Citrus Sinensis ID: 001926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 995 | ||||||
| 255543174 | 1195 | RNA polymerase II ctd phosphatase, putat | 0.916 | 0.763 | 0.625 | 0.0 | |
| 224053553 | 1117 | predicted protein [Populus trichocarpa] | 0.953 | 0.849 | 0.618 | 0.0 | |
| 359473774 | 1238 | PREDICTED: RNA polymerase II C-terminal | 0.956 | 0.768 | 0.601 | 0.0 | |
| 296088169 | 1184 | unnamed protein product [Vitis vinifera] | 0.891 | 0.749 | 0.575 | 0.0 | |
| 356523718 | 1244 | PREDICTED: RNA polymerase II C-terminal | 0.970 | 0.776 | 0.550 | 0.0 | |
| 356567192 | 1221 | PREDICTED: RNA polymerase II C-terminal | 0.950 | 0.774 | 0.549 | 0.0 | |
| 449487451 | 1249 | PREDICTED: LOW QUALITY PROTEIN: RNA poly | 0.949 | 0.756 | 0.568 | 0.0 | |
| 449445782 | 1249 | PREDICTED: RNA polymerase II C-terminal | 0.949 | 0.756 | 0.568 | 0.0 | |
| 357502711 | 1213 | RNA polymerase II C-terminal domain phos | 0.920 | 0.755 | 0.522 | 0.0 | |
| 56547717 | 1227 | putative transcription regulator CPL1 [S | 0.955 | 0.775 | 0.520 | 0.0 |
| >gi|255543174|ref|XP_002512650.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi|223548611|gb|EEF50102.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1140 bits (2949), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 614/982 (62%), Positives = 721/982 (73%), Gaps = 70/982 (7%)
Query: 49 DKEKDMLAMHGVNGKDSNIVTENAVNDLNFKEKVPLPVDSLMQNKP---LEASKPGPPGY 105
+KEK+ L VN KD+++ +++ +D++ K LP DS + NK +E K G +
Sbjct: 249 EKEKEPLISTVVNKKDNDVNGKSSGHDMSAVNK--LPTDSFVNNKANLSIEGPKTGVSSF 306
Query: 106 RSRGVLLPLLDPHKVHDVDSLPSPTRETTPSVPVQRALVVGDGMVKSWAAAAKLSHNAEV 165
+SR LLPLLD HK HD DSLPSPTRE+ +P R L MV + N+ +
Sbjct: 307 KSRAALLPLLDLHKDHDADSLPSPTRESALPLPAYRVLT--PKMVLD-------TGNSRM 357
Query: 166 HKTPHYETDALRAFSSYQQKFGRNSFFMNSELPSPTPSEESGDGDGDTGGEISSATAVDQ 225
H YETDAL+A SSYQQKF ++SF + LPSPTPSEESG+GDGDTGGE+SS+ +V
Sbjct: 358 HP---YETDALKAVSSYQQKFSKSSFALTDRLPSPTPSEESGNGDGDTGGEVSSSLSVSS 414
Query: 226 PKPVNMPTLGQQPVSSQPMDISQP-MDISSVQALTTANNSAPASSGYNPVVKPNPVVKAP 284
+P N T GQ S IS P MD SS+ + + ++ ASS P+ VKA
Sbjct: 415 FRPANPLTSGQSNAS-----ISLPRMDGSSLPGVISIKSAVRASSA------PSLTVKAS 463
Query: 285 IKSRDPRLRF--ASSNALNLNHQPAPILHNAPKVEPVGRVMSSRKQKTVEEPVLDGPALK 342
KSRDPRLRF + SNAL+ NH+ P++ N KVEP+G M+ ++QK V++P+ DG +LK
Sbjct: 464 AKSRDPRLRFVNSDSNALDQNHRAVPVV-NTLKVEPIGGTMNKKRQKIVDDPIPDGHSLK 522
Query: 343 RQRNGFENSGVVRDEKNIYGSGGWLEDTDMFEPQIMNRNLLVDSAESNSRKLDNGATSPI 402
RQ+N ENSGVVRD K + GSGGWLEDTDM PQ MN+N LVD+AES+ R+ D G
Sbjct: 523 RQKNALENSGVVRDVKTMVGSGGWLEDTDMVGPQTMNKNQLVDNAESDPRRKDGGGVCTS 582
Query: 403 TSGTPNVVVSGNEPAPATTPS------------TTVSLPALLKDIAVNPTMLLNILKMGQ 450
+S +V +SG E P T S +T ++P LLK+IAVNPTML+NILKMGQ
Sbjct: 583 SSCISSVNISGTEQIPVTGTSVPIGGELVPVKGSTAAIPDLLKNIAVNPTMLINILKMGQ 642
Query: 451 QQKLAADAQQKSNDSSMNTMHPPIPSS-IPPVSVTCSIPSGILSKPM------------D 497
QQ+LA +AQQK D + +T +P +S + V V + SGIL +P D
Sbjct: 643 QQRLALEAQQKPVDPAKSTTYPLNSNSMLGTVPVVGAAHSGILPRPAGTVQVSPQLGTAD 702
Query: 498 ELGKVRMKPRDPRRVLHGNALQRSGSLGPE-FKTDGPSAPCTQGSKENLNFQKQLGAPEA 556
+LGK+RMKPRDPRRVLH NALQR+GS+G E KT+ S P Q +K+N N QKQ G E
Sbjct: 703 DLGKIRMKPRDPRRVLHNNALQRNGSMGSEHLKTNLTSIPINQETKDNQNLQKQEGQVEK 762
Query: 557 KPVLSQSVLQPDITQQFTKNLKHIADFMSVSQPLTSEPMVSQNSPIQPGQIKSGADMKAV 616
KPV QS+ PDI+ FTKNLK+IAD +SVS TS+P+V QN QP M+
Sbjct: 763 KPVPLQSLALPDISMPFTKNLKNIADIVSVSHASTSQPLVPQNPASQP--------MRTT 814
Query: 617 VTNHDDKQTGTGSGPEAGPVGA---HPQSAWGDVEHLFEGYDDQQKAAIQKERTRRLEEQ 673
+++ D + G GS P A A Q+AWGDVEHLFEGY+DQQKAAIQ+ER RR+EEQ
Sbjct: 815 ISSSD-QFLGIGSAPGAAAAAAAGPRTQNAWGDVEHLFEGYNDQQKAAIQRERARRIEEQ 873
Query: 674 KKMFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPHRHLFRFPHMGMW 733
KK+FSARKLCLVLDLDHTLLNSAKF EVDPVHDEILRKKEEQDREK HRHLFRFPHMGMW
Sbjct: 874 KKLFSARKLCLVLDLDHTLLNSAKFVEVDPVHDEILRKKEEQDREKAHRHLFRFPHMGMW 933
Query: 734 TKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPFD 793
TKLRPGIW FLE+ASKL+E+HLYTMGNKLYATEMAKVLDP GVLF GRVISRGDDG+PFD
Sbjct: 934 TKLRPGIWNFLEKASKLYELHLYTMGNKLYATEMAKVLDPTGVLFNGRVISRGDDGEPFD 993
Query: 794 GDERVPKSKDLEGVLGMESAVVIIDDSVRVWPHNKLNLIVVERYTYFPCSRRQFGLLGPS 853
GDER+PKSKDLEGVLGMES VVI+DDSVRVWPHNKLNLIVVERY YFPCSRRQFGL GPS
Sbjct: 994 GDERIPKSKDLEGVLGMESGVVIMDDSVRVWPHNKLNLIVVERYIYFPCSRRQFGLPGPS 1053
Query: 854 LLEIDHDERSEDGTLASSLGVIERLHKIFFSHQSLDDVDVRNILAAEQRKILAGCRIVFS 913
LLEIDHDER EDGTLA SL VIER+H+ FF+H SLD+ DVRNILA+EQRKILAGCRIVFS
Sbjct: 1054 LLEIDHDERPEDGTLACSLAVIERIHQNFFTHPSLDEADVRNILASEQRKILAGCRIVFS 1113
Query: 914 RVFPVGEANPHLHPLWQTAEQFGAVCTKHIDDQVTHVVANSLGTDKVNWALSTGRFVVHP 973
RVFPVGEANPHLHPLWQTAEQFGAVCT ID+QVTHVVANSLGTDKVNWALSTGRFVV+P
Sbjct: 1114 RVFPVGEANPHLHPLWQTAEQFGAVCTNQIDEQVTHVVANSLGTDKVNWALSTGRFVVYP 1173
Query: 974 GWVEASALLYRRANEQDFAIKP 995
GWVEASALLYRRANEQDFAIKP
Sbjct: 1174 GWVEASALLYRRANEQDFAIKP 1195
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224053553|ref|XP_002297869.1| predicted protein [Populus trichocarpa] gi|222845127|gb|EEE82674.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359473774|ref|XP_002266931.2| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296088169|emb|CBI35661.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356523718|ref|XP_003530482.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356567192|ref|XP_003551805.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449487451|ref|XP_004157633.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal domain phosphatase-like 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449445782|ref|XP_004140651.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357502711|ref|XP_003621644.1| RNA polymerase II C-terminal domain phosphatase-like protein [Medicago truncatula] gi|355496659|gb|AES77862.1| RNA polymerase II C-terminal domain phosphatase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|56547717|gb|AAV92930.1| putative transcription regulator CPL1 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_I7873 | hypothetical protein (1117 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 995 | |||
| TIGR02250 | 156 | TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph | 4e-63 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 1e-47 | |
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 1e-24 | |
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 1e-09 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 6e-08 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 1e-07 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 7e-07 | |
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 3e-06 | |
| pfam12738 | 63 | pfam12738, PTCB-BRCT, twin BRCT domain | 3e-04 |
| >gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
Score = 210 bits (536), Expect = 4e-63
Identities = 72/168 (42%), Positives = 94/168 (55%), Gaps = 15/168 (8%)
Query: 676 MFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPHRHLFRFPHMGMW-- 733
+ +KL LVLDLD TL+++ K + EE + E R L +F MW
Sbjct: 1 LLREKKLHLVLDLDQTLIHTTKDPTLSEWEKY---DIEEPNSE-TRRDLRKFNLGTMWYL 56
Query: 734 TKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPFD 793
TKLRP + FL+ ASKL+EMH+YTMG + YA +AK++DP G F R+ISR + G
Sbjct: 57 TKLRPFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYFGDRIISRDESGS--- 113
Query: 794 GDERVPKSKDLEGVLG-MESAVVIIDDSVRVWPHNKLNLIVVERYTYF 840
P +K L + ES VVIIDD VWP +K NLI +E Y YF
Sbjct: 114 -----PHTKSLLRLFPADESMVVIIDDREDVWPWHKRNLIQIEPYNYF 156
|
This model represents the phosphatase domain of the humanRNA polymerase II subunit A C-terminal domain phosphatase (FCP1, ) and closely related phosphatases from eukaryotes including plants, fungi and slime mold. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDDppphW). This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3.This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the pfam03031. Length = 156 |
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|193214 pfam12738, PTCB-BRCT, twin BRCT domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 995 | |||
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 100.0 | |
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 99.97 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 99.96 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 99.95 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.88 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.84 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.8 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.5 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 99.42 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.35 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 99.29 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 99.19 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 99.17 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 98.47 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 98.41 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 98.17 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.86 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 97.8 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.75 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 97.74 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 97.62 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 97.6 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.59 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 97.56 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.56 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 97.46 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 97.42 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.39 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 97.38 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.37 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 97.19 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 97.18 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 97.07 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 97.06 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 97.05 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 96.99 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 96.94 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.67 | |
| COG5275 | 276 | BRCT domain type II [General function prediction o | 96.64 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 96.63 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.61 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 96.37 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 96.36 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 96.31 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 96.25 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 96.23 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.21 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 96.15 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 96.14 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.06 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 96.03 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 95.96 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 95.72 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 94.75 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 94.52 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 94.47 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 94.47 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 94.38 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 94.2 | |
| PRK08238 | 479 | hypothetical protein; Validated | 93.92 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 93.58 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 93.4 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 93.05 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 92.98 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 92.97 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 92.88 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 92.7 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 92.63 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 92.53 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 92.39 | |
| PRK06769 | 173 | hypothetical protein; Validated | 92.35 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 92.3 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 92.28 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 92.1 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 92.04 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 92.01 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 91.96 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 91.33 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 91.15 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 90.74 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 90.73 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 90.46 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 90.15 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 90.06 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 89.93 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 89.59 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 89.31 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 88.99 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 88.79 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 88.78 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 88.71 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 88.65 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 88.44 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 88.33 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 88.27 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 88.17 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 87.68 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 87.37 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 86.97 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 86.93 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 86.88 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 86.82 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 86.56 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 86.55 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 86.16 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 85.75 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 85.53 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 85.51 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 85.32 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 85.18 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 85.13 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 84.97 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 84.77 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 84.52 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 84.03 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 83.64 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 83.55 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 83.3 | |
| PLN02940 | 382 | riboflavin kinase | 83.29 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 82.65 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 82.3 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 81.84 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 81.49 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 81.41 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 81.29 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 81.25 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 81.23 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 80.93 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 80.7 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 80.4 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 80.16 |
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-47 Score=440.68 Aligned_cols=336 Identities=36% Similarity=0.539 Sum_probs=272.1
Q ss_pred ccCcchhhcCCchhhhhHhhHHHHhhhHHHhhhhcCCCeEEEEeCCCceeecccCCCCCCchhhhhhhhhccccCCCcce
Q 001926 644 WGDVEHLFEGYDDQQKAAIQKERTRRLEEQKKMFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPHRH 723 (995)
Q Consensus 644 ~~~f~~L~~g~~~~q~~~i~ke~akrL~~q~~LLs~kKLTLVLDLDETLVHSs~~~eldP~~~eil~~~Ee~D~~~P~~~ 723 (995)
..-|+++..+++..+.... ..+.+..+..+++.++|+||+|||+||+|+.....+.... .+...+.. ....+..
T Consensus 112 ~~~~~~~~~~~~l~~~~~~---~~~~~~~~~~~~~~~~L~lv~Dld~tllh~~~~~~l~e~~--~~l~~~~~-~~~sn~d 185 (635)
T KOG0323|consen 112 GRSFDYLVKGLQLSNEMVA---FTKTLTTQFSSLNRKKLHLVLDLDHTLLHTILKSDLSETE--KYLKEEAE-SVESNKD 185 (635)
T ss_pred ccchhcccchhhhhhhhhh---hhhHHHHHHHHHhhhcceeehhhhhHHHHhhccchhhhhh--hhcccccc-ccccccc
Confidence 4556788888776665433 5677878888888899999999999999998654333211 11111110 0001223
Q ss_pred eEEec----cceEEEeecccHHHHHHHHhccceEEEEcCCchHHHHHHHHHHcCCCceeeceEEecCCCCCCCCCCCCCC
Q 001926 724 LFRFP----HMGMWTKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPFDGDERVP 799 (995)
Q Consensus 724 lF~~~----~~~~yVKLRPgL~EFLeeLSk~YEIvIFTAGtkeYAd~VLdiLDP~g~lF~~RIySRddc~~~~dG~er~~ 799 (995)
+|+++ ...||||+||++.+||++++++|||||||+|++.||..|+++|||+|.||++|||+|++.. ..
T Consensus 186 l~~~~~~~~~~~~~vKlRP~~~efL~~~sklfemhVyTmg~R~YA~~i~~liDP~~~lF~dRIisrde~~--------~~ 257 (635)
T KOG0323|consen 186 LFRFNPLGHDTEYLVKLRPFVHEFLKEANKLFEMHVYTMGTRDYALEIAKLIDPEGKYFGDRIISRDESP--------FF 257 (635)
T ss_pred ceeecccCCCceEEEEeCccHHHHHHHHHhhceeEEEeccchHHHHHHHHHhCCCCccccceEEEecCCC--------cc
Confidence 44443 2578999999999999999999999999999999999999999999999999999999742 13
Q ss_pred cccccccccCCC-CcEEEEcCCCcccccCccccccccceeeccCcccccCC-----------------------------
Q 001926 800 KSKDLEGVLGME-SAVVIIDDSVRVWPHNKLNLIVVERYTYFPCSRRQFGL----------------------------- 849 (995)
Q Consensus 800 yiKDLsrVLGrd-s~VVIVDDsp~vw~~qpdNgI~IkpY~yF~~s~~q~g~----------------------------- 849 (995)
..+||...+.+. ++||||||+.+||.+++.|+|.|.+|.||.+..+.+..
T Consensus 258 kt~dL~~~~p~g~smvvIIDDr~dVW~~~~~nLI~i~~y~yF~~~gd~nap~~~~~~~~~~~~~~~~~~k~~~~s~~~~~ 337 (635)
T KOG0323|consen 258 KTLDLVLLFPCGDSMVVIIDDRSDVWPDHKRNLIQIAPYPYFSGQGDINAPPPLHVLRNVACSVRGAFFKEFDPSLKSRI 337 (635)
T ss_pred cccccccCCCCCCccEEEEeCccccccCCCcceEEeeeeecccCcccccCCcccccccchhcccccccccccCccccccc
Confidence 567777555665 89999999999999998899999999999987643321
Q ss_pred --------------------------------------------CCCCcccccccCccchhhhHHHHHHHHHHHhhcccc
Q 001926 850 --------------------------------------------LGPSLLEIDHDERSEDGTLASSLGVIERLHKIFFSH 885 (995)
Q Consensus 850 --------------------------------------------p~pSl~Ei~~DedpeD~eLl~LL~fLe~IHq~FF~~ 885 (995)
-..++.+...|+.+.|++|.+++++|+.||..||..
T Consensus 338 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~~~~~de~~~D~~L~~~~kvl~~vH~~ff~~ 417 (635)
T KOG0323|consen 338 SEVRYEDDDESNPTSYSVELSANPGPLKQDGMDEFVPEENAPEARSGSYREKKSDESDEDGELANLLKVLKPVHKGFFAK 417 (635)
T ss_pred ccccccccccccCcccccccccccCcccccccccccccccchhhcccccccccccccccchhHHHHhhhhcccchhhhhc
Confidence 123444555677788999999999999999999997
Q ss_pred C-----CCCcchhHHHHHHHHHhhccCceeEeeecccCCCCCCCChhHHHHHHHhCCEEecccCCCccEEEecCCCCHHH
Q 001926 886 Q-----SLDDVDVRNILAAEQRKILAGCRIVFSRVFPVGEANPHLHPLWQTAEQFGAVCTKHIDDQVTHVVANSLGTDKV 960 (995)
Q Consensus 886 ~-----~L~~~DVR~ILkeiQrkILsGCvIvFSG~~P~~~~~pe~~~LwklAe~LGAtVs~dvd~~VTHLVAss~gTeKv 960 (995)
. .+...|||.+|.++++++|+||.++|||++|.+.+. +...+...+..+|+....+++..+||+|+.+.+|.|+
T Consensus 418 ~~~~~e~~~~~Dvr~~i~~~~~~v~~~~~~vfSg~~P~~~~~-~~s~~~~~~~~~g~vs~~~~~~~~th~i~~~~gt~k~ 496 (635)
T KOG0323|consen 418 YDEVEETLESPDVRLLIPELRTKVLKGSQIVFSGLHPTGSTD-ESADILGVAQQLGAVSAPDVSDKTTHLIAANAGTKKV 496 (635)
T ss_pred cccccccccCCChhhhhhhhhhHHhhccceeecccccCcCCc-chhhhhhhhhcccceecccccchhhhHHhhccCccee
Confidence 5 356799999999999999999999999999987543 2345666789999999999999999999999999999
Q ss_pred HHHHhcC-CcEecHHHHHHHHHhccCCCCCCCCCC
Q 001926 961 NWALSTG-RFVVHPGWVEASALLYRRANEQDFAIK 994 (995)
Q Consensus 961 ~~Alk~G-I~IVSPdWLedC~~~~kRvDEsdYlL~ 994 (995)
.+|...+ ++||++.||+.|...|.+++|..|.+.
T Consensus 497 ~~a~~~~~~~Vv~~~wl~~~~e~w~~v~ek~~~l~ 531 (635)
T KOG0323|consen 497 YKAVVSGSAKVVNAAWLWRSLEKWGKVEEKLEPLD 531 (635)
T ss_pred eccccccceeEechhHHHHHHHHhcchhccccccc
Confidence 9999876 999999999999999999999999863
|
|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >COG5275 BRCT domain type II [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 995 | ||||
| 3ef0_A | 372 | The Structure Of Fcp1, An Essential Rna Polymerase | 8e-24 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 8e-17 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 2e-06 |
| >pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 | Back alignment and structure |
|
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 995 | |||
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 3e-83 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 5e-37 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 3e-30 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 4e-19 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 5e-18 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 6e-16 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 3e-15 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 4e-15 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 4e-15 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 5e-15 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 3e-14 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 2e-13 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 1e-12 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 2e-11 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 4e-11 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 3e-10 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 8e-10 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 4e-09 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 1e-08 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 4e-07 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 4e-07 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 8e-07 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 1e-06 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 1e-06 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 7e-06 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 4e-04 |
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
Score = 273 bits (698), Expect = 3e-83
Identities = 102/383 (26%), Positives = 166/383 (43%), Gaps = 67/383 (17%)
Query: 662 IQKERTRRLEEQKKMFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPH 721
++ E +RL ++ ++L L++DLD T++++ V + + R+
Sbjct: 5 LESENVKRLRQE------KRLSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRS 58
Query: 722 RHLFRFPH---MGMWTKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLF 778
+L P + K RPG+ FL++ S+L+E+H+YTMG K YA E+AK++DP G LF
Sbjct: 59 FNLQEGPSGYTSCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLF 118
Query: 779 AGRVISRGDDGDPFDGDERVPKSKDLEGVLGME-SAVVIIDDSVRVWPHNKLNLIVVERY 837
RV+SR D G K L + + S VV+IDD VW N NLI V Y
Sbjct: 119 QDRVLSRDDSGSLA--------QKSLRRLFPCDTSMVVVIDDRGDVWDWNP-NLIKVVPY 169
Query: 838 TYFP-------------------------------CSRRQFGLLGPSLLEIDHDERSE-- 864
+F S R +LLE +
Sbjct: 170 EFFVGIGDINSNFLSGNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHT 229
Query: 865 -----DGTLASSLGVIERLHKIFFSHQ--------SLDDVDVRNILAAEQRKILAGCRIV 911
D L V++ +H +++ + + +V I+ ++K+L GCR++
Sbjct: 230 LLHNRDHELERLEKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLL 289
Query: 912 FSRVFPVGEANPHLHPLWQTAEQFGAVCTKHIDDQVTHVVANSLGTDKVNWALSTGRF-V 970
FS V P+G + + + A FGA TH++A + T+KV A+S G V
Sbjct: 290 FSGVIPLGV-DVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKV 348
Query: 971 VHPGWVEASALLYRRANEQDFAI 993
V W+ S ++R E D+ +
Sbjct: 349 VKLNWLTESLSQWKRLPESDYLL 371
|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Length = 209 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 995 | |||
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 99.97 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.96 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.95 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.75 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.73 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.72 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.7 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.67 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.66 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.59 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.55 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.49 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.48 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.46 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.42 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.41 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.38 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.37 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.3 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.25 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.21 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.17 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 99.09 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.07 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.06 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.03 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 98.95 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 98.95 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 98.86 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.79 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 98.79 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 98.77 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 98.71 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 98.66 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.56 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.55 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 98.54 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 98.45 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.35 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 98.19 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.18 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.1 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 97.97 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 97.85 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 97.77 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.53 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.45 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 97.42 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.39 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.34 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.26 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.14 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 97.13 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 97.11 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.09 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 97.07 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.06 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.0 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 96.99 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 96.94 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 96.83 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 96.74 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 96.55 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 96.43 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 96.4 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.38 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 96.27 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 96.25 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 96.17 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 96.07 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 95.96 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 95.87 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 95.82 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 95.74 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 95.63 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 95.49 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 95.43 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 95.36 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 95.29 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 95.02 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 94.96 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 94.69 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 94.64 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.27 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 94.18 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 94.08 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.08 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 93.82 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 93.12 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 93.02 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 92.91 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 92.69 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 92.65 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 92.64 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 92.32 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 92.07 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 92.04 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 91.97 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 91.94 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 91.85 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 91.78 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 91.59 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 91.58 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 91.28 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 91.09 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 90.89 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 90.84 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 90.66 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 90.34 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 90.29 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 90.28 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 89.88 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 89.64 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 89.62 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 89.53 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 89.34 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 89.05 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 88.92 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 88.37 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 88.2 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 88.04 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 87.99 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 87.7 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 87.61 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 87.43 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 87.37 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 87.14 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 87.14 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 87.04 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 86.93 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 86.2 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 86.18 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 86.14 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 85.97 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 85.88 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 85.73 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 85.73 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 85.6 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 85.33 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 84.88 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 84.69 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 84.12 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 84.03 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 83.87 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 83.65 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 83.41 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 83.04 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 82.94 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 82.92 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 82.81 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 82.66 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 82.63 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 82.53 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 82.26 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 82.11 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 81.82 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 81.57 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 81.49 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 81.1 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 80.87 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 80.71 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 80.41 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 80.21 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 80.19 |
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-62 Score=552.04 Aligned_cols=318 Identities=32% Similarity=0.525 Sum_probs=258.0
Q ss_pred hhHHHHhhhHH--HhhhhcCCCeEEEEeCCCceeecccCCCCCCchhhhhhhhhcccc-CCCcceeEEec------cceE
Q 001926 662 IQKERTRRLEE--QKKMFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDR-EKPHRHLFRFP------HMGM 732 (995)
Q Consensus 662 i~ke~akrL~~--q~~LLs~kKLTLVLDLDETLVHSs~~~eldP~~~eil~~~Ee~D~-~~P~~~lF~~~------~~~~ 732 (995)
++.+.|.++.. +++|+..+||+||||||||||||+. +|...+|.......+. ...+...|.++ .+.|
T Consensus 5 vs~~~a~~~~~~~~~rll~~~Kl~LVLDLDeTLiHs~~----~~~~~~~~~~~~~~~~~~~~dv~~F~l~~~~~~~~~~~ 80 (442)
T 3ef1_A 5 VSLEEASRLESENVKRLRQEKRLSLIVXLDQTIIHATV----DPTVGEWMSDPGNVNYDVLRDVRSFNLQEGPSGYTSCY 80 (442)
T ss_dssp HHHHHHHHHHHHHHHHHHHTTCEEEEECCBTTTEEEEC----CTHHHHHHTCTTSTTTGGGTTCEEEEEEETTTTEEEEE
T ss_pred ecHHHHHHHHHHHHHHHHhcCCeEEEEeeccceecccc----ccccchhccCCCCcchhhhccccceeeeeccCCceeEE
Confidence 34456666655 5689999999999999999999984 4544444321100000 01122346553 2579
Q ss_pred EEeecccHHHHHHHHhccceEEEEcCCchHHHHHHHHHHcCCCceeeceEEecCCCCCCCCCCCCCCcccccccccCCC-
Q 001926 733 WTKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPFDGDERVPKSKDLEGVLGME- 811 (995)
Q Consensus 733 yVKLRPgL~EFLeeLSk~YEIvIFTAGtkeYAd~VLdiLDP~g~lF~~RIySRddc~~~~dG~er~~yiKDLsrVLGrd- 811 (995)
||++||||++||++|+++|||+|||++.+.||++|++.|||.+.||.+|+|+|++|+. .|+|||+++|||+
T Consensus 81 ~V~~RPgl~eFL~~ls~~yEivIfTas~~~YA~~Vl~~LDp~~~~f~~Rl~sRd~cg~--------~~~KdL~~ll~rdl 152 (442)
T 3ef1_A 81 YIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGS--------LAQKSLRRLFPCDT 152 (442)
T ss_dssp EEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHHCTTSTTTTTCEECTTTSSC--------SSCCCGGGTCSSCC
T ss_pred EEEeCCCHHHHHHHHhCCcEEEEEcCCCHHHHHHHHHHhccCCccccceEEEecCCCC--------ceeeehHHhcCCCc
Confidence 9999999999999999999999999999999999999999999999999999998852 4789999888999
Q ss_pred CcEEEEcCCCcccccCccccccccceeeccCccc---------c-----cCC-C--CCCccc------------------
Q 001926 812 SAVVIIDDSVRVWPHNKLNLIVVERYTYFPCSRR---------Q-----FGL-L--GPSLLE------------------ 856 (995)
Q Consensus 812 s~VVIVDDsp~vw~~qpdNgI~IkpY~yF~~s~~---------q-----~g~-p--~pSl~E------------------ 856 (995)
++||||||++.+|..|+ |+|+|++|+||.+..+ + +++ + .|+...
T Consensus 153 ~~vvIIDd~p~~~~~~p-N~I~I~~~~fF~~~gD~n~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 231 (442)
T 3ef1_A 153 SMVVVIDDRGDVWDWNP-NLIKVVPYEFFVGIGDINSNFLAKSTPLPEQEQLIPLEIPKDEPDSVDEINEENEETPEYDS 231 (442)
T ss_dssp TTEEEEESCSGGGTTCT-TEEECCCCCCSTTCCCSCC-------------------------------------------
T ss_pred ceEEEEECCHHHhCCCC-CEEEcCCccccCCCCcccccccccccccccccccccccccccccccccccccccccCccccc
Confidence 99999999999999997 9999999999987421 1 222 1 110000
Q ss_pred -------------------------------------------------------ccccC----------ccchhhhHHH
Q 001926 857 -------------------------------------------------------IDHDE----------RSEDGTLASS 871 (995)
Q Consensus 857 -------------------------------------------------------i~~De----------dpeD~eLl~L 871 (995)
.+.|| ..+|++|..|
T Consensus 232 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~rpl~~~q~~l~~~~~~~~~~~~~l~d~D~~L~~l 311 (442)
T 3ef1_A 232 SNSSYAQDSSTIPEKTLLKDTFLQNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELERL 311 (442)
T ss_dssp ---------------------------CHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTSCCSCHHHHCSCCCCCCHHHHH
T ss_pred ccccccccccccchhhhhccccCccchhhHHHHHHhhhhhhhhhccCchhhHHHHhhhhhhccccccccccCCcHHHHHH
Confidence 00011 1358999999
Q ss_pred HHHHHHHHhhccccCCC--------CcchhHHHHHHHHHhhccCceeEeeecccCCCCCCCChhHHHHHHHhCCEEeccc
Q 001926 872 LGVIERLHKIFFSHQSL--------DDVDVRNILAAEQRKILAGCRIVFSRVFPVGEANPHLHPLWQTAEQFGAVCTKHI 943 (995)
Q Consensus 872 L~fLe~IHq~FF~~~~L--------~~~DVR~ILkeiQrkILsGCvIvFSG~~P~~~~~pe~~~LwklAe~LGAtVs~dv 943 (995)
+.+|.+||++||+.++. ...||+.||.++++++|+||+|||||++|.+. ++++..+|++|+.+||+|..++
T Consensus 312 ~~~L~~iH~~fy~~~d~~~~~~~~~~~~Dv~~il~~~k~~~L~G~~IvfSG~~p~~~-~~~r~~l~~~~~~lGa~~~~~v 390 (442)
T 3ef1_A 312 EKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIPLGV-DVLSSDIAKWAMSFGAEVVLDF 390 (442)
T ss_dssp HHHHHHHHHHHHHHHHTCCSCCSSSCCCCHHHHHHHHHHTTSTTCEEEEESSSCTTS-CSTTSHHHHHHHTTTCEECSSS
T ss_pred HHHHHHHHHHHHHHhhhcccccccCCCCcHHHHHHHHhhcccCCcEEEEecccCCCC-CccHHHHHHHHHHcCCEEeCCC
Confidence 99999999999987532 34799999999999999999999999998754 4567899999999999999999
Q ss_pred CCCccEEEecCCCCHHHHHHHhc-CCcEecHHHHHHHHHhccCCCCCCCCC
Q 001926 944 DDQVTHVVANSLGTDKVNWALST-GRFVVHPGWVEASALLYRRANEQDFAI 993 (995)
Q Consensus 944 d~~VTHLVAss~gTeKv~~Alk~-GI~IVSPdWLedC~~~~kRvDEsdYlL 993 (995)
+++||||||...+|.|+++|+++ ||+||+++||++|+..|+|+||..|+|
T Consensus 391 s~~vTHLVa~~~~t~K~~~A~~~g~IkIVs~~WL~dcl~~~krldE~~YlL 441 (442)
T 3ef1_A 391 SVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQWKRLPESDYLL 441 (442)
T ss_dssp SSCCSEEEECSCCCHHHHHHHHHSSSEEEEHHHHHHHHHHTSCCCGGGTBC
T ss_pred CCCceEEEeCCCCCHHHHHHHhcCCCEEEeHHHHHHHHHcCCcCChhcccc
Confidence 99999999999999999999998 599999999999999999999999987
|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 995 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 3e-26 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 1e-10 | |
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 2e-08 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 2e-07 | |
| d1zx0a1 | 229 | c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe | 0.002 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 104 bits (260), Expect = 3e-26
Identities = 37/169 (21%), Positives = 62/169 (36%), Gaps = 21/169 (12%)
Query: 673 QKKMFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPHRHLFRFPHMGM 732
+ K + K+C+V+DLD TL++S K + + +
Sbjct: 7 EAKAQDSDKICVVIDLDETLVHS--------------SFKPVNNADFIIPVEIDGVVHQV 52
Query: 733 WTKLRPGIWTFLERASKLFEMHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPF 792
+ RP + FL+R +LFE L+T YA +A +LD G A
Sbjct: 53 YVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGN 112
Query: 793 DGDERVPKSKDLEGVLGMESAVVIIDDSVRVWPHNKLNLIVVERYTYFP 841
KDL + V+I+D+S + + N + V +
Sbjct: 113 YV-------KDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNM 154
|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 995 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.62 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.6 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.53 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.52 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 99.06 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 98.98 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.06 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.52 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.27 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 97.15 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.11 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 96.92 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 96.87 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 95.55 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 95.55 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 94.74 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 94.27 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 94.01 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 93.9 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 93.82 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 93.79 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 93.62 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 93.47 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 92.46 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 92.12 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 91.62 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 90.94 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 90.63 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 90.53 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 90.3 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 90.19 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 90.19 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 90.07 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 88.41 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 87.66 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 87.58 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 87.26 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 86.57 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 86.33 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 86.29 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 85.86 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 85.78 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 84.38 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 83.41 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 83.04 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 82.88 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 82.66 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 81.83 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.1e-36 Score=302.26 Aligned_cols=169 Identities=29% Similarity=0.374 Sum_probs=137.5
Q ss_pred hhcCCCeEEEEeCCCceeecccCCCCCCchhhhhhhhhccccCCCcceeEEec--cceEEEeecccHHHHHHHHhccceE
Q 001926 676 MFSARKLCLVLDLDHTLLNSAKFHEVDPVHDEILRKKEEQDREKPHRHLFRFP--HMGMWTKLRPGIWTFLERASKLFEM 753 (995)
Q Consensus 676 LLs~kKLTLVLDLDETLVHSs~~~eldP~~~eil~~~Ee~D~~~P~~~lF~~~--~~~~yVKLRPgL~EFLeeLSk~YEI 753 (995)
....+|++||||||||||||.......+ + ....+... ...+||++|||+++||++|+++|||
T Consensus 10 ~~~~~k~~LVLDLDeTLihs~~~~~~~~------------~----~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei 73 (181)
T d1ta0a_ 10 AQDSDKICVVIDLDETLVHSSFKPVNNA------------D----FIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFEC 73 (181)
T ss_dssp GGGTTSCEEEECCBTTTEEEESSCCTTC------------S----EEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEE
T ss_pred cccCCCeEEEEeCCCCEEccccCCCCCc------------c----ceeeecccceeeeeEEecCCCHHHHHHHHHhceEE
Confidence 3457899999999999999975221100 0 01112222 3468999999999999999999999
Q ss_pred EEEcCCchHHHHHHHHHHcCCCceeeceEEecCCCCCCCCCCCCCCcccccccccCCC-CcEEEEcCCCcccccCccccc
Q 001926 754 HLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDGDPFDGDERVPKSKDLEGVLGME-SAVVIIDDSVRVWPHNKLNLI 832 (995)
Q Consensus 754 vIFTAGtkeYAd~VLdiLDP~g~lF~~RIySRddc~~~~dG~er~~yiKDLsrVLGrd-s~VVIVDDsp~vw~~qpdNgI 832 (995)
+|||||+++||++|++.|||++. |..++| |++|.. ..+ .++|||+ .+|++ ++||||||++.+|..|++|+|
T Consensus 74 ~I~Ta~~~~YA~~il~~ldp~~~-~~~~~~-r~~c~~-~~~----~~~KdL~-~l~~~l~~vvivDd~~~~~~~~~~N~I 145 (181)
T d1ta0a_ 74 VLFTASLAKYADPVADLLDKWGA-FRARLF-RESCVF-HRG----NYVKDLS-RLGRDLRRVLILDNSPASYVFHPDNAV 145 (181)
T ss_dssp EEECSSCHHHHHHHHHHHCSSCC-EEEEEC-GGGSEE-ETT----EEECCGG-GSCSCGGGEEEECSCGGGGTTCGGGBC
T ss_pred EEEcCCcHHHHHHHHHHhccCCc-eeEEEE-eeeeee-cCC----cccccHh-hcCCCHHHeEEEcCChhhhhcCccCee
Confidence 99999999999999999999985 555555 777742 222 5899999 68999 999999999999999999999
Q ss_pred cccceeeccCcccccCCCCCCcccccccCccchhhhHHHHHHHHHHHhhccccCCCCcchhHHHHHH
Q 001926 833 VVERYTYFPCSRRQFGLLGPSLLEIDHDERSEDGTLASSLGVIERLHKIFFSHQSLDDVDVRNILAA 899 (995)
Q Consensus 833 ~IkpY~yF~~s~~q~g~p~pSl~Ei~~DedpeD~eLl~LL~fLe~IHq~FF~~~~L~~~DVR~ILke 899 (995)
+|++|.+ +++|.+|..++++|++|++ .+|||++|++
T Consensus 146 ~I~~f~~----------------------~~~D~eL~~l~~~L~~l~~---------~~DVR~~l~~ 181 (181)
T d1ta0a_ 146 PVASWFD----------------------NMSDTELHDLLPFFEQLSR---------VDDVYSVLRQ 181 (181)
T ss_dssp CCCCCSS----------------------CTTCCHHHHHHHHHHHHTT---------CSCHHHHHCC
T ss_pred EecCcCC----------------------CCCcHHHHHHHHHHHHHcc---------CCcHHHHhcC
Confidence 9999962 4679999999999999985 7899999963
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|