR  RRKRS K++YGKG+ACV+G+SGIGKTELLLEFAYR+HQRY
Sbjct:   397 EMQSTEMPSRSQVKV-GRNTRRKRSMKVVYGKGVACVSGESGIGKTELLLEFAYRHHQRY 455

Query:   493 KMVLWVGGESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRN 552
             KMVLW+GGESRYIRQNYLNL+ +L+VD+GIEN SDK+R+KSFEEQE+AA+ ++RKELMRN
Sbjct:   456 KMVLWIGGESRYIRQNYLNLYQYLEVDIGIENSSDKTRMKSFEEQEDAAVSKIRKELMRN 515

Query:   553 IPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMNLEPLKLSYLSGVEA 612
             IPFLV+IDNLESEKDWWD KLVMDLLPRFGG THI+ISTRL +VMN+EPLKLSYLSG EA
Sbjct:   516 IPFLVVIDNLESEKDWWDSKLVMDLLPRFGGGTHILISTRLSQVMNMEPLKLSYLSGAEA 575

Query:   613 MSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLR 672
             MSLMQG+VKDYP++E+DALR IE+K+GRLT+GLAVVGAILSELPINPSRLLDTINRMPLR
Sbjct:   576 MSLMQGNVKDYPVSEMDALRTIEDKLGRLTLGLAVVGAILSELPINPSRLLDTINRMPLR 635

Query:   673 DLSWNGRESHSLRRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLA 732
             ++  +GRE + LRRN FL QLFEVCFSIFDHADGPRSLATRMV+A GW APA +P SLLA
Sbjct:   636 EMVCSGREGNLLRRNAFLLQLFEVCFSIFDHADGPRSLATRMVVASGWLAPAPVPASLLA 695

Query:   733 LAAHKIPEKHKGT-HLWRKLLLSLTCGFTSSYTKRSEAEASSMLLRFNIAR-SSTRQGYI 790
             LAAHK+PEKH+G   LWR+L  ++TCGFTSS +KRS AEA+SMLLRFNIAR SS + G+I
Sbjct:   696 LAAHKLPEKHRGPKRLWRRLRRAITCGFTSSNSKRSGAEAASMLLRFNIARTSSIKLGFI 755

Query:   791 HFNDLVKLYARKRGVTGV-AHAMVQAVISRGSITHHSGHIWTACFLLFGFGNDXXXXXXX 849
               ++LVKLYAR R +    A AMVQAVISRGS    +  IW  CFLLFGF N+       
Sbjct:   756 QIHELVKLYARNRVLVNENAPAMVQAVISRGSTVETAEQIWAVCFLLFGFSNESPTIQLK 815

Query:   850 XXXXXXXXXXXXXPVAIRTFITFSRCSAALELLRLCTNALEAADHALVTPVEKLLDKSLC 909
                          P+AIRTFI+FSRC+A++ELLR+CTNALEAAD  LVTPVEK LDKSLC
Sbjct:   816 ITELLILVKQVILPLAIRTFISFSRCTASVELLRVCTNALEAADQTLVTPVEKWLDKSLC 875

Query:   910 WRPVQTNAQLNPSLWQELALTRATVLETRAKLMLRGGQFDMGDDLIRKAVFIRTSISGED 969
             WRPVQT+AQLNP LW+ELAL RATVLETRAKLMLRGGQF + DDLIRKA+FIRTSISGED
Sbjct:   876 WRPVQTSAQLNPILWEELALARATVLETRAKLMLRGGQFGLADDLIRKAIFIRTSISGED 935

Query:   970 HPDTIAARETLSKLTRLLANV-QIH-TSP 996
             HP T++ARETLSKLTRLL+NV QIH TSP
Sbjct:   936 HPGTVSARETLSKLTRLLSNVHQIHNTSP 964
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0007165 "signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0009630 "gravitropism" evidence=RCA
TAIR|locus:2156445 AT5G56220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G5EHR0 MGCH7_ch7g754 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00012890001
SubName- Full=Chromosome undetermined scaffold_411, whole genome shotgun sequence; (1009 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query996
pfam13676102 pfam13676, TIR_2, TIR domain 4e-05
cd01121372 cd01121, Sms, Sms (bacterial radA) DNA repair prot 0.004
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information 
 Score = 43.3 bits (103), Expect = 4e-05
 Identities = 16/78 (20%), Positives = 31/78 (39%), Gaps = 2/78 (2%)

Query: 176 RFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFRNPYSIE 235
            +A WL   LE  G+  ++          +  I E A+  +   +V+L+     +P+   
Sbjct: 11  EWAEWLADALEAAGIRVWLDWDIPPGEDWRDEI-EEALRSADVVLVLLSPAYLASPWCRA 69

Query: 236 ELRYFSG-KKNLVPIFFD 252
           E        K L+P+  +
Sbjct: 70  EWGAALERGKRLIPVRLE 87

This is a family of bacterial Toll-like receptors. Length = 102
>gnl|CDD|238541 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 996
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN03194187 putative disease resistance protein; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.96
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.95
PRK04841 903 transcriptional regulator MalT; Provisional 99.79
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.74
smart00255140 TIR Toll - interleukin 1 - resistance. 99.65
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.57
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.21
PF05729166 NACHT: NACHT domain 99.06
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.03
COG3903414 Predicted ATPase [General function prediction only 99.01
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.96
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.94
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.93
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.84
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.84
COG3899 849 Predicted ATPase [General function prediction only 98.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.69
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.55
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.55
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.46
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.42
PTZ00202550 tuzin; Provisional 98.42
PF13173128 AAA_14: AAA domain 98.35
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.29
PRK13342413 recombination factor protein RarA; Reviewed 98.29
PRK06893229 DNA replication initiation factor; Validated 98.27
PF14516331 AAA_35: AAA-like domain 98.26
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.24
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.22
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.22
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.19
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.18
PRK12402337 replication factor C small subunit 2; Reviewed 98.16
PRK08727233 hypothetical protein; Validated 98.16
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.15
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.15
PTZ001121164 origin recognition complex 1 protein; Provisional 98.15
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.11
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.09
PRK07471365 DNA polymerase III subunit delta'; Validated 98.04
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.03
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.02
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.02
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.01
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.01
PLN03025319 replication factor C subunit; Provisional 98.0
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK09087226 hypothetical protein; Validated 97.99
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.99
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.99
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.98
PRK05564313 DNA polymerase III subunit delta'; Validated 97.97
PRK08084235 DNA replication initiation factor; Provisional 97.97
PRK13341 725 recombination factor protein RarA/unknown domain f 97.95
KOG2028554 consensus ATPase related to the helicase subunit o 97.95
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.94
PRK09112351 DNA polymerase III subunit delta'; Validated 97.94
PRK04195482 replication factor C large subunit; Provisional 97.93
PRK03992389 proteasome-activating nucleotidase; Provisional 97.92
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.91
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.91
PRK00440319 rfc replication factor C small subunit; Reviewed 97.91
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.9
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.89
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.89
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.89
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.88
PRK05642234 DNA replication initiation factor; Validated 97.87
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.86
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.84
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.84
PRK07940394 DNA polymerase III subunit delta'; Validated 97.78
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.78
PHA02544316 44 clamp loader, small subunit; Provisional 97.78
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.77
PRK08116268 hypothetical protein; Validated 97.77
KOG3678832 consensus SARM protein (with sterile alpha and arm 97.75
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.75
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.72
PRK14087450 dnaA chromosomal replication initiation protein; P 97.7
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.69
PRK12422445 chromosomal replication initiation protein; Provis 97.69
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.68
PRK09376416 rho transcription termination factor Rho; Provisio 97.66
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.64
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.64
PRK14088440 dnaA chromosomal replication initiation protein; P 97.64
PRK05707328 DNA polymerase III subunit delta'; Validated 97.63
PRK00149450 dnaA chromosomal replication initiation protein; R 97.62
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.59
cd01128249 rho_factor Transcription termination factor rho is 97.58
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.58
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.58
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.57
PF00004132 AAA: ATPase family associated with various cellula 97.53
smart00382148 AAA ATPases associated with a variety of cellular 97.53
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.52
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.51
PRK14086617 dnaA chromosomal replication initiation protein; P 97.51
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.49
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.49
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.49
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.46
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 97.44
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.41
CHL00095821 clpC Clp protease ATP binding subunit 97.39
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.39
PRK08181269 transposase; Validated 97.38
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.38
PRK12377248 putative replication protein; Provisional 97.36
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.33
PRK06620214 hypothetical protein; Validated 97.33
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.32
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.3
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.3
TIGR00767415 rho transcription termination factor Rho. Members 97.28
CHL00176638 ftsH cell division protein; Validated 97.28
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.24
PRK06526254 transposase; Provisional 97.24
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.23
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.22
PRK06921266 hypothetical protein; Provisional 97.21
PRK10865 857 protein disaggregation chaperone; Provisional 97.19
CHL00195489 ycf46 Ycf46; Provisional 97.19
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.17
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.16
PRK04296190 thymidine kinase; Provisional 97.16
PRK08769319 DNA polymerase III subunit delta'; Validated 97.15
PRK07993334 DNA polymerase III subunit delta'; Validated 97.13
PRK09183259 transposase/IS protein; Provisional 97.12
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.07
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.07
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.07
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.06
CHL00181287 cbbX CbbX; Provisional 97.03
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.02
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.01
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.01
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.0
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.99
PRK08058329 DNA polymerase III subunit delta'; Validated 96.98
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.97
PRK07399314 DNA polymerase III subunit delta'; Validated 96.91
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.9
PRK07952244 DNA replication protein DnaC; Validated 96.89
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.89
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 96.88
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.87
PRK06835329 DNA replication protein DnaC; Validated 96.87
PRK06871325 DNA polymerase III subunit delta'; Validated 96.86
PRK12608380 transcription termination factor Rho; Provisional 96.84
PRK08939306 primosomal protein DnaI; Reviewed 96.83
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.82
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.75
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.74
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.74
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.74
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 96.72
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.72
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.7
PRK06067234 flagellar accessory protein FlaH; Validated 96.69
PRK10536262 hypothetical protein; Provisional 96.68
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.66
PHA00729226 NTP-binding motif containing protein 96.64
COG0593408 DnaA ATPase involved in DNA replication initiation 96.64
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.63
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.62
cd03115173 SRP The signal recognition particle (SRP) mediates 96.6
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.6
PRK06090319 DNA polymerase III subunit delta'; Validated 96.57
PRK09354349 recA recombinase A; Provisional 96.5
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.49
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 96.48
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.45
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.45
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.43
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.43
PRK06964342 DNA polymerase III subunit delta'; Validated 96.41
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.4
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.4
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.34
PRK08699325 DNA polymerase III subunit delta'; Validated 96.34
PRK14974336 cell division protein FtsY; Provisional 96.32
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.31
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.3
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.26
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.24
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 96.23
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.2
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.19
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.19
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.19
cd01394218 radB RadB. The archaeal protein radB shares simila 96.18
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.17
PRK08118167 topology modulation protein; Reviewed 96.16
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.15
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.15
PRK04132846 replication factor C small subunit; Provisional 96.14
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.11
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.09
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.08
PRK00771437 signal recognition particle protein Srp54; Provisi 96.08
TIGR00763775 lon ATP-dependent protease La. This protein is ind 96.08
TIGR00064272 ftsY signal recognition particle-docking protein F 96.0
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.98
PRK13695174 putative NTPase; Provisional 95.97
PRK10867433 signal recognition particle protein; Provisional 95.93
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.91
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.9
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.86
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.86
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.84
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.83
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.83
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.81
KOG1514767 consensus Origin recognition complex, subunit 1, a 95.8
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.8
PF00154322 RecA: recA bacterial DNA recombination protein; In 95.8
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.79
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.77
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 95.76
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.73
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.73
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.72
PRK05541176 adenylylsulfate kinase; Provisional 95.7
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.7
PRK11823446 DNA repair protein RadA; Provisional 95.69
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.68
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.67
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.67
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.66
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 95.66
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.64
PRK04328249 hypothetical protein; Provisional 95.63
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.63
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.62
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.62
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.62
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.61
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.6
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 95.59
cd03246173 ABCC_Protease_Secretion This family represents the 95.59
COG2255332 RuvB Holliday junction resolvasome, helicase subun 95.58
TIGR00959428 ffh signal recognition particle protein. This mode 95.58
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.57
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.55
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.54
PRK10865857 protein disaggregation chaperone; Provisional 95.54
PRK07261171 topology modulation protein; Provisional 95.54
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.53
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.51
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.49
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.48
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 95.47
KOG0731774 consensus AAA+-type ATPase containing the peptidas 95.43
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.43
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.35
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.34
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.33
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.31
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.3
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 95.29
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 95.24
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.2
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.2
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.2
PRK09302509 circadian clock protein KaiC; Reviewed 95.2
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.14
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 95.13
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.12
PRK10416318 signal recognition particle-docking protein FtsY; 95.11
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.11
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.11
PTZ00035337 Rad51 protein; Provisional 95.1
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 95.09
PF07726131 AAA_3: ATPase family associated with various cellu 95.03
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.0
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 94.99
PRK00889175 adenylylsulfate kinase; Provisional 94.98
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.97
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.97
COG1117253 PstB ABC-type phosphate transport system, ATPase c 94.95
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.95
KOG1969877 consensus DNA replication checkpoint protein CHL12 94.94
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 94.9
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 94.89
PRK07132299 DNA polymerase III subunit delta'; Validated 94.86
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.86
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 94.86
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.83
PF1342844 TPR_14: Tetratricopeptide repeat 94.82
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.82
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 94.81
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.81
CHL00095821 clpC Clp protease ATP binding subunit 94.75
PRK03839180 putative kinase; Provisional 94.73
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.73
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 94.67
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 94.67
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 94.65
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.65
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 94.62
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.61
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.6
PRK06762166 hypothetical protein; Provisional 94.57
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 94.57
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.54
PRK09302509 circadian clock protein KaiC; Reviewed 94.54
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.5
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.5
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.49
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.47
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 94.47
PRK04040188 adenylate kinase; Provisional 94.46
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 94.43
PRK06696223 uridine kinase; Validated 94.43
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.43
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 94.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.43
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 94.37
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.35
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.35
PRK08233182 hypothetical protein; Provisional 94.33
PRK03846198 adenylylsulfate kinase; Provisional 94.3
PRK00625173 shikimate kinase; Provisional 94.28
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 94.26
PRK07667193 uridine kinase; Provisional 94.25
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 94.22
PRK08972444 fliI flagellum-specific ATP synthase; Validated 94.2
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 94.18
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.15
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.14
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 94.13
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 94.12
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 94.11
PTZ00301210 uridine kinase; Provisional 94.1
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.09
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.08
PRK13947171 shikimate kinase; Provisional 94.07
PRK00131175 aroK shikimate kinase; Reviewed 94.03
PRK05480209 uridine/cytidine kinase; Provisional 93.99
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 93.95
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.93
COG3910233 Predicted ATPase [General function prediction only 93.9
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.89
COG0003322 ArsA Predicted ATPase involved in chromosome parti 93.87
PF1324576 AAA_19: Part of AAA domain 93.86
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.85
PRK08149428 ATP synthase SpaL; Validated 93.85
COG4133209 CcmA ABC-type transport system involved in cytochr 93.83
PRK06217183 hypothetical protein; Validated 93.8
KOG0734752 consensus AAA+-type ATPase containing the peptidas 93.79
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 93.79
PRK05922434 type III secretion system ATPase; Validated 93.76
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.75
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.75
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.74
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.74
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 93.73
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.73
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 93.71
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.71
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.7
PRK12678672 transcription termination factor Rho; Provisional 93.67
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 93.64
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.63
PRK05973237 replicative DNA helicase; Provisional 93.62
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 93.6
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.6
PRK01184184 hypothetical protein; Provisional 93.58
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.58
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 93.58
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.57
CHL00059485 atpA ATP synthase CF1 alpha subunit 93.57
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 93.54
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 93.53
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.53
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.51
PRK08927442 fliI flagellum-specific ATP synthase; Validated 93.5
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 93.47
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.46
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.44
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.41
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 93.38
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 93.37
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 93.3
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 93.28
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.27
PTZ00494664 tuzin-like protein; Provisional 93.25
PRK06547172 hypothetical protein; Provisional 93.22
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 93.2
PRK06793432 fliI flagellum-specific ATP synthase; Validated 93.18
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 93.14
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 93.12
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 93.11
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.11
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.1
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 93.09
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 93.08
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.08
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.07
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.02
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.02
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.01
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 93.01
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 92.95
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 92.9
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 92.89
PRK13948182 shikimate kinase; Provisional 92.84
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.83
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 92.77
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.76
PRK13949169 shikimate kinase; Provisional 92.75
COG0488530 Uup ATPase components of ABC transporters with dup 92.69
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.69
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 92.66
PRK13946184 shikimate kinase; Provisional 92.65
PRK07196434 fliI flagellum-specific ATP synthase; Validated 92.65
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 92.64
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.63
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 92.6
PRK15453290 phosphoribulokinase; Provisional 92.59
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 92.57
PRK06936439 type III secretion system ATPase; Provisional 92.57
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 92.56
CHL00060494 atpB ATP synthase CF1 beta subunit 92.56
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.55
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 92.51
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 92.49
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 92.48
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 92.46
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 92.45
PRK07594433 type III secretion system ATPase SsaN; Validated 92.45
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 92.43
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 92.42
PRK13768253 GTPase; Provisional 92.41
PRK06002450 fliI flagellum-specific ATP synthase; Validated 92.41
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 92.39
KOG2228408 consensus Origin recognition complex, subunit 4 [R 92.36
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.32
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 92.31
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 92.31
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 92.31
TIGR01287275 nifH nitrogenase iron protein. This model describe 92.3
cd03114148 ArgK-like The function of this protein family is u 92.29
PRK09099441 type III secretion system ATPase; Provisional 92.28
COG0703172 AroK Shikimate kinase [Amino acid transport and me 92.19
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 92.19
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 92.19
PTZ00185574 ATPase alpha subunit; Provisional 92.17
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.17
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 92.16
PRK07721438 fliI flagellum-specific ATP synthase; Validated 92.14
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 92.12
cd02034116 CooC The accessory protein CooC, which contains a 92.11
PRK12339197 2-phosphoglycerate kinase; Provisional 92.09
smart00487201 DEXDc DEAD-like helicases superfamily. 92.08
PRK04182180 cytidylate kinase; Provisional 92.07
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 92.06
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 92.04
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 92.04
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 92.02
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 92.0
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 91.99
KOG0736953 consensus Peroxisome assembly factor 2 containing 91.99
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 91.96
PRK14530215 adenylate kinase; Provisional 91.95
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 91.93
PRK13765637 ATP-dependent protease Lon; Provisional 91.93
TIGR01817534 nifA Nif-specific regulatory protein. This model r 91.92
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.85
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 91.84
KOG0061613 consensus Transporter, ABC superfamily (Breast can 91.68
PRK05688451 fliI flagellum-specific ATP synthase; Validated 91.62
PRK13975196 thymidylate kinase; Provisional 91.59
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 91.59
PRK13537306 nodulation ABC transporter NodI; Provisional 91.56
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 91.56
PRK15359144 type III secretion system chaperone protein SscB; 91.52
PRK03731171 aroL shikimate kinase II; Reviewed 91.5
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 91.49
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 91.48
COG1936180 Predicted nucleotide kinase (related to CMP and AM 91.43
PRK15429686 formate hydrogenlyase transcriptional activator Fh 91.43
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 91.43
PRK13531498 regulatory ATPase RavA; Provisional 91.38
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 91.36
COG4088261 Predicted nucleotide kinase [Nucleotide transport 91.35
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 91.34
cd02040270 NifH NifH gene encodes component II (iron protein) 91.32
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 91.26
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 91.26
COG2884223 FtsE Predicted ATPase involved in cell division [C 91.25
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 91.24
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.23
PRK04196460 V-type ATP synthase subunit B; Provisional 91.23
PRK05057172 aroK shikimate kinase I; Reviewed 91.22
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 91.21
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=4.3e-77  Score=770.15  Aligned_cols=477  Identities=17%  Similarity=0.230  Sum_probs=368.3

Q ss_pred             ccccccCCCccceeEeeccCCCccccchHHHHHHHHHHcCCceeecCccccCCCCcHHHHHHHhhcceEEEEEEcCCCCc
Q 001918          150 SVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFR  229 (996)
Q Consensus       150 s~~~s~~~~~~~dVFlsfrG~d~~r~~F~~hL~~~L~~~gI~~F~dd~~~~~~~~~~~~~~~ai~~S~i~ivv~S~nya~  229 (996)
                      ++|||+++.|+|||||||||+|| |++|++|||+||.++||+||+||+ +++|+.+.+.+.+||++|+|||||||+|||+
T Consensus         2 ~~~~~~~~~~~~~vf~sfrg~d~-r~~f~~hl~~~l~~~~i~~f~d~~-~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~   79 (1153)
T PLN03210          2 ASSSSSSRNWVYDVFPSFSGEDV-RITFLSHFLKELDRKLIIAFKDNE-IERSQSLDPELKQAIRDSRIAVVVFSKNYAS   79 (1153)
T ss_pred             CCCCCCCCCCCCcEEeeCCCccc-ccCHHHHHHHHHHHCCCeEEccCC-ccCCCcccHHHHHHHHhCeEEEEEecCCccc
Confidence            34455667899999999999995 899999999999999999999875 6777778888889999999999999999999


Q ss_pred             CcccHHHHHhhhcCC-----ceEeeeecCCCCchhhHHHHhhhhhhHHhhccchhhhhhhhhHHHHHHHhhhhccccccc
Q 001918          230 NPYSIEELRYFSGKK-----NLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWKL  304 (996)
Q Consensus       230 S~wCL~EL~~i~~~~-----~v~PvFy~vdPs~~~vr~~~~~~g~~~~~~~~~~~~~~~~~~~~W~eal~~~~~~~~w~~  304 (996)
                      |+||||||++||+|+     .||||||+|||||  ||+|.+.||++|+++....   ..+..++|++|++.++++.||++
T Consensus        80 s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~--v~~~~g~f~~~f~~~~~~~---~~~~~~~w~~al~~~~~~~g~~~  154 (1153)
T PLN03210         80 SSWCLNELLEIVRCKEELGQLVIPVFYGLDPSH--VRKQTGDFGEAFEKTCQNK---TEDEKIQWKQALTDVANILGYHS  154 (1153)
T ss_pred             chHHHHHHHHHHHhhhhcCceEEEEEecccHHH--HhhccchHHHHHHHHhccc---chhHHHHHHHHHHHHhCcCceec
Confidence            999999999999864     4999999999999  9999999999999886421   23456999999999999999988


Q ss_pred             cccccchHHHHHHHHHHHhHHhcCchHHHHHHHhhhhcCCCcccccccccccCchhhHHhHHHHHcCCCCchhHhhhhhH
Q 001918          305 EAQEGNCRDCILRAVTLLAMKLGRRSVVERLTKWREKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFEL  384 (996)
Q Consensus       305 ~~~~~~~~~~i~~~~~~~~~~l~~~~~~e~~~~~~~~~~~~~~p~~~~~~~vG~~~~l~~l~~~l~~~~~~~~~~~~l~~  384 (996)
                      . ..++..+.|++||+.+..+++..                  |....++|||++.++++|+.++..+.           
T Consensus       155 ~-~~~~E~~~i~~Iv~~v~~~l~~~------------------~~~~~~~~vG~~~~l~~l~~lL~l~~-----------  204 (1153)
T PLN03210        155 Q-NWPNEAKMIEEIANDVLGKLNLT------------------PSNDFEDFVGIEDHIAKMSSLLHLES-----------  204 (1153)
T ss_pred             C-CCCCHHHHHHHHHHHHHHhhccc------------------cCcccccccchHHHHHHHHHHHcccc-----------
Confidence            3 44566789999999998888532                  44556789999999999998774322           


Q ss_pred             hhhccccCcccCCCCCchhHHHhhhhcccCCCCCCCCccccccCccchhccccchHhhhhhhhcCCCCccccccccccCc
Q 001918          385 KARTRRKNLRIGWSKSASLEERRKERQWEGGSRKGKEPVVWKESEKEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGK  464 (996)
Q Consensus       385 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~p~v~~~~~~~~~fvGR~~el~~l~~~~~~~~~l~~~~~~~~~~  464 (996)
                                                                                                   ...
T Consensus       205 -----------------------------------------------------------------------------~~~  207 (1153)
T PLN03210        205 -----------------------------------------------------------------------------EEV  207 (1153)
T ss_pred             -----------------------------------------------------------------------------Cce
Confidence                                                                                         023


Q ss_pred             eEEEEEcCCCCChhHHHHHHHHHHhcCCCEEEEEeCcCc--cH--H--------HHHHHHHHHcc-CccCcccCCccccc
Q 001918          465 GIACVTGDSGIGKTELLLEFAYRYHQRYKMVLWVGGESR--YI--R--------QNYLNLWSFLD-VDVGIENCSDKSRI  531 (996)
Q Consensus       465 ~vV~I~G~gGIGKTtLA~~~~~~~~~~F~~v~wi~~~~~--~~--~--------~~l~~La~~L~-~~~~~~~~~~~~~~  531 (996)
                      ++|+|||||||||||||+++|+++..+|++.+|++....  ..  .        .....++..+. .......      +
T Consensus       208 ~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~------~  281 (1153)
T PLN03210        208 RMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKD------I  281 (1153)
T ss_pred             EEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCC------c
Confidence            589999999999999999999999999999999864210  00  0        00111222110 0000000      0


Q ss_pred             chhhhcHHHHHHHHHHHHhcCCCEEEEEcCCCCcccccchHHHhhhccCCCCCeEEEEEecCCCcCC---c-ceEEccCC
Q 001918          532 KSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMN---L-EPLKLSYL  607 (996)
Q Consensus       532 ~~~~~~~~~~~~~l~~~L~~~~r~LLVLDdvd~~~~~~~~~~L~~~lp~~~~gsrIIITTR~~~~~~---~-~~~~v~~L  607 (996)
                           . ......++++| .++|+|||||||++..+|   +.+.....++++|++||||||++.+..   . .+|+|+.|
T Consensus       282 -----~-~~~~~~~~~~L-~~krvLLVLDdv~~~~~l---~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l  351 (1153)
T PLN03210        282 -----K-IYHLGAMEERL-KHRKVLIFIDDLDDQDVL---DALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLP  351 (1153)
T ss_pred             -----c-cCCHHHHHHHH-hCCeEEEEEeCCCCHHHH---HHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCC
Confidence                 0 00124578888 899999999999987666   566666667788999999999998742   3 78999999


Q ss_pred             CHHHHHHHHhhhcCC---CCcccHHHHHHHHHHhCCChHHHHHHHHHHhcCCCCHHHHHHHHhcCCCcccccCCCCCccc
Q 001918          608 SGVEAMSLMQGSVKD---YPITEVDALRVIEEKVGRLTMGLAVVGAILSELPINPSRLLDTINRMPLRDLSWNGRESHSL  684 (996)
Q Consensus       608 ~~~EA~~Lf~~~a~~---~~~~~~~~a~~iv~~lgglPLAL~~~gs~L~~~~~s~~e~l~~L~~~~~~~l~~~~~~~~~~  684 (996)
                      +.+||++||+++||.   .+.+..+++++|+++|+|+||||+++|++|+++.  .++|.+.+.+...             
T Consensus       352 ~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~--~~~W~~~l~~L~~-------------  416 (1153)
T PLN03210        352 SNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRD--KEDWMDMLPRLRN-------------  416 (1153)
T ss_pred             CHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCC--HHHHHHHHHHHHh-------------
Confidence            999999999999983   2234678899999999999999999999999654  4555555444210             


Q ss_pred             ccchhHHHHHHHHHHhccccCCCCHHHHHHHHhccccCCCCCCHHHHHHHhccCCCcccchhhHHHhhhhcccCCCCCcc
Q 001918          685 RRNTFLFQLFEVCFSIFDHADGPRSLATRMVLAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYT  764 (996)
Q Consensus       685 ~~~~~i~~~l~iS~~~L~~~~~~~~~A~~lL~ilaff~~~~Ip~~ll~~~~~~l~~~~~~~~~W~~~l~~~~~~~~~~~~  764 (996)
                      ..+..|..+|++||+.|+..    .....|++++|||.+..++......+                     .|++     
T Consensus       417 ~~~~~I~~~L~~SYd~L~~~----~~k~~Fl~ia~ff~~~~~~~v~~~l~---------------------~~~~-----  466 (1153)
T PLN03210        417 GLDGKIEKTLRVSYDGLNNK----KDKAIFRHIACLFNGEKVNDIKLLLA---------------------NSDL-----  466 (1153)
T ss_pred             CccHHHHHHHHHhhhccCcc----chhhhhheehhhcCCCCHHHHHHHHH---------------------hcCC-----
Confidence            11346889999999999642    12257999999998876654221111                     1222     


Q ss_pred             hHHHHHHHHHHHhcCCceeeCCCCeEEEcHHHHHHHHHhCC
Q 001918          765 KRSEAEASSMLLRFNIARSSTRQGYIHFNDLVKLYARKRGV  805 (996)
Q Consensus       765 ~~~~~~~l~~L~~~sLI~~~~~~~~i~mH~Lvq~~~r~~l~  805 (996)
                        +...+++.|+++|||++..  +++.||+|+|+|+|+...
T Consensus       467 --~~~~~l~~L~~ksLi~~~~--~~~~MHdLl~~~~r~i~~  503 (1153)
T PLN03210        467 --DVNIGLKNLVDKSLIHVRE--DIVEMHSLLQEMGKEIVR  503 (1153)
T ss_pred             --CchhChHHHHhcCCEEEcC--CeEEhhhHHHHHHHHHHH
Confidence              1356799999999998864  789999999999998763

syringae 6; Provisional
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query996
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-04
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 94.1 bits (233), Expect = 1e-19
 Identities = 99/651 (15%), Positives = 199/651 (30%), Gaps = 180/651 (27%)

Query: 339 REKVDKEEFPFPRNENFIGRKKELSELEFILFGDITGDSERDYFELKARTRRKNLRIGWS 398
           +  + KEE      ++ I  K  +S     LF  +    E    +      R N    + 
Sbjct: 43  KSILSKEEI-----DHIIMSKDAVSGTLR-LFWTLLSKQEEMVQKFVEEVLRINY--KFL 94

Query: 399 KSASLEERRKERQWEGGSRKGKEPVVWKESEKEIEMQSTE-APQRQKTKSSGR----Y-- 451
            S                         K  +++  M +     QR +  +  +    Y  
Sbjct: 95  MSP-----------------------IKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNV 131

Query: 452 PRRKRSTKI---LY----GKGIACVTGDSGIGKTELLLEFAYRYHQRYKM---VLWVG-- 499
            R +   K+   L      K +  + G  G GKT + L+    Y  + KM   + W+   
Sbjct: 132 SRLQPYLKLRQALLELRPAKNVL-IDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK 190

Query: 500 --GESRYIRQNYLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPF-- 555
                  + +    L   +D +         S IK      +A +    + L+++ P+  
Sbjct: 191 NCNSPETVLEMLQKLLYQIDPN-WTSRSDHSSNIKLRIHSIQAEL----RRLLKSKPYEN 245

Query: 556 -LVIIDNLESEKDWWDDKLVMDLLPRFGGETHIIISTRLPRVMN-LEPLKLSYLSGV--- 610
            L+++ N+       + K        F     I+++TR  +V + L     +++S     
Sbjct: 246 CLLVLLNV------QNAKAWNA----FNLSCKILLTTRFKQVTDFLSAATTTHISLDHHS 295

Query: 611 ------EAMSLMQGSVKDYPITEVDALRVIEEKVGRLTMGLAVVGAILSELP-------- 656
                 E  SL+   +          L    E +      L+++   + +          
Sbjct: 296 MTLTPDEVKSLLLKYLD----CRPQDLP--REVLTTNPRRLSIIAESIRDGLATWDNWKH 349

Query: 657 INPSRLLDTINRMPLRDLSWNGRESHSLRRNTFLFQLFEVCFSIF-DHADGPRSLATRMV 715
           +N  +L   I      + S N  E    R      ++F+   S+F   A  P      ++
Sbjct: 350 VNCDKLTTII------ESSLNVLEPAEYR------KMFDR-LSVFPPSAHIP-----TIL 391

Query: 716 LAGGWFAPAAIPVSLLALAAHKIPEKHKGTHLWRKLLLSLTCGFTSSYTKRSEAEASS-M 774
           L+  WF      V ++               L +  L+           K+ +    S  
Sbjct: 392 LSLIWFDVIKSDVMVVV------------NKLHKYSLVE----------KQPKESTISIP 429

Query: 775 LLRFNIARSSTRQGYIHFNDLVKLYARKRGVTGVAHAMVQAVISRGSITHHSGH------ 828
            +   +      +  +H   +V  Y   +        ++   +       H GH      
Sbjct: 430 SIYLELKVKLENEYALH-RSIVDHYNIPKTFDS--DDLIPPYLD-QYFYSHIGHHLKNIE 485

Query: 829 ------IWTACFLLFGFGNDLKVVELKV--SELLYLVKEVVLPVAI-----RTFIT---- 871
                 ++   FL F F      +E K+      +     +L         + +I     
Sbjct: 486 HPERMTLFRMVFLDFRF------LEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDP 539

Query: 872 -FSR-CSAALELLRLCTNALEAADH------ALVTPVEKLLDKSLCWRPVQ 914
            + R  +A L+ L      L  + +      AL+   E + +++   + VQ
Sbjct: 540 KYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEAIFEEAH--KQVQ 588
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query996
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 100.0
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.97
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.97
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.96
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.95
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.83
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.76
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.74
2js7_A160 Myeloid differentiation primary response protein M 99.74
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.72
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.6
2fna_A357 Conserved hypothetical protein; structural genomic 99.54
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.38
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.27
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.24
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.23
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.16
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.03
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.96
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.91
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.72
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.71
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.61
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.54
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.48
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.34
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.33
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.33
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.25
3bos_A242 Putative DNA replication factor; P-loop containing 98.21
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.18
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.08
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.05
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.02
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.99
3pvs_A447 Replication-associated recombination protein A; ma 97.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.95
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.93
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.89
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.87
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.87
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.85
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.85
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.85
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.84
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.82
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.76
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.76
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.76
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.74
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.69
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.69
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.65
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.65
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.63
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.63
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.55
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.52
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.5
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.45
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.41
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.36
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.29
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.28
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.26
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.24
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.23
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 97.21
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.19
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.14
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.09
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.08
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.06
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.06
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.99
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.98
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.96
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.94
2qgz_A308 Helicase loader, putative primosome component; str 96.94
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.84
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.82
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.75
2r62_A268 Cell division protease FTSH homolog; ATPase domain 96.73
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.67
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.64
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.62
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.62
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.61
3co5_A143 Putative two-component system transcriptional RES 96.53
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.49
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.46
3io5_A333 Recombination and repair protein; storage dimer, i 96.45
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 96.43
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.37
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.35
2z43_A324 DNA repair and recombination protein RADA; archaea 96.31
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.31
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.29
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.23
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.23
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.2
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.13
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.13
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.12
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.1
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.08
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.04
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.02
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.86
4g1t_A 472 Interferon-induced protein with tetratricopeptide 95.86
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.79
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 95.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.69
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.67
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 95.66
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 95.61
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.61
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.6
4g1t_A 472 Interferon-induced protein with tetratricopeptide 95.55
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.45
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.43
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.37
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.31
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.22
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.22
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 95.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.15
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.13
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.12
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.07
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.07
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.06
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 95.02
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.01
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.0
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 94.98
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 94.97
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 94.93
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.92
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.88
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 94.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 94.71
2xxa_A433 Signal recognition particle protein; protein trans 94.68
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.68
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 94.66
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.64
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.55
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.5
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 94.45
3ice_A422 Transcription termination factor RHO; transcriptio 94.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.43
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 94.4
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.39
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.38
3k9i_A117 BH0479 protein; putative protein binding protein, 94.34
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.26
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.25
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.25
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.2
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.18
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.15
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.12
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.03
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.99
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.98
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.97
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.93
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 93.93
3u3w_A293 Transcriptional activator PLCR protein; ternary co 93.92
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 93.91
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 93.86
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.86
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.84
3vtx_A 184 MAMA; tetratricopeptide repeats (TPR) containing p 93.82
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.81
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 93.78
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 93.77
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.76
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.73
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.67
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 93.64
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 93.63
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.63
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 93.57
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.57
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.55
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.55
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.54
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 93.53
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.47
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.39
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.36
1via_A175 Shikimate kinase; structural genomics, transferase 93.3
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 93.26
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.19
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.18
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.16
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.12
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.1
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.08
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 93.03
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 93.01
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 93.0
3fwy_A314 Light-independent protochlorophyllide reductase I 92.99
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.97
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.97
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.96
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 92.96
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.94
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.94
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.93
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.93
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 92.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.88
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.87
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 92.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 92.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 92.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 92.85
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.85
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.82
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.82
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 92.76
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 92.76
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 92.75
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.67
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.67
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.63
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 92.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.59
2l6j_A111 TPR repeat-containing protein associated with HSP; 92.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 92.52
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 92.5
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.41
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 92.4
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.36
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.32
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.32
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.32
3k9i_A117 BH0479 protein; putative protein binding protein, 92.3
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.25
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 92.16
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.16
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.15
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 92.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 92.12
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 92.09
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 92.09
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 92.06
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 92.04
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.03
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.02
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.97
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 91.97
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.91
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.91
3l0o_A427 Transcription termination factor RHO; helicase, RH 91.81
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.8
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 91.78
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 91.76
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 91.73
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.73
2kat_A115 Uncharacterized protein; NESG, structure, structur 91.72
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.71
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.68
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.67
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.63
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 91.59
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.53
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.53
2r44_A331 Uncharacterized protein; putative ATPase, structur 91.52
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 91.52
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 91.51
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 91.5
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.49
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 91.49
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.46
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.45
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 91.44
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.43
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.43
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 91.42
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.34
3end_A307 Light-independent protochlorophyllide reductase ir 91.33
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.33
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 91.29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 91.25
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 91.25
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 91.19
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.19
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 91.19
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 91.18
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.18
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 91.03
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.0
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 91.0
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.96
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 90.94
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.93
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 90.93
3tlx_A243 Adenylate kinase 2; structural genomics, structura 90.92
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 90.9
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 90.82
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.79
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.71
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 90.7
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 90.69
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 90.63
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 90.59
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.57
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.55
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.54
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 90.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 90.53
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 90.5
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 90.46
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.46
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 90.45
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 90.4
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 90.36
2og2_A359 Putative signal recognition particle receptor; nuc 90.36
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 90.23
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 90.22
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.2
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 90.14
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 90.13
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.12
3r20_A233 Cytidylate kinase; structural genomics, seattle st 90.06
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 90.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 90.04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 90.03
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 90.03
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 90.01
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 90.0
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 89.95
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 89.9
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 89.88
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 89.84
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 89.78
1tue_A212 Replication protein E1; helicase, replication, E1E 89.75
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 89.73
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 89.72
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 89.69
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 89.63
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 89.61
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 89.59
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 89.52
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 89.52
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 89.51
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.43
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.43
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 89.34
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.3
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.24
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.21
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 89.2
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 89.14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 89.13
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 89.11
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.1
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 89.09
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.08
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 89.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 89.01
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 88.95
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 88.89
2eyu_A261 Twitching motility protein PILT; pilus retraction 88.88
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 88.86
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 88.85
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 88.81
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 88.78
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.74
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 88.71
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 88.7
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.7
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 88.68
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 88.64
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.61
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 88.59
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 88.58
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 88.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 88.51
4i17_A228 Hypothetical protein; TPR repeats protein, structu 88.51
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 88.51
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.49
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 88.48
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 88.4
2hf9_A226 Probable hydrogenase nickel incorporation protein 88.33
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 88.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 88.21
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 88.12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 88.03
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 88.02
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 87.97
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.91
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 87.84
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 87.78
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 87.73
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 87.73
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 87.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 87.59
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.45
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.32
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 87.27
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 87.2
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 87.15
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 87.1
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 87.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 87.04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 87.02
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 86.95
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 86.94
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 86.89
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 86.86
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 86.82
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 86.8
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 86.69
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 86.69
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 86.68
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 86.62
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 86.61
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 86.58
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 86.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 86.52
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 86.52
3q49_B137 STIP1 homology and U box-containing protein 1; E3 86.5
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 86.5
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 86.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 86.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 86.26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 86.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 86.16
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 86.13
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 86.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 86.09
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 86.03
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 86.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 86.01
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 85.9
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.85
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 85.84
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 85.82
3cwq_A209 Para family chromosome partitioning protein; alpha 85.79
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 85.79
1b0u_A262 Histidine permease; ABC transporter, transport pro 85.78
2kat_A115 Uncharacterized protein; NESG, structure, structur 85.78
2wji_A165 Ferrous iron transport protein B homolog; membrane 85.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 85.77
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 85.74
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 85.71
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 85.7
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.6
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 85.59
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 85.57
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 85.55
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.55
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.5
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 85.49
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 85.48
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 85.34
1g6h_A257 High-affinity branched-chain amino acid transport 85.31
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.24
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 85.2
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 85.16
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 85.08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 85.02
1sgw_A214 Putative ABC transporter; structural genomics, P p 85.01
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 84.93
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 84.91
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 84.89
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 84.82
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 84.81
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 84.79
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 84.75
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 84.69
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 84.67
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
Probab=100.00  E-value=1.4e-46  Score=384.22  Aligned_cols=172  Identities=17%  Similarity=0.293  Sum_probs=147.8

Q ss_pred             ccccccCCCccceeEeeccCCCccccchHHHHHHHHHHcCCceeecCccccCCCCcHHHHHHHhhcceEEEEEEcCCCCc
Q 001918          150 SVSLSCNRLRSCDVFIGLHGCKPSLMRFANWLRAELEVQGMSCFVSDRARCRNSRKHAIVERAMDISSFGVVILTRKSFR  229 (996)
Q Consensus       150 s~~~s~~~~~~~dVFlsfrG~d~~r~~F~~hL~~~L~~~gI~~F~dd~~~~~~~~~~~~~~~ai~~S~i~ivv~S~nya~  229 (996)
                      ++||++.+.++|||||||||+| +|++|++|||++|+++||+||+||+++.+|+.+.+.|.+||++|+++|||||+|||+
T Consensus        25 ~~~s~~~~~~~yDVFISfrg~D-~r~~Fv~~L~~aL~~~GI~~f~D~~el~~G~~I~~~l~~aIe~Sri~IvV~S~nYa~  103 (204)
T 3ozi_A           25 TNPSGSFPSVEYEVFLSFRGPD-TREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYAD  103 (204)
T ss_dssp             ---------CCCCEEEEECHHH-HTTTHHHHHHHHHHHTTCCEEEEETTTCCGGGTTTTHHHHHHHCSEEEEEECTTGGG
T ss_pred             CCCcCCCCCcCCeEEEeccccC-CCHHHHHHHHHHHHHCCCcEEEeCCccCCCCchHHHHHHHHHhCcEeeEEEEccccc
Confidence            4555667889999999999999 489999999999999999999999988888888877789999999999999999999


Q ss_pred             CcccHHHHHhhhcC------CceEeeeecCCCCchhhHHHHhhhhhhHHhhccchhhhhhhhhHHHHHHHhhhhcccccc
Q 001918          230 NPYSIEELRYFSGK------KNLVPIFFDLSPGDCLVRDIVEKRGELWEKNGGELWVLYGGLEKEWKEAVNGLSRVDEWK  303 (996)
Q Consensus       230 S~wCL~EL~~i~~~------~~v~PvFy~vdPs~~~vr~~~~~~g~~~~~~~~~~~~~~~~~~~~W~eal~~~~~~~~w~  303 (996)
                      |+|||+||++||+|      +.||||||+|||||  ||+|++.||++|.+|...|.   .+..++|++||+.++++.||+
T Consensus       104 S~WCl~EL~~I~e~~~~~~~~~ViPIFY~VdPs~--Vr~q~g~fg~af~~~~~~~~---~~~v~~Wr~AL~~va~lsG~~  178 (204)
T 3ozi_A          104 SKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSD--VRHQTGCYKKAFRKHANKFD---GQTIQNWKDALKKVGDLKGWH  178 (204)
T ss_dssp             CHHHHHHHHHHHHHHHHCTTSEECCEEESSCHHH--HHHTCTTHHHHHHHHTTTSC---HHHHHHHHHHHHHHHTSCBEE
T ss_pred             CcHHHHHHHHHHHHHHhcCCeeeEEEEeecCHHH--HHhccccHHHHHHHHHHhhC---HHHHHHHHHHHHHHhccCcee
Confidence            99999999999964      35999999999999  99999999999999986541   246799999999999999999


Q ss_pred             ccccccchHHHHHHHHHHHhHHhcC
Q 001918          304 LEAQEGNCRDCILRAVTLLAMKLGR  328 (996)
Q Consensus       304 ~~~~~~~~~~~i~~~~~~~~~~l~~  328 (996)
                      +. .+.+....|++||..+..+|++
T Consensus       179 ~~-~~~~e~~~i~~Iv~di~~kl~~  202 (204)
T 3ozi_A          179 IG-KNDKQGAIADKVSADIWSHISK  202 (204)
T ss_dssp             EC-TTSCHHHHHHHHHHHHHHHHHH
T ss_pred             cC-CCCCHHHHHHHHHHHHHHHhcc
Confidence            83 5566678899999999888853
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 996
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-06
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 2e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 48.7 bits (115), Expect = 2e-06
 Identities = 29/223 (13%), Positives = 65/223 (29%), Gaps = 25/223 (11%)

Query: 465 GIACVTGDSGIGKTELLLEFAYRYHQR----YKMVLWVGGESRYIRQNYLNLWSFLDVDV 520
               + G +G GK+ +  +   +  Q     Y  ++W+                F D+ +
Sbjct: 45  FFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWL---KDSGTAPKSTFDLFTDILL 101

Query: 521 GIENCSDKSRIKS-FEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLP 579
            +++  D     S            +   L+     L + D++  E+             
Sbjct: 102 MLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIR---------W 152

Query: 580 RFGGETHIIISTRLPRVMNL-----EPLKLSYLSGVEAMSLMQ--GSVKDYPITEVDALR 632
                   +++TR   + N      E ++++ L   E    ++  G        E D L 
Sbjct: 153 AQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLN 212

Query: 633 VIEEKVGRLTMGLAVVGAILSELPINP-SRLLDTINRMPLRDL 674
              E        L +             ++L + +    L  +
Sbjct: 213 KTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGV 255
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query996
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.95
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.49
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.38
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.04
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.55
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.4
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.3
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.29
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.23
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.18
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.18
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.14
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.11
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.08
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.05
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.92
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.92
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.85
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.82
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.81
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.68
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.61
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.38
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.32
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.27
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.07
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.97
d2qy9a2211 GTPase domain of the signal recognition particle r 96.87
d1okkd2207 GTPase domain of the signal recognition particle r 96.74
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.65
d1vmaa2213 GTPase domain of the signal recognition particle r 96.63
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.62
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.62
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.61
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.52
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.52
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.45
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.24
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.15
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.1
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.06
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.04
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.0
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.94
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.92
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.88
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.85
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.8
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.73
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.59
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.5
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.43
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.34
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.34
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.24
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.12
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.11
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.02
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.0
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.91
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.89
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.86
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 94.72
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.71
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.67
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.66
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.65
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.6
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.58
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 94.52
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.5
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.41
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.35
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.33
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.3
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.23
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.22
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.12
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.11
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.96
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.87
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.86
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.85
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.8
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.79
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.77
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 93.74
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.72
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.72
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.67
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.65
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.62
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.53
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.51
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.5
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.48
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.45
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 93.43
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 93.4
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.36
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 93.32
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.31
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.2
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.19
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.18
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.11
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.99
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.73
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.7
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.62
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.53
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.41
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.38
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 92.38
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.37
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.21
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.92
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 91.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 91.41
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 91.38
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 91.34
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 91.24
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.23
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 91.22
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 91.18
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.08
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.06
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 90.23
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.14
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 89.98
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.77
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.56
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 89.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 89.46
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.42
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 89.4
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 89.18
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.86
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.68
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 88.67
d1svma_362 Papillomavirus large T antigen helicase domain {Si 88.57
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.53
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.24
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 87.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.84
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 87.53
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.45
d1g2912240 Maltose transport protein MalK, N-terminal domain 87.26
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 87.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 87.18
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 86.83
d2awna2232 Maltose transport protein MalK, N-terminal domain 86.83
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.82
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 86.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 86.5
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 86.49
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 86.46
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 86.43
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.11
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.09
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 85.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.9
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.78
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.47
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 85.27
d1nrjb_209 Signal recognition particle receptor beta-subunit 84.96
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 84.95
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.94
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 84.76
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 84.75
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 84.68
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 84.64
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 84.61
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 84.49
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.47
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 84.45
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.41
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.35
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.3
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 84.28
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 84.13
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 84.08
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 84.05
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 84.03
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.02
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.86
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 83.73
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.7
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 83.66
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.63
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 83.59
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.5
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 83.45
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.43
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.38
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.28
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.28
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.18
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 83.07
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 82.9
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 82.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 82.71
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 82.68
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.6
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 82.58
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 82.51
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 82.44
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 82.36
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.28
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.24
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 82.17
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 82.06
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 81.87
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 81.72
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.54
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 81.46
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 81.35
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.14
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.06
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 80.82
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 80.72
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 80.66
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 80.55
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 80.54
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 80.5
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 80.25
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 80.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 80.11
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 80.09
d2fh5b1207 Signal recognition particle receptor beta-subunit 80.04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.95  E-value=2e-28  Score=266.31  Aligned_cols=216  Identities=13%  Similarity=0.058  Sum_probs=148.6

Q ss_pred             cchhccccchHhhhhhhhcCCCCccccccccccCceEEEEEcCCCCChhHHHHHHHHH----HhcCCCEEEEEeCcCc-c
Q 001918          430 KEIEMQSTEAPQRQKTKSSGRYPRRKRSTKILYGKGIACVTGDSGIGKTELLLEFAYR----YHQRYKMVLWVGGESR-Y  504 (996)
Q Consensus       430 ~~~~fvGR~~el~~l~~~~~~~~~l~~~~~~~~~~~vV~I~G~gGIGKTtLA~~~~~~----~~~~F~~v~wi~~~~~-~  504 (996)
                      +.+.++||+.+++++.+      .+.....  ...++|+|+|||||||||||++++++    ....|++++|+..... +
T Consensus        18 ~~~~~~gR~~~~~~i~~------~L~~~~~--~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~   89 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIK------KLDEMCD--LDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP   89 (277)
T ss_dssp             CCCCSCCCHHHHHHHHH------HHHHHTT--SSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST
T ss_pred             CCCceeCcHHHHHHHHH------HHHhccC--CCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCC
Confidence            34557799999999874      2211111  13468999999999999999999987    4456899999987655 3


Q ss_pred             HHHH---HHHHHHHccCccCcccCCcccccchhhhcHHHHHHHHHHHHhcCCCEEEEEcCCCCcccccchHHHhhhccCC
Q 001918          505 IRQN---YLNLWSFLDVDVGIENCSDKSRIKSFEEQEEAAICRVRKELMRNIPFLVIIDNLESEKDWWDDKLVMDLLPRF  581 (996)
Q Consensus       505 ~~~~---l~~La~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~~~r~LLVLDdvd~~~~~~~~~~L~~~lp~~  581 (996)
                      ....   +..+...++.......+....     ..........+.+.| .++++||||||||+.      .++..+..  
T Consensus        90 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~L-~~kr~LlVLDDv~~~------~~~~~~~~--  155 (277)
T d2a5yb3          90 KSTFDLFTDILLMLKSEDDLLNFPSVEH-----VTSVVLKRMICNALI-DRPNTLFVFDDVVQE------ETIRWAQE--  155 (277)
T ss_dssp             THHHHHHHHHHHHHTTTSCCTTCCCCTT-----CCHHHHHHHHHHHHT-TSTTEEEEEEEECCH------HHHHHHHH--
T ss_pred             HHHHHHHHHHHHHHhcchhhcCCccchh-----hhhHHHHHHHHHHHh-ccCCeeEecchhhHH------hhhhhhcc--
Confidence            3333   333333333221111110000     012233344567777 899999999999976      45544433  


Q ss_pred             CCCeEEEEEecCCCcCC-----cceEEccCCCHHHHHHHHhhhcCCCC--cccHHHHHHHHHHhCCChHHHHHHHHHHhc
Q 001918          582 GGETHIIISTRLPRVMN-----LEPLKLSYLSGVEAMSLMQGSVKDYP--ITEVDALRVIEEKVGRLTMGLAVVGAILSE  654 (996)
Q Consensus       582 ~~gsrIIITTR~~~~~~-----~~~~~v~~L~~~EA~~Lf~~~a~~~~--~~~~~~a~~iv~~lgglPLAL~~~gs~L~~  654 (996)
                       .|++||||||++.++.     ...|+|++|+.+||++||+.+++..+  +...+.+++|+++|+|+||||+++|+.|+.
T Consensus       156 -~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~  234 (277)
T d2a5yb3         156 -LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP  234 (277)
T ss_dssp             -TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS
T ss_pred             -cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhcc
Confidence             4799999999998743     26799999999999999999998433  345777899999999999999999999975


Q ss_pred             CCC-CHHHHHHHHhc
Q 001918          655 LPI-NPSRLLDTINR  668 (996)
Q Consensus       655 ~~~-s~~e~l~~L~~  668 (996)
                      +.. .|.++.+.|..
T Consensus       235 k~~~~~~~~~~~L~~  249 (277)
T d2a5yb3         235 KTFEKMAQLNNKLES  249 (277)
T ss_dssp             SSHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHhc
Confidence            432 23444445544
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure