Citrus Sinensis ID: 001987


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-----
MVSTRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKNDQGLKTEDSSELSSTPSDYEDCVEEHPPSHNFEEAIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEEMSTAADRGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDASV
ccccEEEEEEEEcccccccccEEEEEEccEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEEccccccccccccccEEEEEEccccccccccccccEEEEcccccccccccccccEEEEEEEEcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccHHccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHccccEEEccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEccccEEEEEEEEEccccccccEEEEEEEEEEEccccccccccccEEEEEEEEEEEEccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccEEEHHHHHHHEEEEEccccccccccEEEEccccccccccEEEEEEEEEEEEEEEEcccHHHHHHHccccccccccccccEEEEEEEEEEccccccccccccccEEEEEEccEEEEEEEccccccccccEEEEEEEEcccccEEEEEEEccccccccccccEEEEEEccccccccccEEEEEcccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccccccEEEcccEEEEEEEccccccccccEEEEEEEcccccccccccccccccccEEEEEccEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccHHHHHHHcccccHHHHHHHHHccccccccccEEcccccEEEEEEEEEEcccccccccccEEEEEEEEcccccEEEEEEEEEcccccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccccEEEEEEEEEccccccccEEEEEEccEEEEEEEEcccccccccEEEEEEEcccccccEEEEEEEEEcccccccccccEEEEEEEEcccccccccccccccEEEccccccccccEEEccEEEEEEEEcccccccccccccccccccccccccEEEcccEEEEEEcEEccccccccccccccHHHHcHHHHHEEcccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEEEEcHHHHHHHHccccccHHHHHHHHHcccccEEccEEEEccccccEEEEEEEEccHHHHHHHHHHHHHcEEEEccccEEEEEEEEccccccccccEEEEEEEEEcccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEcccccccccEEEEccccccccEEEEEEEEcccccccccEccEEEEEEEcccHHHHccEEEEcccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHcccccEEEEEcccHHHHEcccccHccccccEEEEEEEcccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccEEccccccccEEEcccccccHHHHHHHHccccHHHHHHHHccccccccccccccccccEEEEEEEEEcccccccccEEEEEEEcccccccccEEEEEHEEHccccccccEEEEEEEEEEEccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
MVSTRLYVYVLQGQDLLAKDSYVKVqigkhksksrilknnsnpvwneefvfrvhniddeeLVVSVFQhnddsglfgssgelmgrvrvpvssiaaednhmlpptwfsletpktrkftnkdcGKILLTISlngkghnlssnRLLYLHSnvssneskeledpcvlshdvscskapcldvteGNHLMKAMVSHLEKIFNkndqglktedsselsstpsdyedcveehppshnFEEAIKMMQSrenegdmpenlqggilldqlyqvspcdlntflfapdsqfRKDLAElqgtkdvqegpwewksgemtcLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTvstpdvpygntfNVQLLYkiipgpelssgedsshLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKildskdasdkDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCepskrqglefygldlpdsfgELISCGILVIQLEQVFNMVGHFVRARlrkgsdhgvkaqgDGWVLTVALVEGVNlassemtglsdpyvvftcngktrtssvqlqtcdpqwhdilefdameeppsvldvevfdfdgpfdqatslgHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANlfgnktkffflwediediqilspslatvgspSLVIILWKgrgldarhgaksqdeegrLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEEMStaadrgsvpnfedakmskvynaeLPISVKALMEMFDGGKLEHQVMeksgchnyvttpwdlvkpgvcerhlsyrfnrhvsifggevtctqqksplasgegwIVNEVmslhdvpfddhfrvHFRYeieksplahnacKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDASV
MVSTRLYVYVLqgqdllakdsYVKVQigkhksksrilknnsnpvwNEEFVFRVHNIDDEELVVSVFQHNDDSglfgssgelmgRVRVPVSSIaaednhmlpptwfsletpktrkftnKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKNDQGLKTEDSSELSSTPSDYEDCVEEHPPSHNFEEAIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELqgtkdvqegpwewksgeMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTrtssvqlqtCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGaksqdeegrLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEEMSTAADRGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIeksplahnACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREilfatqqdasv
MVSTRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKNDQGLKTEDSSELSSTPSDYEDCVEEHPPSHNFEEAIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMkaatklvkavkatEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYqkeqiaeeqqvqeeMSTAADRGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDASV
****RLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLH**************CVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIF*******************************************************QGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPEL******SHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKIL********************SDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDAR*********GRLRFYFQSFVSFNDASRTIMALWRSRTLTAY**********************************VYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFA*******
**STRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLET***********GKILLTISLNGKGHNLS****************************VSCSKAPCLDVTE************EKIFNKNDQGLKTEDSSE************************************MPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPW*********LTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLA***************************DWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGH*******************GWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEY****************SARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTI**********************************************VYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNR*********TCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVE*************
MVSTRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVS***************DVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKNDQG***********************PPSHNFEEAIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGL**********EEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQI***************RGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDASV
**STRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKND************************************M*****NEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEE******MSTA**RGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREIL*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTRLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMKAMVSHLEKIFNKNDQGLKTEDSSELSSTPSDYEDCVEEHPPSHNFEEAIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEEMSTAADRGSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDASV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query985 2.2.26 [Sep-21-2011]
Q9FGS81027 C2 and GRAM domain-contai yes no 0.980 0.940 0.553 0.0
Q9ZVT91020 C2 and GRAM domain-contai no no 0.968 0.935 0.479 0.0
Q8K0T72210 Protein unc-13 homolog C yes no 0.121 0.054 0.317 1e-08
Q8NB662214 Protein unc-13 homolog C yes no 0.121 0.054 0.317 1e-08
Q627702204 Protein unc-13 homolog C yes no 0.121 0.054 0.317 1e-08
Q9Z1N91602 Protein unc-13 homolog B no no 0.121 0.074 0.324 2e-08
P277152155 Phorbol ester/diacylglyce no no 0.121 0.055 0.317 3e-08
Q627691622 Protein unc-13 homolog B no no 0.121 0.073 0.317 6e-08
O147951591 Protein unc-13 homolog B no no 0.121 0.075 0.317 1e-07
Q627681735 Protein unc-13 homolog A no no 0.121 0.069 0.310 2e-07
>sp|Q9FGS8|C2GR2_ARATH C2 and GRAM domain-containing protein At5g50170 OS=Arabidopsis thaliana GN=At5g50170 PE=2 SV=1 Back     alignment and function desciption
 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1020 (55%), Positives = 745/1020 (73%), Gaps = 54/1020 (5%)

Query: 5    RLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVS 64
            RLYVY+LQ +DL AK+++ K+ +G+HKSK+R+ ++ S+P+WNEEFVFR+ ++D+ + VV 
Sbjct: 2    RLYVYILQAKDLPAKETFAKLHVGRHKSKTRVARDTSSPIWNEEFVFRISDVDEGDDVVV 61

Query: 65   VFQHND--DSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGK 122
               H++  D     S+G L+G+VR+P++S+AAE+N  L PTWF +E P   KF N +CGK
Sbjct: 62   SILHHEQQDHQSIVSTG-LIGKVRIPLTSVAAEENQTLLPTWFVIEKPSDGKFVNIECGK 120

Query: 123  ILLTISLNGKGHNLSSNRLLYLHSNVSSNES-KELE-DPCVLSHDVSCSKAPCLDVTEGN 180
            ILL++SL GK  + S  ++L    ++ + E  KELE  P  L   +S          +G 
Sbjct: 121  ILLSLSLQGKWESTSGEKVLNDKQDIINLEGVKELEGSPKDL---ISSRDGKRRKHHDGK 177

Query: 181  HLMKAMVSHLEKIFNKNDQGLKT--EDSSELSSTPSDYEDCVEEHPPSHN---FEEAIKM 235
            H+MK +V+H++K+F+K ++  K   ++SS   S  S+YED  ++   S     FEE + +
Sbjct: 178  HIMKNIVNHIDKLFHKKEEISKRLHDESSVGQSVNSNYEDATDQCSSSATCTGFEEGLDL 237

Query: 236  MQSRENEGD-MPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGP 294
            MQS ++E + MPENL GG+L+DQ Y VSPC+LN FLF P SQFRK+LAELQG  DVQEGP
Sbjct: 238  MQSSDSEREEMPENLTGGVLVDQKYLVSPCELNKFLFTPSSQFRKELAELQGLSDVQEGP 297

Query: 295  WEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNT 354
            W     +   LTR V+YM+AATK+VKAVKATE Q Y KA+G++FA+ V+VSTPDVPYGNT
Sbjct: 298  WTMMQEDTPRLTRVVTYMRAATKMVKAVKATENQVYRKASGKQFAVFVSVSTPDVPYGNT 357

Query: 355  FNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANL 414
            F ++LLYKI+P  E ++G ++S LIISWGI F QST+M+GMIEGGARQGLKESFEQF+NL
Sbjct: 358  FKIELLYKILPETEPTAGGEASRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQFSNL 417

Query: 415  LAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLC 474
            LA+  K LD     DK+ ++AT+Q+E ++D + A  YFW+ +V+ A  + +YVVVH+L C
Sbjct: 418  LAKTYKTLDPAVVLDKEQVIATVQSEPKTDLKSAFLYFWSSSVICAVLLSVYVVVHMLHC 477

Query: 475  EPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGD 534
            EPSK QG EFYGLDLPDSFGEL S GILV+ LE+V+ M  HFV+ARL +G D GVKA G 
Sbjct: 478  EPSKIQGFEFYGLDLPDSFGELFSSGILVLLLERVYIMTVHFVQARLHRGRDQGVKANGK 537

Query: 535  GWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEE 594
            GW+LT+AL++G NLAS E T L DPYVVFTCNGKTRTSSV+LQ  DPQW++++EFDAMEE
Sbjct: 538  GWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDAMEE 597

Query: 595  PPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRI 654
            PPSVLDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELAD+ V+L G  AQ++QSK+ LRI
Sbjct: 598  PPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADLSVALVGNHAQASQSKLQLRI 657

Query: 655  FLENNNGVETIKEYLTKMEKEVGKK----------------------------------- 679
            FLEN NGVET+K+YL+K+EKEVGKK                                   
Sbjct: 658  FLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYLKRK 717

Query: 680  ----GRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGR 735
                G+LFLSARIV FY+N+FG+KTKF+FLWEDI+DIQ+L P+ A++GSP L+IIL K R
Sbjct: 718  LPVQGKLFLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLIILKKNR 777

Query: 736  GLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEE 795
            GLDA+HGAKSQD+EGRL FYFQSFVSF+  SRTIMALW++RTL+   + QI EE Q   +
Sbjct: 778  GLDAKHGAKSQDDEGRLSFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIVEEDQDVAD 837

Query: 796  MSTAADRGSVPNFEDA-KMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTP 854
                 +  +V +  DA  MSKVY  +LP  V+ +M++F GG+LE ++MEKSGC +Y +T 
Sbjct: 838  PFLLPEAVTVVSDADALMMSKVYTCDLPCDVELVMKIFGGGELERKIMEKSGCLSYASTT 897

Query: 855  WDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHF 914
            W+  KPGV ER LSY++N +VS+FGG VTC QQKSP  + EGWI+NE+++LHDVPF DHF
Sbjct: 898  WESKKPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPAPNDEGWILNEIVALHDVPFGDHF 957

Query: 915  RVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVERE 974
            RVH RYE++K+ +     KC +Y+ I WLK+ KF+QRI+++I EKF +R K + +L ++E
Sbjct: 958  RVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRFKVIFDLFQKE 1017





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 Back     alignment and function description
>sp|Q8K0T7|UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus GN=Unc13c PE=1 SV=3 Back     alignment and function description
>sp|Q8NB66|UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens GN=UNC13C PE=2 SV=3 Back     alignment and function description
>sp|Q62770|UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus GN=Unc13c PE=1 SV=3 Back     alignment and function description
>sp|Q9Z1N9|UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus GN=Unc13b PE=2 SV=2 Back     alignment and function description
>sp|P27715|UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans GN=unc-13 PE=1 SV=4 Back     alignment and function description
>sp|Q62769|UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus GN=Unc13b PE=1 SV=2 Back     alignment and function description
>sp|O14795|UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens GN=UNC13B PE=1 SV=2 Back     alignment and function description
>sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query985
3594912111021 PREDICTED: C2 and GRAM domain-containing 0.992 0.957 0.687 0.0
2977337111060 unnamed protein product [Vitis vinifera] 0.990 0.920 0.687 0.0
2555405211022 conserved hypothetical protein [Ricinus 0.991 0.955 0.671 0.0
2241336621039 predicted protein [Populus trichocarpa] 0.987 0.936 0.648 0.0
3565072901014 PREDICTED: C2 and GRAM domain-containing 0.981 0.953 0.626 0.0
3565189441017 PREDICTED: C2 and GRAM domain-containing 0.981 0.950 0.621 0.0
3574618151014 GRAM domain-containing protein 1B [Medic 0.981 0.953 0.592 0.0
152406291027 C2 and GRAM domain-containing protein [A 0.980 0.940 0.553 0.0
2977923131028 C2 domain-containing protein [Arabidopsi 0.980 0.939 0.553 0.0
2241247261020 predicted protein [Populus trichocarpa] 0.978 0.945 0.488 0.0
>gi|359491211|ref|XP_002277671.2| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1436 bits (3718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/1021 (68%), Positives = 829/1021 (81%), Gaps = 43/1021 (4%)

Query: 5    RLYVYVLQGQDLLAKDSYVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNIDDEELVVS 64
            RLY YVL+G+DL  +DSYVK+Q+GK KSK+R+L+ + NPVWNEEF FRVH++  E L++S
Sbjct: 2    RLYAYVLEGRDLCVEDSYVKLQLGKFKSKTRVLRRSRNPVWNEEFAFRVHDVGGE-LILS 60

Query: 65   VFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKIL 124
            V  H+DDSG F SS EL+GRVR+PVS++ A++N  LPPTWFSLE  ++ KF +K+ GKIL
Sbjct: 61   VLHHDDDSGFFNSSNELVGRVRIPVSAVLAKENQTLPPTWFSLERGRSGKFISKEYGKIL 120

Query: 125  LTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGNHLMK 184
            LTISL+G+  + +++  LY HS V + + KE E   V S D+  S      V EG  LMK
Sbjct: 121  LTISLHGRSQDTTADHPLYAHSRVKTRDFKEWEG-LVESEDIVSSNTSTWKVPEGKQLMK 179

Query: 185  AMVSHLEKIFNKNDQGLKTEDSSELSSTPSDYEDCVEEHPPSH-NFEEAIKMMQSRENEG 243
            A+ S LEK+  KN++  K +DSSE+SS PSDYEDC+EE  PS  +FEEAI++MQSR  E 
Sbjct: 180  AIASRLEKLLGKNEETSKMDDSSEVSSIPSDYEDCIEEQRPSCCSFEEAIELMQSRNGEQ 239

Query: 244  DMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGPWEWKSGEMT 303
            +MPENLQGGILLDQ Y V+   LN  LFAP+SQFR+DLAELQ T +++EGPW WKSG ++
Sbjct: 240  EMPENLQGGILLDQTYIVASKVLNMLLFAPNSQFRQDLAELQRTTNMKEGPWTWKSGALS 299

Query: 304  CLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNTFNVQLLYKI 363
            CLTR VSY +AATKLVKAV A E+QTY+KA+G+EFA+LV V TPDVPYGN+F V+LLYKI
Sbjct: 300  CLTRVVSYTQAATKLVKAVDALEEQTYIKADGREFAVLVNVDTPDVPYGNSFKVELLYKI 359

Query: 364  IPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANLLAQNLKILD 423
            +PGPELSSGE+SSHL++SWG+ F Q+T+MRGMIEGGARQGLKESF+QFANLLAQN K L 
Sbjct: 360  MPGPELSSGEESSHLVVSWGLSFSQNTIMRGMIEGGARQGLKESFDQFANLLAQNFKTLG 419

Query: 424  SKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLCEPSKRQGLE 483
            S D+ DKD MLATLQTEQQSDWELA+EYF NFTVVSA FM++Y++VHILL   S++QGLE
Sbjct: 420  SIDSLDKDQMLATLQTEQQSDWELATEYFGNFTVVSAFFMVIYILVHILLSVRSEQQGLE 479

Query: 484  FYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGDGWVLTVALV 543
            F GLDLPDSFGELI+CGILVIQLE+V+ M+ HFV+AR ++GSDHGVKAQGDGWVLTVAL+
Sbjct: 480  FSGLDLPDSFGELITCGILVIQLERVYAMILHFVQARFQRGSDHGVKAQGDGWVLTVALI 539

Query: 544  EGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEV 603
            EG+NLAS + TGLSDPYVVFTCNGKTRTSSV+LQT DPQW++ILEFDAMEEPP+VLDVEV
Sbjct: 540  EGINLASLDSTGLSDPYVVFTCNGKTRTSSVKLQTHDPQWNEILEFDAMEEPPAVLDVEV 599

Query: 604  FDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRIFLENNNGVE 663
            FDFDGPFD+A SLGHAEINFL+HTSTELADMWVSLEGKLAQS+QSK+HLRIFL+NNNGVE
Sbjct: 600  FDFDGPFDEAASLGHAEINFLRHTSTELADMWVSLEGKLAQSSQSKLHLRIFLDNNNGVE 659

Query: 664  TIKEYLTKMEKEVGKK---------------------------------------GRLFL 684
            TIKEYL KMEKEVGKK                                       GRLFL
Sbjct: 660  TIKEYLAKMEKEVGKKITLQSPHRNSTFLALFGLPPEEFLINDFTCYLKRKVPLQGRLFL 719

Query: 685  SARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAK 744
            SARIVGFYANLFG+KTKFFFLWEDIEDIQ+  PSLA++GSPSLVIIL KGRGLDARHGAK
Sbjct: 720  SARIVGFYANLFGHKTKFFFLWEDIEDIQVHPPSLASLGSPSLVIILRKGRGLDARHGAK 779

Query: 745  SQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEEMS-TAADRG 803
            SQDEEGRL+FYFQSFVSFN ASRTIMALWR+RTLT  QK QIA+EQQ ++  S    D G
Sbjct: 780  SQDEEGRLKFYFQSFVSFNVASRTIMALWRTRTLTPEQKAQIADEQQDEDGSSLLLEDPG 839

Query: 804  SVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVC 863
            SV N E+AKMSKVY+AELPI +K+LMEMFDGG LEH++MEKSG  NY  T W+ VKP + 
Sbjct: 840  SVFNVEEAKMSKVYSAELPIDIKSLMEMFDGGNLEHKIMEKSGYLNYKATGWETVKPDLY 899

Query: 864  ERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIE 923
            ERHL ++FNRHVSIFGGEVTCTQ+KSP+ +  GWI+NEVM+LHD+PF DHFRVHFRY+IE
Sbjct: 900  ERHLCFKFNRHVSIFGGEVTCTQKKSPIGNDNGWILNEVMALHDIPFGDHFRVHFRYQIE 959

Query: 924  KSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVEREILFATQQDA 983
               LA   CKC +++ I WLKST FQQRIT+NITEKFT RLKE+IELVERE L    QD+
Sbjct: 960  NFGLAPGKCKCEVHMEILWLKSTVFQQRITRNITEKFTSRLKEIIELVEREALLNCPQDS 1019

Query: 984  S 984
            S
Sbjct: 1020 S 1020




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297733711|emb|CBI14958.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540521|ref|XP_002511325.1| conserved hypothetical protein [Ricinus communis] gi|223550440|gb|EEF51927.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224133662|ref|XP_002321630.1| predicted protein [Populus trichocarpa] gi|222868626|gb|EEF05757.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356507290|ref|XP_003522401.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like [Glycine max] Back     alignment and taxonomy information
>gi|356518944|ref|XP_003528135.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like [Glycine max] Back     alignment and taxonomy information
>gi|357461815|ref|XP_003601189.1| GRAM domain-containing protein 1B [Medicago truncatula] gi|355490237|gb|AES71440.1| GRAM domain-containing protein 1B [Medicago truncatula] Back     alignment and taxonomy information
>gi|15240629|ref|NP_199828.1| C2 and GRAM domain-containing protein [Arabidopsis thaliana] gi|75309065|sp|Q9FGS8.1|C2GR2_ARATH RecName: Full=C2 and GRAM domain-containing protein At5g50170 gi|9759019|dbj|BAB09388.1| unnamed protein product [Arabidopsis thaliana] gi|15810203|gb|AAL07002.1| AT5g50170/K6A12_3 [Arabidopsis thaliana] gi|32815845|gb|AAP88330.1| At5g50170/K6A12_3 [Arabidopsis thaliana] gi|332008523|gb|AED95906.1| C2 and GRAM domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297792313|ref|XP_002864041.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309876|gb|EFH40300.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224124726|ref|XP_002329933.1| predicted protein [Populus trichocarpa] gi|222871955|gb|EEF09086.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FGS8C2GR2_ARATHNo assigned EC number0.55390.98070.9406yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
cd13219161 cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-conta 8e-64
cd00030102 cd00030, C2, C2 domain 5e-20
smart00239101 smart00239, C2, Protein kinase C conserved region 3e-18
pfam0016885 pfam00168, C2, C2 domain 3e-17
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-16
cd00030102 cd00030, C2, C2 domain 6e-16
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 2e-13
pfam0016885 pfam00168, C2, C2 domain 2e-12
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 2e-12
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-11
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 2e-11
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 2e-11
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 3e-11
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 5e-11
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 7e-11
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-10
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-10
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 2e-10
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-10
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 6e-10
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 6e-09
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-08
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-08
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 5e-08
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 7e-08
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 7e-08
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 8e-08
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 8e-08
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 2e-07
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 2e-07
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 2e-07
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 3e-07
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-07
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 5e-07
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 6e-07
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 7e-07
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-06
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 1e-06
cd08379126 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repe 2e-06
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-06
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 2e-06
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 2e-06
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-06
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 4e-06
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 5e-06
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 6e-06
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 1e-05
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 1e-05
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 1e-05
pfam0289360 pfam02893, GRAM, GRAM domain 2e-05
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 2e-05
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 2e-05
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 3e-05
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 3e-05
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 4e-05
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-05
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 4e-05
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 5e-05
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 5e-05
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 5e-05
smart0056860 smart00568, GRAM, domain in glucosyltransferases, 5e-05
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 7e-05
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 8e-05
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 8e-05
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 9e-05
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 1e-04
cd1057094 cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltran 1e-04
cd08408138 cd08408, C2B_Synaptotagmin-14_16, C2 domain second 1e-04
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 2e-04
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-04
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 2e-04
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 3e-04
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 3e-04
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 3e-04
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 3e-04
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 4e-04
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 4e-04
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 4e-04
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 5e-04
cd08685119 cd08685, C2_RGS-like, C2 domain of the Regulator O 5e-04
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 7e-04
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 0.001
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 0.001
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 0.002
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 0.002
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 0.002
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 0.002
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 0.002
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 0.002
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 0.002
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 0.002
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.003
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 0.003
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 0.004
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 0.004
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 0.004
>gnl|CDD|241373 cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-containing protein Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain Back     alignment and domain information
 Score =  212 bits (541), Expect = 8e-64
 Identities = 94/161 (58%), Positives = 110/161 (68%), Gaps = 40/161 (24%)

Query: 670 TKMEKEVGKK---------------------------------------GRLFLSARIVG 690
           +KMEKEVGKK                                       GRLFLSARI+G
Sbjct: 1   SKMEKEVGKKINLRSPQKNSAFQKLFGLPPEEFLINDFTCALKRKFPLQGRLFLSARIIG 60

Query: 691 FYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDARHGAKSQDEEG 750
           FY+NLFG+KTKFFFLWEDIE+IQ+  PSL +VGSPS+VIIL KGRGLDARHGAK QD EG
Sbjct: 61  FYSNLFGHKTKFFFLWEDIEEIQVSPPSL-SVGSPSIVIILRKGRGLDARHGAKPQDPEG 119

Query: 751 RLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQ 791
           RL+F+FQSFVSFN A RTIMALW++R+L+  QK+QI EE +
Sbjct: 120 RLKFHFQSFVSFNHAFRTIMALWKNRSLSPEQKKQIVEESE 160


C2GRAM contains two N-terminal C2 domains followed by a single PH-GRAM domain. Since it contains both of these domains it is assumed that this gene cross-links both calcium and phosphoinositide signaling pathways. In general he C2 domain is involved in binding phospholipids in a calcium dependent manner or calcium independent manner. The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins. The GRAM domain is part of a larger motif with a pleckstrin homology (PH) domain fold. Length = 161

>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176025 cd08379, C2D_MCTP_PRT_plant, C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|217271 pfam02893, GRAM, GRAM domain Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|214725 smart00568, GRAM, domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|241306 cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain Back     alignment and domain information
>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 985
KOG1032 590 consensus Uncharacterized conserved protein, conta 99.97
KOG13261105 consensus Membrane-associated protein FER-1 and re 99.9
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.89
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.88
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.88
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.83
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.82
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.82
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.81
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.81
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.81
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.81
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.8
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.79
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.79
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.79
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.79
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.79
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.78
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.77
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.77
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.76
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.76
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.76
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.76
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.76
KOG1032590 consensus Uncharacterized conserved protein, conta 99.75
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.75
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.75
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.75
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.75
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.75
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.75
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.74
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.74
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.74
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.74
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.73
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.73
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.73
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.73
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.73
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.73
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.72
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.72
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.72
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.72
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.72
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.72
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.72
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.71
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.71
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.71
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.71
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.71
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.71
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.7
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.7
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.7
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.7
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.69
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.69
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.69
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.69
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.69
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.69
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.69
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.68
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.68
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.68
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.68
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.68
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.67
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.67
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.67
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.67
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.67
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.67
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.67
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.67
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.67
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.67
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.66
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.66
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.66
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.66
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.66
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.66
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.66
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.66
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.65
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.65
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.65
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.65
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.65
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.64
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.64
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.64
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.64
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.64
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.64
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.64
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.63
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.63
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.63
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.62
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.62
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.62
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.62
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.62
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.61
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.61
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.61
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.61
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.61
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.6
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.6
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.59
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.59
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.59
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.59
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.59
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.58
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.58
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.58
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.58
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.58
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.58
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.57
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.57
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.57
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.57
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.57
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.57
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.56
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.56
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.56
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.55
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.55
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.55
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.55
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.55
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.54
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.54
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.53
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.53
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.53
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.53
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.53
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.53
PLN03008 868 Phospholipase D delta 99.53
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.52
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.51
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.51
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.51
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.51
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.51
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.5
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.5
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.5
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.5
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.49
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.49
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.49
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.48
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.48
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.48
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.48
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.48
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.48
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.48
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.47
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.45
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.45
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.45
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.44
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.44
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.43
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.43
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.43
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.42
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.42
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.42
PLN03008868 Phospholipase D delta 99.42
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 99.41
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.41
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.41
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.4
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.38
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.38
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.37
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.37
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.33
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.28
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.25
KOG10111283 consensus Neurotransmitter release regulator, UNC- 99.25
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.25
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.22
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.22
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.19
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.17
PLN02223537 phosphoinositide phospholipase C 99.17
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.15
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.1
PLN02952599 phosphoinositide phospholipase C 99.09
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 99.02
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.01
PLN02223537 phosphoinositide phospholipase C 99.0
cd00030102 C2 C2 domain. The C2 domain was first identified i 98.98
PLN02230598 phosphoinositide phospholipase C 4 98.98
PLN02270 808 phospholipase D alpha 98.98
PLN02952599 phosphoinositide phospholipase C 98.91
PLN02222581 phosphoinositide phospholipase C 2 98.9
PLN02228567 Phosphoinositide phospholipase C 98.9
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 98.89
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.89
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.89
PLN02270808 phospholipase D alpha 98.86
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.82
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.8
PLN02230598 phosphoinositide phospholipase C 4 98.79
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 98.76
PLN02222581 phosphoinositide phospholipase C 2 98.76
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.75
PLN02228567 Phosphoinositide phospholipase C 98.67
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.62
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.61
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.6
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.43
PLN02352 758 phospholipase D epsilon 98.28
PF0289369 GRAM: GRAM domain; InterPro: IPR004182 The GRAM do 98.21
PLN02352758 phospholipase D epsilon 98.18
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.12
smart0056861 GRAM domain in glucosyltransferases, myotubularins 98.08
PLN02964 644 phosphatidylserine decarboxylase 98.05
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.01
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.7
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.68
KOG13261105 consensus Membrane-associated protein FER-1 and re 97.5
KOG1327529 consensus Copine [Signal transduction mechanisms] 97.32
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.27
PLN02964644 phosphatidylserine decarboxylase 97.25
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.16
KOG3837523 consensus Uncharacterized conserved protein, conta 96.96
KOG1327529 consensus Copine [Signal transduction mechanisms] 96.91
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 96.76
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 96.55
KOG12651189 consensus Phospholipase C [Lipid transport and met 96.15
KOG3837523 consensus Uncharacterized conserved protein, conta 95.93
KOG12651189 consensus Phospholipase C [Lipid transport and met 95.81
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.8
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.79
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.73
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 95.25
PF15627156 CEP76-C2: CEP76 C2 domain 95.24
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.03
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 94.98
PF15627156 CEP76-C2: CEP76 C2 domain 94.82
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 94.67
cd08397159 C2_PI3K_class_III C2 domain present in class III p 94.63
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 94.41
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 93.93
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 93.83
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 93.24
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 92.54
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 91.67
KOG1452442 consensus Predicted Rho GTPase-activating protein 91.52
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 90.43
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 90.23
cd08397159 C2_PI3K_class_III C2 domain present in class III p 89.95
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 89.92
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 89.69
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 88.86
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 88.85
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 88.26
cd08871222 START_STARD10-like Lipid-binding START domain of m 85.85
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 85.09
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 85.01
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 84.88
cd08870209 START_STARD2_7-like Lipid-binding START domain of 84.49
KOG1452442 consensus Predicted Rho GTPase-activating protein 84.26
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 84.04
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 83.15
cd00177193 START Lipid-binding START domain of mammalian STAR 82.52
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 81.93
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 81.06
>KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] Back     alignment and domain information
Probab=99.97  E-value=4.5e-31  Score=308.67  Aligned_cols=276  Identities=17%  Similarity=0.223  Sum_probs=216.6

Q ss_pred             CCcchhhhhhhhhhhhccccceeEeeeeEeeeeccccCcceEEEEeccccccccccCCcccccCCCeEEEEEecCCCccc
Q 001987          660 NGVETIKEYLTKMEKEVGKKGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGRGLDA  739 (985)
Q Consensus       660 ~~~~~l~~~l~~lek~i~~~gr~y~s~~~~~f~snif~~~~~~~i~~~di~~i~~~~~~~~~~~~~~~~i~~~~~~~~~~  739 (985)
                      .....+.++.|++.+++..+||||++..++|||||||||+++.+||+++|..++|..+|  .+.+++++|..        
T Consensus       119 ~~~~l~~~~~cal~reillQGrmyis~~~icF~s~i~gw~~~~vIpf~eI~~ikk~~ta--g~fpn~i~i~t--------  188 (590)
T KOG1032|consen  119 DPEILLTDYSCALQREILLQGRMYISEEHICFNSNIFGWETKVVIPFDEITLIKKTKTA--GIFPNAIEITT--------  188 (590)
T ss_pred             CcceeeeecchhhccccccccccccccceeeecccccCccceeEEeeeeeeeeehhhhc--cCCCcceEEec--------
Confidence            34556788899999999999999999999999999999999999999999999999998  56667777762        


Q ss_pred             cCCCCcCCccccEEEEEeeccCcchhhHHHHHHHHhcc---CCc----------hhhhhhh----hhhccccc-------
Q 001987          740 RHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRT---LTA----------YQKEQIA----EEQQVQEE-------  795 (985)
Q Consensus       740 ~~~~~~~~~~~~~k~~F~SF~srd~a~~~i~~~w~~~~---~~~----------~~~~~~~----~~~~~~~~-------  795 (985)
                                +..+|.|+||.+||.||.+|..+-+...   .++          +.+....    ........       
T Consensus       189 ----------~~~ky~f~s~~Srda~~~~~~~~~~~~~~~s~s~~~~~~~l~~~~~~~~~~~~~~~~~~~~~s~~~~s~~  258 (590)
T KOG1032|consen  189 ----------GTTKYIFVSLLSRDATYKLIKLLLHKFLDSSGSPRADSDYLSSVEPEVNDDQQGNVDNSQSPSALQNSFD  258 (590)
T ss_pred             ----------CCCcceeeecccCccHHHHHHHhhhhcccccCCccccchhcccCCCCcCcccccccccCCCccccccccC
Confidence                      3458999999999999997644333211   111          1000000    00000000       


Q ss_pred             ccccccC-CCCCCccccccceeEeeeecCChHHHHh-ccCCCchhHHHHHHcCCcceEEcccccCCCCceeEEEEEEe--
Q 001987          796 MSTAADR-GSVPNFEDAKMSKVYNAELPISVKALME-MFDGGKLEHQVMEKSGCHNYVTTPWDLVKPGVCERHLSYRF--  871 (985)
Q Consensus       796 ~~~~~~~-~~~~~~~~~~~~~~~~~~~p~~~~~~~~-lf~~s~f~~~~~~~~~~~~~~~~~W~~~~~~~~~R~~sy~~--  871 (985)
                      .+.++.. ..+-..-......+.+-.+.+++..||+ +|.+..|...+.+.+..+++...+|.....+...|.++|+.  
T Consensus       259 ~~~~e~~~~~~~~~~~~~~~v~~~~~~s~~~~~~~~~lf~d~~~~~~~l~~~~~~~vs~~~~~~~~~~~~~r~~~y~~~l  338 (590)
T KOG1032|consen  259 SPKEEELEHDFSCSLSRLFGVLGRLPFSAPIGAFFSLLFGDNTFFFFFLEDQDEIQVSPIPWKGPRSGILLRTLSYTKGL  338 (590)
T ss_pred             CCccccccccccccccccccccccccccccccccceeeccCcceeeeccccccccccccccccCCCccceeEeccCCccC
Confidence            0000000 0000000001345667788899999999 68988899999999999999999999777789999999996  


Q ss_pred             ccccCCCceeeeeEEEEeeccCCCcEEEEEEEeeCCCCCCCeEEEEEEEEEEecCCCCCccEEEEEEEEEEEeeeeehhh
Q 001987          872 NRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQR  951 (985)
Q Consensus       872 ~~~~~~~~~~~~~~q~~~~~~~~~~~vv~~~~~~~dVPygd~F~v~~ry~i~~~~~~~~~~~l~v~~~v~~~k~t~~K~~  951 (985)
                      ..+++|+.+.|.++|...+....+++.|...+.|+|||||++|+|++||||+|..+  ++|+|.|+.+|.|.+++|.+.+
T Consensus       339 ~~~~gPk~t~~~~~~~l~~~~~~~~~~vls~t~~~~vps~~~f~v~~~y~i~~~~~--~~~~l~v~~~V~~~~~sw~~~~  416 (590)
T KOG1032|consen  339 PAKSGPKSTDCEGTQTLHHQDLEKYFRVLSETLTPDVPSGDSFYVKTRYLISRAGS--NSCKLKVSTSVEWTKSSWDVPV  416 (590)
T ss_pred             CCcCCCccccccceeeEEeccchhhhhhhheeccCCccccceeeeeEEEEEEecCC--cceeecceeEEEeccCchhhcc
Confidence            88999999999999888888888889999999999999999999999999999999  9999999999999999999999


Q ss_pred             hhhchH
Q 001987          952 ITQNIT  957 (985)
Q Consensus       952 Ie~~~~  957 (985)
                      +|.++.
T Consensus       417 ~~~~~~  422 (590)
T KOG1032|consen  417 SEIGSN  422 (590)
T ss_pred             cccccc
Confidence            999886



>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>PF02893 GRAM: GRAM domain; InterPro: IPR004182 The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00568 GRAM domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 3e-07
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 3e-05
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 3e-05
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 3e-05
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 3e-04
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 8e-04
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 8e-04
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 44/144 (30%), Positives = 67/144 (46%), Gaps = 25/144 (17%) Query: 3 STRLYVYVLQGQDLLAKDS------YVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNI 56 S ++ + V+ Q L AKD YV VQ+GK K +++ + N NPVW E F F HN Sbjct: 16 SAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNS 75 Query: 57 DDEELVVSVFQHNDD------SGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETP 110 D + V V +DD S + +G+ + V +++ E W++L+ Sbjct: 76 SD-RIKVRVLDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGE-----MDVWYNLD-- 127 Query: 111 KTRKFTNKDC--GKILLTISLNGK 132 K T+K G I L IS+ K Sbjct: 128 ---KRTDKSAVSGAIRLHISVEIK 148
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 4e-26
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-16
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-24
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-20
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 2e-23
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 6e-11
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 2e-23
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 2e-11
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 7e-23
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-05
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 7e-23
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 7e-05
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 6e-22
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-15
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-21
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-17
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-21
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 3e-18
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-20
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 3e-13
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 3e-19
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 4e-14
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-19
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-17
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 5e-19
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-12
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-18
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 4e-09
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 5e-18
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 2e-13
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 7e-18
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 6e-12
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 5e-17
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-09
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 6e-17
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 1e-09
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 1e-16
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 4e-10
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 1e-16
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 8e-09
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-16
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 7e-09
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-16
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 4e-09
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 4e-16
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-07
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 6e-16
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-14
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 8e-09
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-07
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-16
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 3e-15
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-10
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-07
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 9e-16
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-07
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-15
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 4e-07
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-15
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-06
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-15
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 5e-11
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 2e-15
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 7e-07
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-15
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-06
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 2e-15
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 3e-07
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-15
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 1e-07
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 7e-15
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 9e-10
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-14
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-06
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 3e-14
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 4e-07
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 9e-13
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 3e-06
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 1e-12
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 6e-09
3nsj_A540 Perforin-1; pore forming protein, immune system; H 1e-10
3nsj_A540 Perforin-1; pore forming protein, immune system; H 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 6e-09
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 2e-07
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 5e-04
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 3e-04
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
 Score =  104 bits (260), Expect = 4e-26
 Identities = 42/142 (29%), Positives = 65/142 (45%), Gaps = 21/142 (14%)

Query: 3   STRLYVYVLQGQDLLAKDS------YVKVQIGKHKSKSRILKNNSNPVWNEEFVFRVHNI 56
           S ++ + V+  Q L AKD       YV VQ+GK K +++ +  N NPVW E F F  HN 
Sbjct: 16  SAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNS 75

Query: 57  DDEELVVSVFQHNDD------SGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETP 110
            D  + V V   +DD            S + +G+  + V +++ E        W++L+  
Sbjct: 76  SD-RIKVRVLDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEM-----DVWYNLD-- 127

Query: 111 KTRKFTNKDCGKILLTISLNGK 132
             R   +   G I L IS+  K
Sbjct: 128 -KRTDKSAVSGAIRLHISVEIK 148


>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.85
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.84
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.84
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.83
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.82
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.81
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.81
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.81
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.79
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.78
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.78
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.77
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.76
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.76
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.75
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.74
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.74
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.74
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.74
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.74
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.74
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.73
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.73
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.73
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.73
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.73
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.73
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.72
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.72
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.71
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.71
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.71
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.71
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.71
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.71
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.71
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.7
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.7
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.69
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.69
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.69
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.69
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.68
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.67
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.67
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.66
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.64
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.64
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.63
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.62
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.61
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.61
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.61
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.6
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.6
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.6
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.59
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.59
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.59
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.58
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.58
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.58
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.58
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.58
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.57
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.57
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.55
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.55
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.55
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.55
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.55
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.54
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.53
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.53
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.53
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.52
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.52
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.51
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.49
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.47
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.47
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.39
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 99.37
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.34
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.26
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.24
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 99.24
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.14
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.11
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.09
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.05
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.05
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.01
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.94
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.84
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.77
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.67
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.64
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 93.57
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 90.46
2pcs_A162 Conserved protein; structural genomics, unknown fu 90.09
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 88.72
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 87.34
2wxf_A940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 87.04
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 86.92
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 86.85
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 85.29
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 83.78
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 81.91
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 80.6
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.85  E-value=1.4e-20  Score=206.50  Aligned_cols=166  Identities=23%  Similarity=0.397  Sum_probs=139.4

Q ss_pred             CcEEEEEEEEeecCC------CCCcEEEEEECC---eEEeecCccCCCCCeEeeEEEEEEe--cCCCceEEEEEEecCCC
Q 001987            3 STRLYVYVLQGQDLL------AKDSYVKVQIGK---HKSKSRILKNNSNPVWNEEFVFRVH--NIDDEELVVSVFQHNDD   71 (985)
Q Consensus         3 ~~~L~V~V~~Ar~L~------~~DPyv~v~l~~---~~~kT~v~~~t~nP~wnE~f~f~v~--~~~~~~L~~~V~D~d~~   71 (985)
                      .+.|.|+|++|+||+      .+||||++++++   ++++|+++++++||.|||+|.|.+.  +.....|.|+|||+|  
T Consensus        18 ~~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~~l~~~V~d~d--   95 (284)
T 2r83_A           18 NNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYDFD--   95 (284)
T ss_dssp             TTEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCTTCEEEEEEEECC--
T ss_pred             CCEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhCcCEEEEEEEECC--
Confidence            578999999999998      689999999964   4689999999999999999999986  235689999999999  


Q ss_pred             CCCCCCCCCeeEEEEEeCccccccCCCCCCCeEEEeecCCCCCCCCccccEEEEEEEEEecCCeeeEEEEeeeccCCCCC
Q 001987           72 SGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLETPKTRKFTNKDCGKILLTISLNGKGHNLSSNRLLYLHSNVSSN  151 (985)
Q Consensus        72 ~~~~~~~d~~lG~~~i~L~~l~~~~~~~~~~~W~~L~~~~~~~~~~~~~G~I~lsl~~~~~~~~l~v~v~~~~a~~L~~~  151 (985)
                       +  .+++++||++.++|.++..+   .....|++|......+  ....|+|++++.|.+..+.+.+.|+.  |++|+.+
T Consensus        96 -~--~~~~~~lG~~~i~l~~l~~~---~~~~~w~~L~~~~~~~--~~~~G~i~l~l~~~p~~~~l~v~v~~--a~~L~~~  165 (284)
T 2r83_A           96 -R--FSKHDIIGEFKVPMNTVDFG---HVTEEWRDLQSAEKEE--QEKLGDICFSLRYVPTAGKLTVVILE--AKNLKKM  165 (284)
T ss_dssp             -S--SSCCCEEEEEEEEGGGCCCS---SCEEEEEECBCCSSCC--CCCCCEEEEEEEEETTTTEEEEEEEE--EESCCCC
T ss_pred             -C--CCCCceeEEEEEcchhcccC---CcceeEEEeecccccc--ccccccEEEEEEecCcCCceEEEEEE--eECCCCc
Confidence             4  57899999999999999765   2457899998433221  34689999999999999999988886  8899999


Q ss_pred             CCCCCCCCeEEEEEcCCCCCCcccccccc
Q 001987          152 ESKELEDPCVLSHDVSCSKAPCLDVTEGN  180 (985)
Q Consensus       152 d~~g~sdP~vkv~l~~~~~~~~~k~~~~~  180 (985)
                      |..|.+||||++++..++....+++|+..
T Consensus       166 d~~~~~dpyv~v~~~~~~~~~~~~kT~v~  194 (284)
T 2r83_A          166 DVGGLSDPYVKIHLMQNGKRLKKKKTTIK  194 (284)
T ss_dssp             STTSCCCEEEEEEEEETTEEEEEEECCCC
T ss_pred             CCCCCcCeEEEEEEEeCCcEeeeecccee
Confidence            99999999999999887655445555444



>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 985
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 4e-15
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-11
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 7e-15
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 9e-08
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 6e-13
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 6e-05
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 2e-12
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 4e-12
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 4e-12
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-08
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-11
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-06
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 3e-11
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 0.001
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 4e-11
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 0.004
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-10
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 3e-09
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 2e-10
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 3e-10
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 4e-10
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 8e-10
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 4e-10
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 6e-05
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 6e-10
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 2e-07
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 9e-10
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 8e-07
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-09
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 6e-09
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 4e-09
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 0.001
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 2e-08
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 8e-07
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 9e-05
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 2e-06
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 1e-04
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Regulating synaptic membrane exocytosis protein, rim2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.9 bits (173), Expect = 4e-15
 Identities = 23/118 (19%), Positives = 53/118 (44%), Gaps = 21/118 (17%)

Query: 5   RLYVYVLQGQDLLAKDS------YVKVQI-----GKHKSKSRILKNNSNPVWNEEFVFRV 53
           +L V +L  +DL +++       YVK+        K+K +++ +K    P WN+ F++  
Sbjct: 15  QLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSP 74

Query: 54  ---HNIDDEELVVSVFQHNDDSGLFGSSGELMGRVRVPVSSIAAEDNHMLPPTWFSLE 108
                  +  L ++++   D + +     E +G + + + +   +D     P W+ L+
Sbjct: 75  VHRREFRERMLEITLW---DQARVREEESEFLGEILIELETALLDD----EPHWYKLQ 125


>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.84
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.78
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.78
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.78
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.77
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.75
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.75
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.74
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.73
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.72
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.72
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.72
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.71
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.71
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.7
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.68
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.67
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.65
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.64
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.64
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.63
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.6
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.58
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.58
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.58
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.58
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.57
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.57
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.56
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.5
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.49
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.48
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.48
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.48
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.47
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.44
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.39
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.34
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.3
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 91.38
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 91.34
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 89.97
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 84.69
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=4.5e-21  Score=181.25  Aligned_cols=119  Identities=24%  Similarity=0.411  Sum_probs=105.0

Q ss_pred             CCeEEEEEEEEeecCCCCCCCCCCCcEEEEEECCEEEEeeeccCCCCCeEeEEEEEEeecCCCCEEEEEEEecCCCCCCC
Q 001987          534 DGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEEPPSVLDVEVFDFDGPFDQA  613 (985)
Q Consensus       534 ~~g~L~V~v~~a~~L~~~d~~g~~DPyv~v~~~~~~~kT~~~~~tlnP~Wne~f~f~v~~~~~~~L~v~V~D~d~~~~~d  613 (985)
                      +.|.|+|+|++|+||+++|..|.+||||++++++++++|+++++|+||+|||+|.|.+ ..+...|.|+|||+|. +++|
T Consensus         4 ~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v-~~~~~~L~i~V~d~~~-~~~d   81 (126)
T d2ep6a1           4 DVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPI-KDIHDVLEVTVFDEDG-DKPP   81 (126)
T ss_dssp             CSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEE-SCTTCEEEEEEEEEET-TEEE
T ss_pred             ccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCCeEEEEEeeCCceeEEEEEEEEEEE-eccCceeEEEEEEccC-CcCc
Confidence            4589999999999999999999999999999999999999999999999999999995 5566899999999998 7899


Q ss_pred             CccceEEEEeeccccCcccceEEEccccc-cCCcceeEEEEEee
Q 001987          614 TSLGHAEINFLKHTSTELADMWVSLEGKL-AQSAQSKVHLRIFL  656 (985)
Q Consensus       614 d~lG~~~i~l~~l~~~~~~~~w~~L~~~~-~~~~~g~l~l~~~l  656 (985)
                      ++||++.|+|.++..+.  ..|+.|.... ....+|.|+|++.+
T Consensus        82 ~~lG~~~i~l~~l~~~~--~~~~~l~~~~~~~~~~G~i~l~~~~  123 (126)
T d2ep6a1          82 DFLGKVAIPLLSIRDGQ--PNCYVLKNKDLEQAFKGVIYLEMDL  123 (126)
T ss_dssp             EECCBCEEEGGGCCSSC--CEECCCBCSCTTSCCSSEEEEEEEE
T ss_pred             ceEEEEEEEHHHCCCCC--ceEEEccccCCCCceeEEEEEEEEE
Confidence            99999999999986654  5799887643 33456999999864



>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure