Citrus Sinensis ID: 001951

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990--
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQV
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEccccccccccccccccccEEEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHccccccccEEEEEccccccccccccccccccccEEEcccccccccccccccccccccHHHHcccccccEEEEEcccccccccccccccccccEEEEccccccccccccccEEEEEcccccccHHHcccccccEEEcccccccccccccccccccccccEEEEEcccccEEEEcccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEccccccccccccccccccccccEEEEEcccccccccccHHHcccccccEEEEEccccccEEcccccccccccccccccccEEEEEccccccEEcccccccccccccEEEEEEcccccEEccccccccccccEEccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEEEccccccccccHHHHHHccccccccEEEEcccccccEEcccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccc
cHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEHHHHHHHHHHHHHcccccEEEEccccccccccHHHHccEEEEEEccccHHHccccccccccEEEEEccccccccccHHHHHcccccEEEEccccccccccccHHHHHcccEEEcccccccccHHHHHHcccEEEEcccccHHHccHHHHHHHccEEEEccccccccEccccHHHccHcccEEEEcccccEEEccccccccccccHHHHHHcccccEEEEEEccccccccHccHHHHHHEEEEEcccccccccccHHHHHHccccccccHHHHHHHHcccEEEEEccccccccccccccccccccEEEEEEccccEEEEccccccccccccccccEEEEccHHcHHHHccccccccccccccEEEEcccHHHHHcccHHHHHccccccEEEEcccHcHHHccccccccccccccccccccccccEEEEcccccccccccccccccccccEEcccccccccHHccccccccccccccccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccHHHHHHHHcccEEEEEccccHHHHcccccccccccccccccHcEEEHcccHcccHccccccccccccccEEEEccccccEEcccccccccccccEEEEEccccccHHcHHccccHHHHcHccHHHHHHHcccccHHHHHHHHHcHEEEEccccccHHHHHHcccccEEEEEccccEEEcccccccccccccccccEEEEcccHHHHHcccccccccccccccEEEEEcccccccccccccccccccEEEEEcccHHHHHcccHHHHHHHHcccEEEEcccHHHHHHHcccccccccccccccccEEEEccccccHHccccccccccccccEEEEEccccccEcccccccccccEEEEEEcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEcccccccc
mdllkygtglhifkgtytMQETRDRLYALVHKLKDYcllldgptedwIRMHDLVREVAISIASRDRHVFMLRNDIQIEwpvadmlkncptiflhdckhwevpegleypqleffcmsprdhsikipnhvFAGMSNLRGLALSnmqflslpslfhlplnlqtlcldrcalgdiaiignLKKLEILSLVDSNIEQLPEEMAQLTQLRLfdlsgcsklkvippnllsglsrledlymgnTSVKWEFeglnvgrsnaSLQELKLLSHLTTLEIQICDamilpkglfskKLERYKIFigdewdwsgnyknkrVLKLKLYTSNVDEVIMQLKGIEElyldevpgiknVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqtlnvincknmkeiftvgrendvdchevdkiefsqlhsltlkflpqlTSFYSQVKTSAASQTRLKElsthtlpreviledecdtlmpffnekvvfpnletlELCAISTEKIWCNQLAAVYSQNLTRLIVHGCeklkylfpssmirnfvqLEHLEICYcsslesivgkesgeeatttfvfpKVTFLKLwnlselktfypgthtskwpmlkklevygcdkvkiFTSRFLRFQeinegqfdiptqQALFLVEKVTSKLEELKLSGKDIAMICQsqfpkhifrnlknlevvndesenfRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLinlvpssasfknltTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISkeedvaedEIVFSKLKWVSLERLEnltsfcsgnytlkfpsledlfviecpkmkifshrvlstprlrevrqnwglykgcwegdLNTTIQQLQKnelplllpiassssslaapttgnqvplnlsgnrktqv
mdllkygtglhifkgtytmqeTRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISiasrdrhvFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFigdewdwsgnykNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAasqtrlkelsthtlprevILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTfypgthtskwpmlKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLvtsstakslVCLTKLRIDGCRMLTEIiskeedvaedeIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKifshrvlstprlREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSsslaapttgnqvplnlsgnrktqv
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQflslpslfhlplnlQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNElplllpiassssslaapTTGNQVPLNLSGNRKTQV
***LKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKT*******LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLP*****************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRE******EVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVG**********FVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFS**********LTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIIS*********IVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPL**********************NLSGNRKT**
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQ**********LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQV
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDV*CHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSS**LAAPTTGNQVP***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query992 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.480 0.519 0.266 1e-30
Q9T048985 Disease resistance protei no no 0.411 0.414 0.260 1e-23
Q42484909 Disease resistance protei no no 0.393 0.429 0.247 8e-16
O35930734 Platelet glycoprotein Ib yes no 0.184 0.249 0.296 6e-07
Q9SH22884 Probable disease resistan no no 0.403 0.452 0.232 3e-06
P07359626 Platelet glycoprotein Ib yes no 0.139 0.220 0.296 1e-05
Q01513 2145 Adenylate cyclase OS=Podo yes no 0.083 0.038 0.369 3e-05
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.108 0.105 0.351 0.0001
Q9SI85893 Probable disease resistan no no 0.393 0.436 0.224 0.0001
Q8N9N7239 Leucine-rich repeat-conta no no 0.087 0.364 0.416 0.0004
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 132/496 (26%), Positives = 223/496 (44%), Gaps = 19/496 (3%)

Query: 2   DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAI-- 59
           +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct: 383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query: 60  -SIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
            S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct: 443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query: 118 RDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRC-ALGDIAIIGN 176
             H  ++PN       NLR L LS ++  +LP  F    +L++L L  C  L ++  + +
Sbjct: 503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query: 177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
           L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct: 563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query: 237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGL--FSKKLERYKIFIGD 294
           +  W  +G       A+L E+  L HL  L I++ D +         +K+L +++     
Sbjct: 623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query: 295 EWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIE---GFL 351
               S     +  L +     +   +   L+ +  L L+   G+  +  +L  +    F+
Sbjct: 682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query: 352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
            +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct: 742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query: 411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFS 469
           +++V  C +LK +FS   + G LP LQ + V++C  ++E+F         C E       
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAES---LLP 855

Query: 470 QLHSLTLKFLPQLTSF 485
           +L  + LK+LPQL S 
Sbjct: 856 KLTVIKLKYLPQLRSL 871
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|P07359|GP1BA_HUMAN Platelet glycoprotein Ib alpha chain OS=Homo sapiens GN=GP1BA PE=1 SV=1 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
359488108 1436 PREDICTED: disease resistance protein At 0.935 0.646 0.406 1e-171
296087872 1152 unnamed protein product [Vitis vinifera] 0.854 0.736 0.424 1e-166
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.873 0.659 0.408 1e-162
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.836 0.619 0.390 1e-160
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.876 0.649 0.400 1e-157
255563252 1603 Disease resistance protein RPS5, putativ 0.859 0.532 0.413 1e-156
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.901 0.667 0.386 1e-151
359488027 1520 PREDICTED: disease resistance protein At 0.925 0.603 0.378 1e-151
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.883 0.356 0.405 1e-151
147787802 1517 hypothetical protein VITISV_005047 [Viti 0.897 0.586 0.362 1e-145
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  610 bits (1573), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 407/1001 (40%), Positives = 572/1001 (57%), Gaps = 73/1001 (7%)

Query: 2    DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
            DLLKYG GL +F+GT T++E ++R+ ALV  LK    LL+     ++RMHDLVR  A  I
Sbjct: 421  DLLKYGVGLRLFQGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFVRMHDLVRSTARKI 480

Query: 62   ASRDRHVFMLRND-IQIE-WPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFF-CMSPR 118
            AS   HVF L+N  +++E WP  D L+    + LHDC   E+PEGL  P+LE F C    
Sbjct: 481  ASDQHHVFTLQNTTVRVEGWPRIDELQKVTWVSLHDCDIRELPEGLACPKLELFGCYDVN 540

Query: 119  DHS-IKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNL 177
             +S ++IPN+ F  M  L+ L LS MQ  SLP   H   NL+TLCLD C LG+I II  L
Sbjct: 541  TNSAVQIPNNFFEEMKQLKVLDLSRMQLPSLPLSCHCRTNLRTLCLDGCNLGEIVIIAEL 600

Query: 178  KKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTS 237
            KKLEILSL  S+IE+LP E+AQLT LRLFDL G  KLKVIPP+++S LS+LEDL M N+ 
Sbjct: 601  KKLEILSLTYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISSLSQLEDLCMENSF 660

Query: 238  VKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWD 297
             +WE E    G+SNA L ELK LSHLT+L+IQI DA +LPK +    L RY+IF+GD W 
Sbjct: 661  TQWEGE----GKSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDTLVRYRIFVGDVWS 716

Query: 298  WSGNYKNKRVLKLKLYTSN---VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLK 354
            W G  +  + L+L  + ++   VD +I  LK  E+L+L E+ G  NVL  LD EGFL+LK
Sbjct: 717  WGGISEANKTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNVLSKLDGEGFLKLK 776

Query: 355  HLHVQNNPFILFIVDSMAWV-RYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIK 413
            HL+V+++P I +IV+SM     + AF ++E+L L+ LI+L+++C GQ  A SF  L+ ++
Sbjct: 777  HLNVESSPEIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFPAGSFGCLRKVE 836

Query: 414  VRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHS 473
            V +CD LK +FS S  RGL +L+   V  CK+M E+ + GR+ ++    V+   F +L S
Sbjct: 837  VEDCDGLKFLFSLSVARGLSRLEETKVTRCKSMVEMVSQGRK-EIKEDAVNVPLFPELRS 895

Query: 474  LTLKFLPQLTSF-YSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPN 532
            LTL+ LP+L++F + +    +   + +   ST  L +  I + +       F+   +  N
Sbjct: 896  LTLEDLPKLSNFCFEENPVLSKPASTIVGPSTPPLNQPEIRDGQL-----LFS---LGGN 947

Query: 533  LETLEL-CAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLF---------------PS 576
            L +L L   +S  K++   L     QNL  L V  C+KL+ +F               P 
Sbjct: 948  LRSLNLKKCMSLLKLFPPSLL----QNLQELTVENCDKLEQVFDLEELNVDDGHVGLLPK 1003

Query: 577  SMIRNFVQLEHLE-ICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFY-PG 634
                  + L  L  IC C S  +              +FPK+ ++ L  L  L +F  PG
Sbjct: 1004 LGKLRLIDLPKLRHICNCGSSRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSPG 1063

Query: 635  THT------------------SKWPMLKKLEVYGCDKVKIFTSRFLRFQEIN-EGQFDIP 675
             H+                   +WP+L++L V  C K+ +F      FQ+ + EG  D+P
Sbjct: 1064 YHSLQRLHHADLDTPFPVLFDERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNLDMP 1123

Query: 676  TQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIG--F 733
                 FL       LEEL+L       I   QFP   F  L+ L V +       I    
Sbjct: 1124 L---FFLPHVAFPNLEELRLGDNRDTEIWPEQFPVDSFPRLRVLHVHDYRDILVVIPSFM 1180

Query: 734  LERFHNLEKLEL-RWSSYKEIFSNEEIVE--HAEMLTQVKSLKLWELSDLMYIWKQDSKL 790
            L+R HNLE L++   SS KE+F  E + E   A+ L +++ ++L +L  L  +WK++S+ 
Sbjct: 1181 LQRLHNLEVLKVGSCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSEP 1240

Query: 791  DSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKL 850
                ++LESLEVW C +LINLVPSS SF+NL TL++  C  L +L++ S AKSLV L  L
Sbjct: 1241 GLDLQSLESLEVWNCGSLINLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKSLVKLKTL 1300

Query: 851  RIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVI 910
            +I    M+ E+++ E   A DEI F KL+ + L  L NLTSF SG Y   FPSLE + V 
Sbjct: 1301 KIGRSDMMEEVVANEGGEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQMLVK 1360

Query: 911  ECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQ 951
            ECPKMK+FS  +++ PRL+ ++   G  +  W+ DLNT I 
Sbjct: 1361 ECPKMKMFSPSLVTPPRLKRIK--VGDEEWPWQDDLNTAIH 1399

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.478 0.516 0.264 2.6e-29
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.412 0.415 0.254 1.8e-19
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.282 0.308 0.237 0.00027
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.412 0.340 0.237 1.3e-08
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.265 0.132 0.242 1.4e-06
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.196 0.219 0.254 1.8e-07
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.116 0.131 0.323 3.8e-07
MGI|MGI:1333744734 Gp1ba "glycoprotein 1b, alpha 0.174 0.235 0.292 3.1e-06
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.192 0.218 0.235 3.5e-06
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.091 0.102 0.306 3.8e-06
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 2.6e-29, Sum P(2) = 2.6e-29
 Identities = 131/496 (26%), Positives = 220/496 (44%)

Query:     2 DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
             +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct:   383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query:    62 ASRDR---HVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
              S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct:   443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query:   118 RDHSIKIPNHVFAGMSNLRGLALSNMQXXXXXXXXXXXXXXQTLCLDRCA-LGDIAIIGN 176
               H  ++PN       NLR L LS ++              ++L L  C  L ++  + +
Sbjct:   503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query:   177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
             L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct:   563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query:   237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFS--KKLERYKIFIGD 294
             +  W  +G       A+L E+  L HL  L I++ D +       S  K+L +++     
Sbjct:   623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query:   295 EWDWSGNYKNKRVLKLK-LYTSN--VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFL 351
                 S     +  L +  +  SN  +  ++  +  ++  Y + + G+   L       F+
Sbjct:   682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query:   352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
              +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct:   742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query:   411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVD-CHEVDKIEF 468
             +++V  C +LK +FS   + G LP LQ + V++C  ++E+F       VD C E      
Sbjct:   799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSV-PVDFCAES---LL 854

Query:   469 SQLHSLTLKFLPQLTS 484
              +L  + LK+LPQL S
Sbjct:   855 PKLTVIKLKYLPQLRS 870
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1333744 Gp1ba "glycoprotein 1b, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 53.0 bits (127), Expect = 9e-07
 Identities = 70/255 (27%), Positives = 103/255 (40%), Gaps = 52/255 (20%)

Query: 393 LEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE---- 448
           LEK+  G     S   L+ I +R    LK I   S       L+TL + +C ++ E    
Sbjct: 623 LEKLWDG---VHSLTGLRNIDLRGSKNLKEIPDLSMA---TNLETLKLSDCSSLVELPSS 676

Query: 449 IFTVGRENDVDCHEVDKIE-------FSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKE 501
           I  + +  D+D    + +E          L+ L L    +L SF     ++  S   L E
Sbjct: 677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDE 734

Query: 502 LSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQ-----LAAVYS 556
            +    P  + LE                 NL+ L LC + +EK+W        L  + S
Sbjct: 735 TAIEEFPSNLRLE-----------------NLDELILCEMKSEKLWERVQPLTPLMTMLS 777

Query: 557 QNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPK 616
            +LTRL +     L  L PSS I+N  +LEHLEI  C +LE++          T      
Sbjct: 778 PSLTRLFLSDIPSLVEL-PSS-IQNLHKLEHLEIENCINLETL---------PTGINLES 826

Query: 617 VTFLKLWNLSELKTF 631
           +  L L   S L+TF
Sbjct: 827 LESLDLSGCSRLRTF 841

syringae 6; Provisional. Length = 1153
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 992
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.97
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.47
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG4237498 consensus Extracellular matrix protein slit, conta 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.22
KOG4341483 consensus F-box protein containing LRR [General fu 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.99
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.73
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.51
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.31
PLN03150623 hypothetical protein; Provisional 98.31
PRK15386 426 type III secretion protein GogB; Provisional 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.23
PLN03150623 hypothetical protein; Provisional 98.22
PRK15386 426 type III secretion protein GogB; Provisional 98.21
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.98
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.93
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.83
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.82
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.77
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.66
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.73
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.62
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.67
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.4
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.83
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.7
smart0037026 LRR Leucine-rich repeats, outliers. 89.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.72
smart0037026 LRR Leucine-rich repeats, outliers. 84.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.65
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.46
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.8e-34  Score=356.90  Aligned_cols=512  Identities=19%  Similarity=0.171  Sum_probs=283.4

Q ss_pred             CCCCEEEeecCCCccc-CCCC-CCCCccEEEcCCCCCCCCcChhhhcCCCCCcEEEeeCCcCc-cCCcccCCCCCCcEEE
Q 001951           86 KNCPTIFLHDCKHWEV-PEGL-EYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFL-SLPSLFHLPLNLQTLC  162 (992)
Q Consensus        86 ~~~r~l~l~~~~~~~l-~~~~-~~~~Lr~L~l~~~~~~~~~~~~~~~~l~~Lr~L~Ls~~~i~-~lp~~i~~l~~Lr~L~  162 (992)
                      .+++.|+++++.+... +..+ .+++|++|++++|.+...+|..+|.++++||+|++++|.+. .+|.  +.+++|++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~  146 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLD  146 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEE
Confidence            4678888888876533 3333 68888889888888877788888888888999998888876 4553  5678888899


Q ss_pred             ccCCCCCC-c-ccccCcccCcEEEccCCCCC-CCChhhhCCCCcCEEeecCCCCCCccCccccCCCCCCCEEEeecCccc
Q 001951          163 LDRCALGD-I-AIIGNLKKLEILSLVDSNIE-QLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVK  239 (992)
Q Consensus       163 L~~~~l~~-l-~~i~~L~~L~~L~L~~~~l~-~LP~~i~~L~~L~~L~l~~~~~l~~~p~~~i~~L~~L~~L~l~~~~~~  239 (992)
                      +++|.+.. + ..++++++|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|++|++++|.+.
T Consensus       147 Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~  225 (968)
T PLN00113        147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNLS  225 (968)
T ss_pred             CcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCccC
Confidence            88888762 3 67888888899998888765 67888888888888888888744566766 788888888888888765


Q ss_pred             ccccccccCCCCCChhhhcCCCCCCEEEeeccCCc-cCCCccccCCccEEEEEeCCccCccCCcCcceEEEeecccCChH
Q 001951          240 WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAM-ILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVD  318 (992)
Q Consensus       240 ~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~  318 (992)
                                 +..+..++++++|++|++++|.+. .+|..+                                      
T Consensus       226 -----------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l--------------------------------------  256 (968)
T PLN00113        226 -----------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL--------------------------------------  256 (968)
T ss_pred             -----------CcCChhHhcCCCCCEEECcCceeccccChhH--------------------------------------
Confidence                       345667888888888888887653 233322                                      


Q ss_pred             HHHHhhcccceeeccccCCcccccccccccccccccEEEeecCCCeeEEecCCCccccccccccceeeccccccccceec
Q 001951          319 EVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICL  398 (992)
Q Consensus       319 ~~~~~l~~L~~L~L~~~~~~~~~~~~l~~~~l~~L~~L~l~~~~~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~  398 (992)
                         ..+++|+.|++.++. +....|. .+..+++|++|++++|.-...++     .....+++|+.|++.++......  
T Consensus       257 ---~~l~~L~~L~L~~n~-l~~~~p~-~l~~l~~L~~L~Ls~n~l~~~~p-----~~~~~l~~L~~L~l~~n~~~~~~--  324 (968)
T PLN00113        257 ---GNLKNLQYLFLYQNK-LSGPIPP-SIFSLQKLISLDLSDNSLSGEIP-----ELVIQLQNLEILHLFSNNFTGKI--  324 (968)
T ss_pred             ---hCCCCCCEEECcCCe-eeccCch-hHhhccCcCEEECcCCeeccCCC-----hhHcCCCCCcEEECCCCccCCcC--
Confidence               334445555554422 1111111 11445556666665553111110     11233445555555443211111  


Q ss_pred             CCCCchhcCCccEEEEecCCCCccccchhhhcccCcccEEEeccccCchhhhcccccCCccCCCccceecCcccEEeecC
Q 001951          399 GQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKF  478 (992)
Q Consensus       399 ~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~  478 (992)
                       +.....+++|+.|++.+|.-...+|  ..++.+++|+.|+++++.-...++.            ....+++|+.|++.+
T Consensus       325 -~~~~~~l~~L~~L~L~~n~l~~~~p--~~l~~~~~L~~L~Ls~n~l~~~~p~------------~~~~~~~L~~L~l~~  389 (968)
T PLN00113        325 -PVALTSLPRLQVLQLWSNKFSGEIP--KNLGKHNNLTVLDLSTNNLTGEIPE------------GLCSSGNLFKLILFS  389 (968)
T ss_pred             -ChhHhcCCCCCEEECcCCCCcCcCC--hHHhCCCCCcEEECCCCeeEeeCCh------------hHhCcCCCCEEECcC
Confidence             1112345566666666543222232  2245566666666665432222220            112344555555555


Q ss_pred             CCccccccccccchhhhhcccccccccCCCceeecccccCcccccccccccccccceeeccccccccccccCccccccCC
Q 001951          479 LPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQN  558 (992)
Q Consensus       479 ~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~  558 (992)
                      ++-...++.    .+..                                  +++|+.|++++|.++...+..+.  .+++
T Consensus       390 n~l~~~~p~----~~~~----------------------------------~~~L~~L~L~~n~l~~~~p~~~~--~l~~  429 (968)
T PLN00113        390 NSLEGEIPK----SLGA----------------------------------CRSLRRVRLQDNSFSGELPSEFT--KLPL  429 (968)
T ss_pred             CEecccCCH----HHhC----------------------------------CCCCCEEECcCCEeeeECChhHh--cCCC
Confidence            432222211    1222                                  34444444444443322222221  2455


Q ss_pred             CcEEEEecCCCccccCchhhhhhhcCCCEEEEeccccccccccccccccccceeecCccCccccccCCccceecCCCccc
Q 001951          559 LTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTS  638 (992)
Q Consensus       559 L~~L~l~~C~~L~~l~p~~~l~~l~~L~~L~i~~c~~l~~i~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~  638 (992)
                      |+.|+++++ .++...+ .....+++|+.|++++|.....++...         ..++|+.|++++|.-...++....  
T Consensus       430 L~~L~Ls~N-~l~~~~~-~~~~~l~~L~~L~L~~n~~~~~~p~~~---------~~~~L~~L~ls~n~l~~~~~~~~~--  496 (968)
T PLN00113        430 VYFLDISNN-NLQGRIN-SRKWDMPSLQMLSLARNKFFGGLPDSF---------GSKRLENLDLSRNQFSGAVPRKLG--  496 (968)
T ss_pred             CCEEECcCC-cccCccC-hhhccCCCCcEEECcCceeeeecCccc---------ccccceEEECcCCccCCccChhhh--
Confidence            555555553 3333322 223345555555555555332222211         234555555555443333332221  


Q ss_pred             CCCcccEEEEecCCcceeeccccccccccccCcccccccccceeeeeecCCceEEeecCccccccccccCCccccccccE
Q 001951          639 KWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKN  718 (992)
Q Consensus       639 ~~~sL~~L~i~~C~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~  718 (992)
                      .+++|+.|++++|.-...+|...                       ..+++|++|++++|......+..+  ..+++|+.
T Consensus       497 ~l~~L~~L~Ls~N~l~~~~p~~~-----------------------~~l~~L~~L~Ls~N~l~~~~p~~~--~~l~~L~~  551 (968)
T PLN00113        497 SLSELMQLKLSENKLSGEIPDEL-----------------------SSCKKLVSLDLSHNQLSGQIPASF--SEMPVLSQ  551 (968)
T ss_pred             hhhccCEEECcCCcceeeCChHH-----------------------cCccCCCEEECCCCcccccCChhH--hCcccCCE
Confidence            35666666666654333333211                       345666666666666654332222  23566677


Q ss_pred             EEeecCCCC-cccHHHHhhCCCCcEEEEEcceeEEEcc
Q 001951          719 LEVVNDESE-NFRIGFLERFHNLEKLELRWSSYKEIFS  755 (992)
Q Consensus       719 L~i~~c~~~-~~~~~~l~~l~~L~~L~i~c~~l~~~~~  755 (992)
                      |++++|... .+| ..+.++++|+.|+++.+.+...+|
T Consensus       552 L~Ls~N~l~~~~p-~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        552 LDLSQNQLSGEIP-KNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             EECCCCcccccCC-hhHhcCcccCEEeccCCcceeeCC
Confidence            777766655 444 345566777777777444544333

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-06
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-06
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 14/149 (9%)
Query: 161 LCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPN 220
           L LDRC L  + + G L  L  L L  + ++ LP     L  L + D+S  ++L  +P  
Sbjct: 61  LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVS-FNRLTSLPLG 119
Query: 221 LLSGLSRLEDLYMGNTSVKWEFEGL--------NVGRSNASLQELKL-----LSHLTTLE 267
            L GL  L++LY+    +K    GL         +  +N +L EL       L +L TL 
Sbjct: 120 ALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLL 179
Query: 268 IQICDAMILPKGLFSKKLERYKIFIGDEW 296
           +Q      +PKG F   L  +    G+ W
Sbjct: 180 LQENSLYTIPKGFFGSHLLPFAFLHGNPW 208
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score = 82.9 bits (205), Expect = 2e-16
 Identities = 95/524 (18%), Positives = 169/524 (32%), Gaps = 103/524 (19%)

Query: 107 YPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLP-SLFHLPLNLQTLCLDR 165
             QL+   +  +   + I    F  + NLR L L + +   L    F    +L  L L  
Sbjct: 47  LEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYF 106

Query: 166 CALGDIAI----IGNLKKLEILSLVDSNIEQLPEE--MAQLTQLRLFDLSGCSKLKVIPP 219
           C L D  +      NLK L  L L  + I  L       +L  L+  D S   ++ ++  
Sbjct: 107 CGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN-QIFLVCE 165

Query: 220 NLLSGLS--RLEDLYMGNTSVK----WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDA 273
           + L  L    L    +   S+      ++        N  L+ L +  +  T+       
Sbjct: 166 HELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV------- 218

Query: 274 MILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEV------IMQLKGI 327
                G FS  + + + F               ++       N+ +        +    +
Sbjct: 219 --DITGNFSNAISKSQAFSLIL--------AHHIMGAGFGFHNIKDPDQNTFAGLARSSV 268

Query: 328 EELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVL 387
             L L         ++ L+   F  LK L V N             + YN    +     
Sbjct: 269 RHLDLS-----HGFVFSLNSRVFETLKDLKVLN-------------LAYNKINKIADEAF 310

Query: 388 HNLIHLEKI-----CLGQLRAESFY---KLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLN 439
           + L +L+ +      LG+L + +FY   K+  I ++    +  I   +F + L +LQTL+
Sbjct: 311 YGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKN-HIAIIQDQTF-KFLEKLQTLD 368

Query: 440 VINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRL 499
           + +   +  I  +    D+            L    L  LP++    + +     S+ RL
Sbjct: 369 LRDN-ALTTIHFIPSIPDIF-----------LSGNKLVTLPKINLTANLIHL---SENRL 413

Query: 500 KELSTHTLP------REVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAA 553
           + L            + +IL     +           P+LE L L          N L  
Sbjct: 414 ENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLG--------ENMLQL 465

Query: 554 VYSQNLTRLIVHGCEKLKYL---------FPSSMIRNFVQLEHL 588
            +   L   +  G   L+ L          P  +  +   L  L
Sbjct: 466 AWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGL 509
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.5
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.47
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.65
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.16
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.63
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.47
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 93.1
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.22
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.35
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-41  Score=413.87  Aligned_cols=680  Identities=14%  Similarity=0.050  Sum_probs=348.2

Q ss_pred             CccEEEcCCCCCCCC---cChhhhcCCCCCcEEEeeCCcCccCCcccCCCCCCcEEEccCCCCCC--cc--cccCcccCc
Q 001951          109 QLEFFCMSPRDHSIK---IPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGD--IA--IIGNLKKLE  181 (992)
Q Consensus       109 ~Lr~L~l~~~~~~~~---~~~~~~~~l~~Lr~L~Ls~~~i~~lp~~i~~l~~Lr~L~L~~~~l~~--l~--~i~~L~~L~  181 (992)
                      +++.|+++++.+.+.   +++. |.++++|++++++.+.+..+|+.|+.+++||+|+|++|.+..  +.  .++++++|+
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~~-l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~  129 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSSS-LLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLK  129 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHHH-TTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCC
T ss_pred             cEEEEECCCCCcCCccCccChh-HhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCC
Confidence            455566665555443   4433 456667777777766666666667777777777777766542  23  566677777


Q ss_pred             EEEccCCCCC-CCChhh-hCCCCcCEEeecCCCCCCccCccc---cCCCCCCCEEEeecCcccccccccccCCCCCChhh
Q 001951          182 ILSLVDSNIE-QLPEEM-AQLTQLRLFDLSGCSKLKVIPPNL---LSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQE  256 (992)
Q Consensus       182 ~L~L~~~~l~-~LP~~i-~~L~~L~~L~l~~~~~l~~~p~~~---i~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~  256 (992)
                      +||+++|.+. ..|..+ .++++|++|++++|. +...+...   ++++++|++|++++|.+.           +  ...
T Consensus       130 ~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~-----------~--~~~  195 (768)
T 3rgz_A          130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS-ISGANVVGWVLSDGCGELKHLAISGNKIS-----------G--DVD  195 (768)
T ss_dssp             EEECCSSEEECCSSCCSCCCCTTCSEEECCSSC-CEEETHHHHHHTTCCTTCCEEECCSSEEE-----------S--CCB
T ss_pred             EEECcCCccCCcCCHHHhccCCCCCEEECCCCc-cCCcCChhhhhhccCCCCCEEECCCCccc-----------c--cCC
Confidence            7777776554 344443 666777777777666 54444332   466667777777666654           0  112


Q ss_pred             hcCCCCCCEEEeeccCCccCCCccccCCccEEEEEeCCccCccCCcCcceEEEeecccCChHHHHHhhcccceeeccccC
Q 001951          257 LKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVP  336 (992)
Q Consensus       257 l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~~~~~~l~~L~~L~L~~~~  336 (992)
                      +.++++|++|++++|.+......+                                         ..+++|++|+++++.
T Consensus       196 ~~~l~~L~~L~Ls~n~l~~~~~~l-----------------------------------------~~l~~L~~L~Ls~n~  234 (768)
T 3rgz_A          196 VSRCVNLEFLDVSSNNFSTGIPFL-----------------------------------------GDCSALQHLDISGNK  234 (768)
T ss_dssp             CTTCTTCCEEECCSSCCCSCCCBC-----------------------------------------TTCCSCCEEECCSSC
T ss_pred             cccCCcCCEEECcCCcCCCCCccc-----------------------------------------ccCCCCCEEECcCCc
Confidence            256666777777666654322212                                         112334444443322


Q ss_pred             CcccccccccccccccccEEEeecCCCeeEEecCCCccccccccccceeeccccccccceecCCCCchhcCCccEEEEec
Q 001951          337 GIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRN  416 (992)
Q Consensus       337 ~~~~~~~~l~~~~l~~L~~L~l~~~~~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~  416 (992)
                       +....+. .++.+++|++|++++|.....+      + ...+++|++|++.++.-...+..  .....+++|++|++.+
T Consensus       235 -l~~~~~~-~l~~l~~L~~L~Ls~n~l~~~~------~-~~~l~~L~~L~L~~n~l~~~ip~--~~~~~~~~L~~L~Ls~  303 (768)
T 3rgz_A          235 -LSGDFSR-AISTCTELKLLNISSNQFVGPI------P-PLPLKSLQYLSLAENKFTGEIPD--FLSGACDTLTGLDLSG  303 (768)
T ss_dssp             -CCSCHHH-HTTTCSSCCEEECCSSCCEESC------C-CCCCTTCCEEECCSSEEEESCCC--CSCTTCTTCSEEECCS
T ss_pred             -CCCcccH-HHhcCCCCCEEECCCCcccCcc------C-ccccCCCCEEECcCCccCCccCH--HHHhhcCcCCEEECcC
Confidence             1111111 1144455555555554322111      0 11344555555554321111100  0011235666666665


Q ss_pred             CCCCccccchhhhcccCcccEEEeccccCchhhhcccccCCccCCCccceecCcccEEeecCCCccccccccccchhhhh
Q 001951          417 CDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQ  496 (992)
Q Consensus       417 c~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~  496 (992)
                      |. ++...+ ..++.+++|++|++++|.-...++..           ....+++|++|+++++.-...++.    .+..+
T Consensus       304 n~-l~~~~p-~~~~~l~~L~~L~L~~n~l~~~ip~~-----------~l~~l~~L~~L~Ls~n~l~~~~p~----~l~~l  366 (768)
T 3rgz_A          304 NH-FYGAVP-PFFGSCSLLESLALSSNNFSGELPMD-----------TLLKMRGLKVLDLSFNEFSGELPE----SLTNL  366 (768)
T ss_dssp             SE-EEECCC-GGGGGCTTCCEEECCSSEEEEECCHH-----------HHTTCTTCCEEECCSSEEEECCCT----THHHH
T ss_pred             Cc-CCCccc-hHHhcCCCccEEECCCCcccCcCCHH-----------HHhcCCCCCEEeCcCCccCccccH----HHHhh
Confidence            43 332222 23556666666666665322222210           123455666666666532222222    13333


Q ss_pred             c-ccccccccCCCceeecccccCcccccccccccccccceeeccccccccccccCccccccCCCcEEEEecCCCccccCc
Q 001951          497 T-RLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFP  575 (992)
Q Consensus       497 ~-~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~p  575 (992)
                      + +|+.|+++++.....        .+.......+++|++|++++|.++...+..+.  .+++|+.|++++| .++...|
T Consensus       367 ~~~L~~L~Ls~N~l~~~--------~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~Ls~N-~l~~~~p  435 (768)
T 3rgz_A          367 SASLLTLDLSSNNFSGP--------ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS--NCSELVSLHLSFN-YLSGTIP  435 (768)
T ss_dssp             TTTCSEEECCSSEEEEE--------CCTTTTCSTTCCCCEEECCSSEEEEECCGGGG--GCTTCCEEECCSS-EEESCCC
T ss_pred             hcCCcEEEccCCCcCCC--------cChhhhhcccCCccEEECCCCccccccCHHHh--cCCCCCEEECcCC-cccCccc
Confidence            3 556666655531100        00000011256777777777776544433332  3677777777775 4554434


Q ss_pred             hhhhhhhcCCCEEEEeccccccccccccccccccceeecCccCccccccCCccceecCCCcccCCCcccEEEEecCCcce
Q 001951          576 SSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVK  655 (992)
Q Consensus       576 ~~~l~~l~~L~~L~i~~c~~l~~i~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~sL~~L~i~~C~~L~  655 (992)
                      . .+..+++|+.|++++|.-...++....        .+++|+.|++.++.-...+|....  .+++|+.|++++|.--.
T Consensus       436 ~-~l~~l~~L~~L~L~~n~l~~~~p~~~~--------~l~~L~~L~L~~N~l~~~~p~~l~--~l~~L~~L~L~~N~l~~  504 (768)
T 3rgz_A          436 S-SLGSLSKLRDLKLWLNMLEGEIPQELM--------YVKTLETLILDFNDLTGEIPSGLS--NCTNLNWISLSNNRLTG  504 (768)
T ss_dssp             G-GGGGCTTCCEEECCSSCCCSCCCGGGG--------GCTTCCEEECCSSCCCSCCCGGGG--GCTTCCEEECCSSCCCS
T ss_pred             H-HHhcCCCCCEEECCCCcccCcCCHHHc--------CCCCceEEEecCCcccCcCCHHHh--cCCCCCEEEccCCccCC
Confidence            3 356677777777777763323333221        456777777776654444443322  46677777777764333


Q ss_pred             eeccccccccccccCcccccccccceeeeeecCCceEEeecCccccccccccCCccccccccEEEeecCCCC-cccHHHH
Q 001951          656 IFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESE-NFRIGFL  734 (992)
Q Consensus       656 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~i~~c~~~-~~~~~~l  734 (992)
                      .+|...                       ..+++|++|++++|......+..  ...+++|+.|++.+|... .+|....
T Consensus       505 ~~p~~~-----------------------~~l~~L~~L~L~~N~l~~~~p~~--l~~l~~L~~L~Ls~N~l~g~ip~~~~  559 (768)
T 3rgz_A          505 EIPKWI-----------------------GRLENLAILKLSNNSFSGNIPAE--LGDCRSLIWLDLNTNLFNGTIPAAMF  559 (768)
T ss_dssp             CCCGGG-----------------------GGCTTCCEEECCSSCCEEECCGG--GGGCTTCCEEECCSSEEESBCCGGGG
T ss_pred             cCChHH-----------------------hcCCCCCEEECCCCcccCcCCHH--HcCCCCCCEEECCCCccCCcCChHHh
Confidence            444221                       34566667777666665332211  234556666666666544 4444332


Q ss_pred             hhCCCCcEEEEE-cceeEEEccCh----------------hhhhhhhhccccceEecCCccccccccccCCCcccccccc
Q 001951          735 ERFHNLEKLELR-WSSYKEIFSNE----------------EIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENL  797 (992)
Q Consensus       735 ~~l~~L~~L~i~-c~~l~~~~~~~----------------~~~~~~~~l~~L~~L~l~~~~~L~~l~~~~~~~~~~l~~L  797 (992)
                      . ...+..+.+. +..+..+....                ..+..+..++.++.+++...    .+.......+..+++|
T Consensus       560 ~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~----~~~g~~~~~~~~l~~L  634 (768)
T 3rgz_A          560 K-QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSR----VYGGHTSPTFDNNGSM  634 (768)
T ss_dssp             T-TTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSC----EEEEECCCSCSSSBCC
T ss_pred             c-ccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccc----eecccCchhhhccccc
Confidence            2 2222221111 11111110000                00001111222222222211    0001111234667889


Q ss_pred             cEEEEeccCCcccccCCccccCCcCEEEEcCCCCCcccchhHhhhccCCccEEEEccCcchhhhhccCcccccccccccc
Q 001951          798 ESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSK  877 (992)
Q Consensus       798 ~~L~i~~c~~l~~l~~~~~~~~~L~~L~i~~C~~L~~l~~~~~~~~l~sL~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~  877 (992)
                      ++|+++++.-...+|..++.+++|+.|+++++.--..+|  .....+++|+.|+++++.--..++..-       ..+++
T Consensus       635 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip--~~l~~L~~L~~LdLs~N~l~g~ip~~l-------~~l~~  705 (768)
T 3rgz_A          635 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP--DEVGDLRGLNILDLSSNKLDGRIPQAM-------SALTM  705 (768)
T ss_dssp             CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCC--GGGGGCTTCCEEECCSSCCEECCCGGG-------GGCCC
T ss_pred             cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCC--hHHhCCCCCCEEECCCCcccCcCChHH-------hCCCC
Confidence            999999988777888888999999999999875333553  456788999999999886433333221       25788


Q ss_pred             ccccccccCCccccccCCCccccCCCccEEEEccccccccCCCCcccCCccceEEeccCCccccccCc
Q 001951          878 LKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGD  945 (992)
Q Consensus       878 L~~L~l~~c~~L~~l~~~~~~~~~~sL~~L~i~~C~~l~~lp~~~~~~p~L~~~~~~~~~~~~~~~~~  945 (992)
                      |++|++++++--..+|.++.   +.++....+.++|.+--.|        |. .|....+++|+++.|
T Consensus       706 L~~L~ls~N~l~g~iP~~~~---~~~~~~~~~~gN~~Lcg~~--------l~-~C~~~~~~~~~~~~~  761 (768)
T 3rgz_A          706 LTEIDLSNNNLSGPIPEMGQ---FETFPPAKFLNNPGLCGYP--------LP-RCDPSNADGYAHHQR  761 (768)
T ss_dssp             CSEEECCSSEEEEECCSSSS---GGGSCGGGGCSCTEEESTT--------SC-CCCSCC---------
T ss_pred             CCEEECcCCcccccCCCchh---hccCCHHHhcCCchhcCCC--------Cc-CCCCCccCCCCCCCC
Confidence            99999999876667777653   5556666677888766433        22 466788999999955
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 992
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 54.2 bits (129), Expect = 4e-08
 Identities = 29/171 (16%), Positives = 60/171 (35%), Gaps = 28/171 (16%)

Query: 86  KNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQF 145
            N   + L+  +  ++        L    ++    S   P    +G++ L  L L   Q 
Sbjct: 219 TNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQI 275

Query: 146 LSLPSLFHLPLN---------------------LQTLCLDRCALGDIAIIGNLKKLEILS 184
            ++  L  L                        L  L L    + DI+ + +L KL+ L 
Sbjct: 276 SNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLF 335

Query: 185 LVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGN 235
             ++ +  +   +A LT +         ++  + P  L+ L+R+  L + +
Sbjct: 336 FANNKVSDVSS-LANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.46
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.83  E-value=7.3e-19  Score=194.52  Aligned_cols=103  Identities=22%  Similarity=0.316  Sum_probs=70.9

Q ss_pred             CCCCCcEEEeeCCcCccCCcccCCCCCCcEEEccCCCCCCcccccCcccCcEEEccCCCCCCCChhhhCCCCcCEEeecC
Q 001951          131 GMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSG  210 (992)
Q Consensus       131 ~l~~Lr~L~Ls~~~i~~lp~~i~~l~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~L~~~~l~~LP~~i~~L~~L~~L~l~~  210 (992)
                      .+.+|++|+++++.|+.+. .++.+++||+|++++|.++.++.++++++|++|++++|.+..++ .++++++|++|++++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCccccCCccccccccccccccccc-ccccccccccccccc
Confidence            4566777777777777763 57777777777777777777766777777777777777777665 377777777777776


Q ss_pred             CCCCCccCccccCCCCCCCEEEeecCcc
Q 001951          211 CSKLKVIPPNLLSGLSRLEDLYMGNTSV  238 (992)
Q Consensus       211 ~~~l~~~p~~~i~~L~~L~~L~l~~~~~  238 (992)
                      +. +..++.  ......+..+....+.+
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~l  144 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNTI  144 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEEE
T ss_pred             cc-cccccc--ccccccccccccccccc
Confidence            65 555554  34555666665555443
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure