Citrus Sinensis ID: 001990

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-----
MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccccccEEEEEcccccccccccEEEEEEEcccccEEEccHHHHHHHHHHcccEEEEEHHHHHHHcccccccccccEEEEccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHccccEEEEcccEEEEEccccccHHHHHHHHHHHHcccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHcccEEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccHHHHHccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccccccccccHHHHHHHHccccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccc
cHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHEEcccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHcccccHHHHHHHHHHHccccHHHHHHHHccHHHcccccccccccccccHHHHHHHHHHHHHHcHHHHHHcccccccccccHHHHHHHHcccccEcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHEEEEEccccccEEEEEccHHHcccccccEEEEEEEcccccccEccHHHHHHHHHHcccEEEEEHHHHHHHHcccccccccEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccEEEEEcccHHHHHHHHHHccccEEEEcccEEEEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHcccccccccccHcccccHHHHHHHHHHHHHcccccccccccccccHHHHcccHccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHHHHHHHHcccEEEEcccccccEEcccccccccccEcHEccccEEEccccccccccccHcHHHHcccccccccEEcccccccccccccccEEEccccccHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEEEEEccHHHHHccccHHHHHHHHHHccccccccccccccEEEEcccccccHccHHHHHHHHHHHHHHHHHHHHHccccccc
MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAAtytpsrylsslscapfvcsnnsrsdllqsrnmshhnvngyglgsqtrgisvealkpsdtfarrhnsatpedqAKMSelvgldnldslidatvpksiridsmkfskfdegltESQMIEHMQKLASMNKVYKSFIgmgyynthvpPVILrnimenpawytqytpYQAEIAQGRLESLLNFQTMIAdltglpmsnasllDEGTAAAEAMAMCNNIQKGKKKTFIiasnchpqtidicitradgfDIKVVVSDlkdidyksgdvCGVLvqypgtegevldygDFIKNAHANGVKVVMATDLLALtilkppgelgadIVVGSaqrfgvpmgyggphaafLATSQEYkrmmpgrivgvsidssgkpALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGlkklgtvevqglpffdtvkvkCADAHAIASAAYKIEMNLrvvdsntvtasfdetttledvDKLFIVFAggksvpftAASLAEEVETaipsgltrespylthpvfnkyhTEHELLRYIHLLQSKELslchsmiplgsctmklnattemmpvtwpsfanihpfapadqaqGYQEMFNNLGEWLCtitgfdsfslqpnagaagEYAGLMVIRAYHKargdhhrnvciipvsahgtnpataAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVtypsthgvyeeGIDEICKIIhdnggqvymdganmnaqvgltspgyigadvchlnlhktfciphggggpgmgpigvkkhlapflpshpvvstggipapeksqplgtiaaapwgsaliLPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHypilfrgvngtvAHEFIVDLRglkntagiepEDVAKRLMdygfhgptmswpvpgtlmiepteseskvchNREDLFFQILLSLTKFTTFAGRVGQVL
merarrlasrafLKRLvneskqlsrnhreskssaaaAATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTfarrhnsatpedqakmseLVGLDNLDSLIDATvpksiridsmkfskFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVsidssgkpALRVAMQTREqhirrdkatsNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASfdetttledvDKLFIVFAGGKSVPFTAASLAEEVETAIpsgltrespyLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
MERARRLASRAFLKRLVNESKQLSRNHRESKssaaaaaTYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIphggggpgmgpigVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
********************************************YLSSLSCAPFVC*************************************************************GLDNLDSLIDATVPKSIRIDSMKFSKF********MIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSI***********************ATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV*************LGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPT***SKVCHNREDLFFQILLSLTKFTTFAGRV****
*********************************************************************************************PSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRI************TESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALR******************ICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTG***********GTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
********SRAFLKRLVNES*****************ATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
*****RLASRAFLKRLVNES******************************************************************ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGR*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHNREDLFFQILLSLTKFTTFAGRVGQVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query985 2.2.26 [Sep-21-2011]
P493611037 Glycine dehydrogenase [de N/A no 0.963 0.915 0.843 0.0
P493621034 Glycine dehydrogenase [de N/A no 0.960 0.914 0.844 0.0
O498521034 Glycine dehydrogenase [de N/A no 0.960 0.914 0.842 0.0
O498501034 Glycine dehydrogenase [de N/A no 0.960 0.914 0.844 0.0
O499541035 Glycine dehydrogenase [de N/A no 0.960 0.914 0.829 0.0
Q94B781037 Glycine dehydrogenase [de yes no 0.963 0.915 0.824 0.0
O809881044 Glycine dehydrogenase [de no no 0.967 0.912 0.824 0.0
P269691057 Glycine dehydrogenase [de N/A no 0.975 0.909 0.821 0.0
Q3M9G1974 Glycine dehydrogenase [de yes no 0.863 0.873 0.590 0.0
B2J427979 Glycine dehydrogenase [de yes no 0.880 0.885 0.583 0.0
>sp|P49361|GCSPA_FLAPR Glycine dehydrogenase [decarboxylating] A, mitochondrial OS=Flaveria pringlei GN=GDCSPA PE=2 SV=1 Back     alignment and function desciption
 Score = 1665 bits (4311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/974 (84%), Positives = 880/974 (90%), Gaps = 25/974 (2%)

Query: 1   MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCS-NN 59
           MERARRLA++A L RLV+++K     H  S SS A     +PSRY+SSLS  P+VCS  N
Sbjct: 1   MERARRLANKAILGRLVSQTK-----HNPSISSPALC---SPSRYVSSLS--PYVCSGTN 50

Query: 60  SRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGL 119
            RSD          N+NG+G  SQ R ISVEALKPSDTF RRHNSATPE+Q KM+E VG 
Sbjct: 51  VRSD---------RNLNGFG--SQVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGF 99

Query: 120 DNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTH 179
            NLDSLIDATVPKSIR+DSMK+SKFDEGLTESQMI HMQ LAS NK++KSFIGMGYYNT 
Sbjct: 100 PNLDSLIDATVPKSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTS 159

Query: 180 VPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTA 239
           VP VILRNIMENP WYTQYTPYQAEIAQGRLESLLNFQTM+ DLTGLPMSNASLLDEGTA
Sbjct: 160 VPTVILRNIMENPGWYTQYTPYQAEIAQGRLESLLNFQTMVTDLTGLPMSNASLLDEGTA 219

Query: 240 AAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVC 299
           AAEAMAMCNNIQKGKKKTFIIASNCHPQTIDIC TRADGFD+KVV SDLKD DY SGDVC
Sbjct: 220 AAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVC 279

Query: 300 GVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRF 359
           GVLVQYPGTEGE+LDY +FIKNAHANGVKVVMA+DLLALTILKPPGELGADIVVGSAQRF
Sbjct: 280 GVLVQYPGTEGELLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRF 339

Query: 360 GVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSN 419
           GVPMGYGGPHAAFLATSQEYKRMMPGRI+GVS+DSSGKPALR+AMQTREQHIRRDKATSN
Sbjct: 340 GVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSN 399

Query: 420 ICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVK 479
           ICTAQALLANMAAM+ VYHGPEGLKTIA+RVHGLAGTFA GLKKLGTV+VQ LPFFDTVK
Sbjct: 400 ICTAQALLANMAAMFGVYHGPEGLKTIAKRVHGLAGTFAAGLKKLGTVQVQDLPFFDTVK 459

Query: 480 VKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAAS 539
           V C D+ AIA  AYK +MNLR+VD NT+T +FDETTT+EDVD LF VFA GK V FTAAS
Sbjct: 460 VTCVDSKAIAEEAYKHKMNLRIVDKNTITVAFDETTTIEDVDTLFKVFALGKPVTFTAAS 519

Query: 540 LAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTM 599
           +A EV+ AIPSGL RE+PYLTHP+FN YHTEHELLRYI  LQSK+LSLCHSMIPLGSCTM
Sbjct: 520 IAPEVQDAIPSGLVRETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTM 579

Query: 600 KLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAA 659
           KLNATTEMMPVTWP+FA+IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAA
Sbjct: 580 KLNATTEMMPVTWPAFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAA 639

Query: 660 GEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEE 719
           GEYAGLMVIRAYH ARGDHHRNVCIIPVSAHGTNPA+AAMCGMKI++VGTD+KGNINIEE
Sbjct: 640 GEYAGLMVIRAYHMARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEE 699

Query: 720 LRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSP 779
           LRKAAEAN++NLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSP
Sbjct: 700 LRKAAEANKENLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSP 759

Query: 780 GYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPL 839
           G+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVV+TGGIPAPE+SQPL
Sbjct: 760 GWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVATGGIPAPEQSQPL 819

Query: 840 GTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNG 899
           GTIAAAPWGSALILPISYTYIAMMGS+G+T ASKIAILNANYMAKRLE HYPILFRGVNG
Sbjct: 820 GTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRLENHYPILFRGVNG 879

Query: 900 TVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVCHN 959
           TVAHEFIVDLR LK TAGIEPEDVAKRL+DYGFHGPTMSWPVPGTLMIEPTESESK    
Sbjct: 880 TVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLMIEPTESESKA--- 936

Query: 960 REDLFFQILLSLTK 973
             D F   L+S+ +
Sbjct: 937 ELDRFCDALISIRQ 950
The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.
Flaveria pringlei (taxid: 4226)
EC: 1EC: .EC: 4EC: .EC: 4EC: .EC: 2
>sp|P49362|GCSPB_FLAPR Glycine dehydrogenase [decarboxylating] B, mitochondrial OS=Flaveria pringlei GN=GDCSPB PE=3 SV=1 Back     alignment and function description
>sp|O49852|GCSP_FLATR Glycine dehydrogenase [decarboxylating], mitochondrial OS=Flaveria trinervia GN=GDCSPA PE=3 SV=1 Back     alignment and function description
>sp|O49850|GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mitochondrial OS=Flaveria anomala GN=GDCSP PE=3 SV=1 Back     alignment and function description
>sp|O49954|GCSP_SOLTU Glycine dehydrogenase [decarboxylating], mitochondrial OS=Solanum tuberosum GN=GDCSP PE=2 SV=1 Back     alignment and function description
>sp|Q94B78|GCSP2_ARATH Glycine dehydrogenase [decarboxylating] 2, mitochondrial OS=Arabidopsis thaliana GN=At4g33010 PE=1 SV=2 Back     alignment and function description
>sp|O80988|GCSP1_ARATH Glycine dehydrogenase [decarboxylating] 1, mitochondrial OS=Arabidopsis thaliana GN=GDCSP PE=1 SV=1 Back     alignment and function description
>sp|P26969|GCSP_PEA Glycine dehydrogenase [decarboxylating], mitochondrial OS=Pisum sativum GN=GDCSP PE=1 SV=1 Back     alignment and function description
>sp|Q3M9G1|GCSP_ANAVT Glycine dehydrogenase [decarboxylating] OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gcvP PE=3 SV=1 Back     alignment and function description
>sp|B2J427|GCSP_NOSP7 Glycine dehydrogenase [decarboxylating] OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gcvP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query985
2240888381060 precursor of carboxylase p-protein 1, gl 0.979 0.910 0.856 0.0
1341428001060 mitochondrial glycine decarboxylase comp 0.979 0.910 0.857 0.0
13461161037 RecName: Full=Glycine dehydrogenase [dec 0.963 0.915 0.843 0.0
4380031037 P protein [Flaveria pringlei] 0.963 0.915 0.841 0.0
13461171034 RecName: Full=Glycine dehydrogenase [dec 0.960 0.914 0.844 0.0
33341991034 RecName: Full=Glycine dehydrogenase [dec 0.960 0.914 0.842 0.0
33341981034 RecName: Full=Glycine dehydrogenase [dec 0.960 0.914 0.844 0.0
3594762461043 PREDICTED: glycine dehydrogenase [decarb 0.970 0.916 0.842 0.0
3565640511056 PREDICTED: glycine dehydrogenase [decarb 0.982 0.916 0.833 0.0
33342001035 RecName: Full=Glycine dehydrogenase [dec 0.960 0.914 0.829 0.0
>gi|224088838|ref|XP_002308562.1| precursor of carboxylase p-protein 1, glycine decarboxylase complex [Populus trichocarpa] gi|222854538|gb|EEE92085.1| precursor of carboxylase p-protein 1, glycine decarboxylase complex [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1674 bits (4334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 836/976 (85%), Positives = 897/976 (91%), Gaps = 11/976 (1%)

Query: 1   MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAAT--YTPSRYLSSLSCAPFVCSN 58
           MERARRLA+RA LKRLVNESKQ  +  R   S   +++   YTPSRY+SSLS      S 
Sbjct: 1   MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSF---GSR 57

Query: 59  NSRSDLLQ-SRNMSHHNV--NGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSE 115
           + RS LL  ++N+  HNV    YG+GSQ R ISVE+LKPSDTF RRHNSATPE+Q KM+E
Sbjct: 58  SPRSGLLPGTKNIVSHNVPAGSYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAE 117

Query: 116 LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY 175
           L G D LDSLIDATVPKSIR+DSMKFSKFD GLTESQMIEHM  LAS NKV+KS+IGMGY
Sbjct: 118 LCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGMGY 177

Query: 176 YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD 235
           YNTHVPPVILRNIMENPAWYTQYTPYQAEI+QGRLESLLN+QTMI DLTGLPMSNASLLD
Sbjct: 178 YNTHVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLD 237

Query: 236 EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS 295
           EGTAAAEAMAMCNNIQKGKKKTFIIA+NCHPQTIDIC TRA GFD+KVV +DLKDIDYKS
Sbjct: 238 EGTAAAEAMAMCNNIQKGKKKTFIIANNCHPQTIDICDTRAGGFDLKVVTADLKDIDYKS 297

Query: 296 GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS 355
           GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct: 298 GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS 357

Query: 356 AQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDK 415
           AQRFGVPMGYGGPHAAFLATSQEYKRMMPGRI+GVS+DSSGKPALR+AMQTREQHIRRDK
Sbjct: 358 AQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDK 417

Query: 416 ATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFF 475
           ATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAG F +GLKKLGTVEVQGLPFF
Sbjct: 418 ATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGAFTVGLKKLGTVEVQGLPFF 477

Query: 476 DTVKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPF 535
           DTVKVKCADAHAIA AAYK E+NLRVVD+ T+T SFDETTTLEDVDKLF VF+GGK VPF
Sbjct: 478 DTVKVKCADAHAIADAAYKSEINLRVVDAKTITVSFDETTTLEDVDKLFKVFSGGKPVPF 537

Query: 536 TAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLG 595
           TAASLA EV+  IPSGLTRESPYLTHP+FN YHTEHELLRY+H LQSK+LSLCHSMIPLG
Sbjct: 538 TAASLAPEVQNVIPSGLTRESPYLTHPIFNTYHTEHELLRYMHRLQSKDLSLCHSMIPLG 597

Query: 596 SCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPN 655
           SCTMKLNAT+EMMPVT P+F ++HPFAP +Q+QGYQEMF++LG+ LCTITGFDSFS QPN
Sbjct: 598 SCTMKLNATSEMMPVTLPNFTDMHPFAPTEQSQGYQEMFDDLGDLLCTITGFDSFSFQPN 657

Query: 656 AGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNI 715
           AGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPA+AAMCGMKIV+VGTDAKGNI
Sbjct: 658 AGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPASAAMCGMKIVAVGTDAKGNI 717

Query: 716 NIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVG 775
           N+EELRKAAE NRDNLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVG
Sbjct: 718 NVEELRKAAEDNRDNLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVG 777

Query: 776 LTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEK 835
           LTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGV+KHLAP+LPSHPVV TGGIPAP++
Sbjct: 778 LTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVQKHLAPYLPSHPVVPTGGIPAPDQ 837

Query: 836 SQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFR 895
           SQPLGTI+AAPWGSALILPISYTYIAMMGSKGLT+ASKIAILNANYMAKRLE +YPILFR
Sbjct: 838 SQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRLENYYPILFR 897

Query: 896 GVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESK 955
           GVNGTVAHEFIVDLRG+KNTAGIEPEDVAKRLMDYGFH PTMSWPVPGTLMIEPTESESK
Sbjct: 898 GVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESK 957

Query: 956 VCHNREDLFFQILLSL 971
                 D F   L+S+
Sbjct: 958 A---ELDRFCDALISI 970

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|134142800|gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus tremuloides] Back     alignment and taxonomy information
>gi|1346116|sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase [decarboxylating] A, mitochondrial; AltName: Full=Glycine cleavage system P protein A; AltName: Full=Glycine decarboxylase A; Flags: Precursor gi|608712|emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei] Back     alignment and taxonomy information
>gi|438003|emb|CAA81076.1| P protein [Flaveria pringlei] Back     alignment and taxonomy information
>gi|1346117|sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase [decarboxylating] B, mitochondrial; AltName: Full=Glycine cleavage system P protein B; AltName: Full=Glycine decarboxylase B; Flags: Precursor gi|1000489|emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei] Back     alignment and taxonomy information
>gi|3334199|sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase [decarboxylating], mitochondrial; AltName: Full=Glycine cleavage system P protein; AltName: Full=Glycine decarboxylase; Flags: Precursor gi|2894360|emb|CAB16916.1| P-Protein precursor [Flaveria trinervia] Back     alignment and taxonomy information
>gi|3334198|sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase [decarboxylating], mitochondrial; AltName: Full=Glycine cleavage system P protein; AltName: Full=Glycine decarboxylase; Flags: Precursor gi|2894358|emb|CAB16911.1| P-protein [Flaveria anomala] Back     alignment and taxonomy information
>gi|359476246|ref|XP_002279590.2| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
>gi|356564051|ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|3334200|sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase [decarboxylating], mitochondrial; AltName: Full=Glycine cleavage system P protein; AltName: Full=Glycine decarboxylase; Flags: Precursor gi|2894362|emb|CAB16918.1| P-Protein precursor [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query985
UNIPROTKB|P269691057 GDCSP "Glycine dehydrogenase [ 0.980 0.913 0.812 0.0
TAIR|locus:20574641044 GLDP2 "glycine decarboxylase P 0.967 0.912 0.809 0.0
TAIR|locus:21237771037 GLDP1 "glycine decarboxylase P 0.960 0.912 0.804 0.0
MGI|MGI:13411551025 Gldc "glycine decarboxylase" [ 0.908 0.873 0.545 6.5e-264
DICTYBASE|DDB_G0287255994 gcvP "glycine dehydrogenase (d 0.864 0.857 0.568 3.2e-262
UNIPROTKB|E2R9Z71023 GLDC "Uncharacterized protein" 0.884 0.851 0.542 4.9e-259
UNIPROTKB|E1BJQ11020 GLDC "Uncharacterized protein" 0.885 0.854 0.542 6.2e-259
TIGR_CMR|CPS_1276965 CPS_1276 "glycine dehydrogenas 0.877 0.895 0.552 3.1e-257
UNIPROTKB|P233781020 GLDC "Glycine dehydrogenase [d 0.898 0.867 0.534 8.2e-257
TIGR_CMR|CPS_3846956 CPS_3846 "glycine dehydrogenas 0.850 0.876 0.555 3.6e-256
UNIPROTKB|P26969 GDCSP "Glycine dehydrogenase [decarboxylating], mitochondrial" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
 Score = 4075 (1439.5 bits), Expect = 0., P = 0.
 Identities = 793/976 (81%), Positives = 856/976 (87%)

Query:     1 MERARRLASRAFLKRLVNESKQLSRNHRESKXXXX---XXXTYTPSRYLSSLSCAPFVCS 57
             MERARRLA+RA LKRL++E+KQ  +    S           + + SRY+SS+S +  +  
Sbjct:     1 MERARRLANRATLKRLLSEAKQNRKTESTSTTTTTPLPFSLSGSSSRYVSSVSNS-ILRG 59

Query:    58 NNSRSDLLQSRNMSHHNVNGYGLGSQTRGISVEALKPSDTFARRHNSATPEDQAKMSELV 117
               S+ D   SR +      G G  SQ+R ISVEALKPSDTF RRHNSATP++Q KM+E V
Sbjct:    60 RGSKPDNNVSRRVG--GFLGVGYPSQSRSISVEALKPSDTFPRRHNSATPDEQTKMAESV 117

Query:   118 GLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYN 177
             G D LDSL+DATVPKSIR+  MKF+KFD GLTE QMIEHM+ LAS NKV+KSFIGMGYYN
Sbjct:   118 GFDTLDSLVDATVPKSIRLKEMKFNKFDGGLTEGQMIEHMKDLASKNKVFKSFIGMGYYN 177

Query:   178 THVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEG 237
             THVPPVILRNIMENPAWYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLDEG
Sbjct:   178 THVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG 237

Query:   238 TAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGD 297
             TAAAEAM+MCNNIQKGKKKTFIIASNCHPQTIDIC TRADGF++KVVV DLKDIDYKSGD
Sbjct:   238 TAAAEAMSMCNNIQKGKKKTFIIASNCHPQTIDICQTRADGFELKVVVKDLKDIDYKSGD 297

Query:   298 VCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGSAQ 357
             VCGVLVQYPGTEGEVLDYG+FIK AHAN VKVVMA+DLLALT+LKPPGE GADIVVGSAQ
Sbjct:   298 VCGVLVQYPGTEGEVLDYGEFIKKAHANEVKVVMASDLLALTVLKPPGEFGADIVVGSAQ 357

Query:   358 RFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKAT 417
             RFGVPMGYGGPHAAFLATSQEYKRMMPGRI+GVS+DSSGK ALR+AMQTREQHIRRDKAT
Sbjct:   358 RFGVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKQALRMAMQTREQHIRRDKAT 417

Query:   418 SNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDT 477
             SNICTAQALLANMAAMYAVYHGPEGLK IAQRVHGLAG FALGLKKLG +EVQ L FFDT
Sbjct:   418 SNICTAQALLANMAAMYAVYHGPEGLKAIAQRVHGLAGVFALGLKKLG-LEVQDLGFFDT 476

Query:   478 VKVKCADAHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTA 537
             VKVK ++A AIA AA K E+NLRVVD NT+TA+FDETTTLEDVDKLF VFAGGK V FTA
Sbjct:   477 VKVKTSNAKAIADAAIKSEINLRVVDGNTITAAFDETTTLEDVDKLFKVFAGGKPVSFTA 536

Query:   538 ASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSC 597
             ASLA E + AIPSGL RESPYLTHP+FN Y TEHELLRYIH LQSK+LSLCHSMIPLGSC
Sbjct:   537 ASLAPEFQNAIPSGLVRESPYLTHPIFNTYQTEHELLRYIHRLQSKDLSLCHSMIPLGSC 596

Query:   598 TMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAG 657
             TMKLNATTEMMPVTWPSF ++HPFAP +QAQGYQEMFNNLG+ LCTITGFDSFSLQPNAG
Sbjct:   597 TMKLNATTEMMPVTWPSFTDLHPFAPTEQAQGYQEMFNNLGDLLCTITGFDSFSLQPNAG 656

Query:   658 AAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINI 717
             AAGEYAGLMVIRAYH +RGDHHRNVCIIP SAHGTNPA+AAM GMKIV++GTDAKGNINI
Sbjct:   657 AAGEYAGLMVIRAYHLSRGDHHRNVCIIPASAHGTNPASAAMVGMKIVTIGTDAKGNINI 716

Query:   718 EELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLT 777
             EEL+KAAE ++DNLS  MVTYPSTHGVYEEGID+ICKIIHDNGGQVYMDGANMNAQVGLT
Sbjct:   717 EELKKAAEKHKDNLSAFMVTYPSTHGVYEEGIDDICKIIHDNGGQVYMDGANMNAQVGLT 776

Query:   778 SPGYIGADVCHLNLHKTFCIXXXXXXXXXXXXXVKKHLAPFLPSHPVVSTGGIPAPEKSQ 837
             SPG+IGADVCHLNLHKTFCI             VKKHLAPFLPSHPVV TGGIPAPE  Q
Sbjct:   777 SPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVPTGGIPAPENPQ 836

Query:   838 PLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGV 897
             PLG+I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRLE +YP+LFRGV
Sbjct:   837 PLGSISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLESYYPVLFRGV 896

Query:   898 NGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKVC 957
             NGTVAHEFI+DLRG KNTAGIEPEDVAKRLMDYGFHGPTMSWPV GTLMIEPTESESK  
Sbjct:   897 NGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVAGTLMIEPTESESKA- 955

Query:   958 HNREDLFFQILLSLTK 973
                 D F   L+S+ K
Sbjct:   956 --ELDRFCDALISIRK 969
GO:0005960 "glycine cleavage complex" evidence=IDA
TAIR|locus:2057464 GLDP2 "glycine decarboxylase P-protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123777 GLDP1 "glycine decarboxylase P-protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1341155 Gldc "glycine decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287255 gcvP "glycine dehydrogenase (decarboxylating)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9Z7 GLDC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJQ1 GLDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1276 CPS_1276 "glycine dehydrogenase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P23378 GLDC "Glycine dehydrogenase [decarboxylating], mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3846 CPS_3846 "glycine dehydrogenase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C5BAT0GCSP_EDWI91, ., 4, ., 4, ., 20.54780.87610.8989yesno
Q8DII3GCSP_THEEB1, ., 4, ., 4, ., 20.58050.85980.8878yesno
Q055P8GCSP_LEPBL1, ., 4, ., 4, ., 20.57350.85980.8786yesno
A7N5C4GCSP_VIBHB1, ., 4, ., 4, ., 20.58080.86390.8920yesno
C3JYR1GCSP_PSEFS1, ., 4, ., 4, ., 20.56920.85880.8942yesno
Q47XG2GCSP2_COLP31, ., 4, ., 4, ., 20.57090.85070.8765yesno
B5EUH1GCSP_VIBFM1, ., 4, ., 4, ., 20.57780.86390.8910yesno
Q1LHM2GCSP_RALME1, ., 4, ., 4, ., 20.56760.86700.8767yesno
P26969GCSP_PEA1, ., 4, ., 4, ., 20.82160.97560.9091N/Ano
Q04PM7GCSP_LEPBJ1, ., 4, ., 4, ., 20.57350.85980.8786yesno
Q3M9G1GCSP_ANAVT1, ., 4, ., 4, ., 20.59050.86390.8737yesno
P49361GCSPA_FLAPR1, ., 4, ., 4, ., 20.84390.96340.9151N/Ano
P49362GCSPB_FLAPR1, ., 4, ., 4, ., 20.84490.96040.9148N/Ano
Q7MEH9GCSP_VIBVY1, ., 4, ., 4, ., 20.57390.86390.8920yesno
P74416GCSP_SYNY31, ., 4, ., 4, ., 20.60320.87200.8738N/Ano
B2T7I8GCSP_BURPP1, ., 4, ., 4, ., 20.55860.88930.8957yesno
Q0BJI1GCSP_BURCM1, ., 4, ., 4, ., 20.56440.87100.88yesno
Q9RTF5GCSP_DEIRA1, ., 4, ., 4, ., 20.56140.87610.9093yesno
O80988GCSP1_ARATH1, ., 4, ., 4, ., 20.82420.96750.9128nono
Q8F937GCSP_LEPIN1, ., 4, ., 4, ., 20.57350.85980.8786yesno
Q3IFW1GCSP_PSEHT1, ., 4, ., 4, ., 20.56980.88420.9044yesno
Q6MPZ6GCSP_BDEBA1, ., 4, ., 4, ., 20.56410.88930.9144yesno
Q5DZM3GCSP_VIBF11, ., 4, ., 4, ., 20.57900.86390.8910yesno
Q4K7Q8GCSP1_PSEF51, ., 4, ., 4, ., 20.57320.86090.8916yesno
Q87I05GCSP_VIBPA1, ., 4, ., 4, ., 20.57380.88420.9129yesno
B2J427GCSP_NOSP71, ., 4, ., 4, ., 20.58370.88020.8855yesno
Q54KM7GCSP_DICDI1, ., 4, ., 4, ., 20.57880.87000.8621yesno
Q2STK2GCSP_BURTA1, ., 4, ., 4, ., 20.56610.86290.8717yesno
A9ACU3GCSP_BURM11, ., 4, ., 4, ., 20.56320.88420.8933yesno
O49852GCSP_FLATR1, ., 4, ., 4, ., 20.84290.96040.9148N/Ano
O49850GCSP_FLAAN1, ., 4, ., 4, ., 20.84490.96040.9148N/Ano
B1YQQ1GCSP_BURA41, ., 4, ., 4, ., 20.56670.87100.88yesno
Q13SR6GCSP_BURXL1, ., 4, ., 4, ., 20.56310.88930.8957yesno
Q6LHN5GCSP_PHOPR1, ., 4, ., 4, ., 20.57970.86090.8842yesno
C3LUU7GCSP_VIBCM1, ., 4, ., 4, ., 20.57900.86290.8909yesno
B6ES35GCSP_ALISL1, ., 4, ., 4, ., 20.57900.86390.8910yesno
Q72VI8GCSP_LEPIC1, ., 4, ., 4, ., 20.57240.85980.8786yesno
O49954GCSP_SOLTU1, ., 4, ., 4, ., 20.82900.96040.9140N/Ano
Q91W43GCSP_MOUSE1, ., 4, ., 4, ., 20.57200.87710.8429yesno
Q8D7G7GCSP_VIBVU1, ., 4, ., 4, ., 20.57390.86390.8920yesno
Q8YNF9GCSP_NOSS11, ., 4, ., 4, ., 20.57940.87610.8779yesno
P23378GCSP_HUMAN1, ., 4, ., 4, ., 20.55280.88420.8539yesno
Q39KU1GCSP_BURS31, ., 4, ., 4, ., 20.55870.87100.88yesno
A5EYY8GCSP_VIBC31, ., 4, ., 4, ., 20.57900.86290.8909yesno
P15505GCSP_CHICK1, ., 4, ., 4, ., 20.54770.88830.8715yesno
A1SY74GCSP_PSYIN1, ., 4, ., 4, ., 20.56860.87200.8892yesno
Q2SFI6GCSP_HAHCH1, ., 4, ., 4, ., 20.57940.87410.8968yesno
Q4ZXH2GCSP_PSEU21, ., 4, ., 4, ., 20.57090.86190.8899yesno
Q94B78GCSP2_ARATH1, ., 4, ., 4, ., 20.82490.96340.9151yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.4.4.20.979
3rd Layer1.4.40.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
PLN02414993 PLN02414, PLN02414, glycine dehydrogenase (decarbo 0.0
PRK05367954 PRK05367, PRK05367, glycine dehydrogenase; Provisi 0.0
TIGR00461939 TIGR00461, gcvP, glycine dehydrogenase (decarboxyl 0.0
PRK12566954 PRK12566, PRK12566, glycine dehydrogenase; Provisi 0.0
pfam02347429 pfam02347, GDC-P, Glycine cleavage system P-protei 0.0
COG1003496 COG1003, GcvP, Glycine cleavage system protein P ( 0.0
COG0403450 COG0403, GcvP, Glycine cleavage system protein P ( 0.0
PRK04366481 PRK04366, PRK04366, glycine dehydrogenase subunit 1e-163
cd00613398 cd00613, GDC-P, Glycine cleavage system P-protein, 1e-160
cd00613398 cd00613, GDC-P, Glycine cleavage system P-protein, 1e-156
PRK00451447 PRK00451, PRK00451, glycine dehydrogenase subunit 1e-117
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-11
pfam02347429 pfam02347, GDC-P, Glycine cleavage system P-protei 1e-10
PRK00451447 PRK00451, PRK00451, glycine dehydrogenase subunit 4e-10
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 1e-08
COG0403450 COG0403, GcvP, Glycine cleavage system protein P ( 2e-07
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 5e-06
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 4e-04
smart00263127 smart00263, LYZ1, Alpha-lactalbumin / lysozyme C 5e-04
COG1003496 COG1003, GcvP, Glycine cleavage system protein P ( 0.002
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 0.004
>gnl|CDD|178035 PLN02414, PLN02414, glycine dehydrogenase (decarboxylating) Back     alignment and domain information 
 Score = 1885 bits (4884), Expect = 0.0
 Identities = 762/874 (87%), Positives = 815/874 (93%), Gaps = 1/874 (0%)

Query: 82  SQTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF 141
            QTR ISVEALKPSDTF RRHNSATPE+Q  M+E  G D+LD+LIDATVPKSIR+DSMK 
Sbjct: 19  EQTRSISVEALKPSDTFPRRHNSATPEEQKAMAEYCGFDSLDALIDATVPKSIRLDSMKL 78

Query: 142 SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY 201
           SK+DEGLTESQM+EHM+ LAS NKV+KS+IGMGYYNTHVPPVILRNI+ENP WYTQYTPY
Sbjct: 79  SKYDEGLTESQMLEHMKSLASKNKVFKSYIGMGYYNTHVPPVILRNILENPGWYTQYTPY 138

Query: 202 QAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIA 261
           QAEIAQGRLESLLN+QTMI DLTGLPMSNASLLDEGTAAAEAMAMCNNI KGKKK F+IA
Sbjct: 139 QAEIAQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGKKKKFLIA 198

Query: 262 SNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKN 321
           SNCHPQTID+C TRADG  ++VVV+D KD DY SGDVCGVLVQYP T+GEVLDY +F+KN
Sbjct: 199 SNCHPQTIDVCQTRADGLGLEVVVADEKDFDYSSGDVCGVLVQYPATDGEVLDYAEFVKN 258

Query: 322 AHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKR 381
           AHANGVKVVMATDLLALT+LKPPGE GADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKR
Sbjct: 259 AHANGVKVVMATDLLALTMLKPPGEWGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKR 318

Query: 382 MMPGRIVGVSIDSSGKPALRVAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPE 441
           +MPGRI+GVS+DSSGKPALR+AMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPE
Sbjct: 319 LMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPE 378

Query: 442 GLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVKCADAHAIASAAYKIEMNLRV 501
           GLKTIAQRVHGLAG FA GLKKLG  +VQ LPFFDTVKVKC+DA AIA AA K+ +NLRV
Sbjct: 379 GLKTIAQRVHGLAGVFAAGLKKLG-FQVQSLPFFDTVKVKCSDADAIADAAAKVGINLRV 437

Query: 502 VDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTH 561
           VD+NTVT SFDETTTLEDVDKLF VFAGGK VPFTA SLA EV+++IPS L RESPYLTH
Sbjct: 438 VDANTVTVSFDETTTLEDVDKLFKVFAGGKPVPFTAESLAPEVDSSIPSSLARESPYLTH 497

Query: 562 PVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPF 621
           P+FN+YH+EHELLRY+H LQ+K+LSL HSMIPLGSCTMKLNATTEMMPVTWP FANIHPF
Sbjct: 498 PIFNQYHSEHELLRYLHRLQNKDLSLVHSMIPLGSCTMKLNATTEMMPVTWPEFANIHPF 557

Query: 622 APADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRN 681
           AP DQAQGYQEMF +LG+ LC ITGFDSFSLQPNAGAAGEYAGLMVIRAYH +RGDHHRN
Sbjct: 558 APVDQAQGYQEMFEDLGDLLCEITGFDSFSLQPNAGAAGEYAGLMVIRAYHLSRGDHHRN 617

Query: 682 VCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPST 741
           VCIIPVSAHGTNPA+AAMCGMKIV VGTDAKGNINIEELRKAAEA++DNL+ LMVTYPST
Sbjct: 618 VCIIPVSAHGTNPASAAMCGMKIVVVGTDAKGNINIEELRKAAEAHKDNLAALMVTYPST 677

Query: 742 HGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGG 801
           HGVYEEGIDEIC IIHDNGGQVYMDGANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGG
Sbjct: 678 HGVYEEGIDEICDIIHDNGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGG 737

Query: 802 GGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIA 861
           GGPGMGPIGVKKHLAPFLPSHPVV TGGIP PEK+QPLGTI+AAPWGSALILPISYTYIA
Sbjct: 738 GGPGMGPIGVKKHLAPFLPSHPVVPTGGIPRPEKTQPLGTISAAPWGSALILPISYTYIA 797

Query: 862 MMGSKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPE 921
           MMGS+GLT+ASKIAILNANYMAKRLE HYP+LFRG NGT AHEFI+DLR  KNTAGIEPE
Sbjct: 798 MMGSEGLTDASKIAILNANYMAKRLEGHYPVLFRGKNGTCAHEFIIDLRPFKNTAGIEPE 857

Query: 922 DVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESK 955
           DVAKRLMDYGFH PTMSWPVPGTLMIEPTESESK
Sbjct: 858 DVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESK 891

Length = 993
>gnl|CDD|235432 PRK05367, PRK05367, glycine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|129553 TIGR00461, gcvP, glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|171585 PRK12566, PRK12566, glycine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|216983 pfam02347, GDC-P, Glycine cleavage system P-protein Back     alignment and domain information
>gnl|CDD|223935 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223480 COG0403, GcvP, Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235292 PRK04366, PRK04366, glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|99737 cd00613, GDC-P, Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>gnl|CDD|99737 cd00613, GDC-P, Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>gnl|CDD|234769 PRK00451, PRK00451, glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|216983 pfam02347, GDC-P, Glycine cleavage system P-protein Back     alignment and domain information
>gnl|CDD|234769 PRK00451, PRK00451, glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223480 COG0403, GcvP, Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|197612 smart00263, LYZ1, Alpha-lactalbumin / lysozyme C Back     alignment and domain information
>gnl|CDD|223935 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 985
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 100.0
PRK12566954 glycine dehydrogenase; Provisional 100.0
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 100.0
PLN02414993 glycine dehydrogenase (decarboxylating) 100.0
PRK05367954 glycine dehydrogenase; Provisional 100.0
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 100.0
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 100.0
PRK00451447 glycine dehydrogenase subunit 1; Validated 100.0
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 100.0
PRK04366481 glycine dehydrogenase subunit 2; Validated 100.0
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
PRK12566954 glycine dehydrogenase; Provisional 100.0
PRK04366481 glycine dehydrogenase subunit 2; Validated 100.0
PRK05367954 glycine dehydrogenase; Provisional 100.0
PLN02414993 glycine dehydrogenase (decarboxylating) 100.0
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 100.0
PRK00451447 glycine dehydrogenase subunit 1; Validated 100.0
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 100.0
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 100.0
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.98
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.97
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.96
PRK13520371 L-tyrosine decarboxylase; Provisional 99.95
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.95
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.95
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.95
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.95
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.94
PLN03032374 serine decarboxylase; Provisional 99.94
PRK02769380 histidine decarboxylase; Provisional 99.94
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.94
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.94
TIGR01814406 kynureninase kynureninase. This model describes ky 99.93
PLN02651364 cysteine desulfurase 99.93
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.93
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.93
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.93
PLN02263470 serine decarboxylase 99.93
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.93
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.93
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.93
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.93
PLN02590539 probable tyrosine decarboxylase 99.92
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.92
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 99.92
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.92
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.92
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.92
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.92
PLN02651364 cysteine desulfurase 99.92
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.92
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.92
PRK13520371 L-tyrosine decarboxylase; Provisional 99.91
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.91
PLN02880490 tyrosine decarboxylase 99.91
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.91
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.91
PRK02948381 cysteine desulfurase; Provisional 99.91
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.91
PRK13580493 serine hydroxymethyltransferase; Provisional 99.9
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.9
PLN02724805 Molybdenum cofactor sulfurase 99.9
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.9
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.9
TIGR01814406 kynureninase kynureninase. This model describes ky 99.9
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.89
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.89
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.89
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.89
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.89
PRK02948381 cysteine desulfurase; Provisional 99.89
PLN02409401 serine--glyoxylate aminotransaminase 99.89
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.88
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.88
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.88
PLN02409401 serine--glyoxylate aminotransaminase 99.88
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.88
PRK03080378 phosphoserine aminotransferase; Provisional 99.88
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.88
PRK14012404 cysteine desulfurase; Provisional 99.88
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.88
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.88
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.87
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.87
PLN02271586 serine hydroxymethyltransferase 99.86
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.86
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.86
PRK02769380 histidine decarboxylase; Provisional 99.86
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.85
PRK14012404 cysteine desulfurase; Provisional 99.85
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.85
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.85
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.84
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.83
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.83
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.83
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.83
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.83
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.83
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.83
PLN02724 805 Molybdenum cofactor sulfurase 99.83
PRK07179407 hypothetical protein; Provisional 99.83
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.83
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.83
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.82
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.82
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.82
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.82
PLN03032374 serine decarboxylase; Provisional 99.82
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.82
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.82
PRK03080378 phosphoserine aminotransferase; Provisional 99.82
PLN02955476 8-amino-7-oxononanoate synthase 99.82
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.81
PLN03226475 serine hydroxymethyltransferase; Provisional 99.81
PLN02955476 8-amino-7-oxononanoate synthase 99.81
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.81
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.81
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.81
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.81
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.8
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.8
PRK13392410 5-aminolevulinate synthase; Provisional 99.8
PRK13393406 5-aminolevulinate synthase; Provisional 99.8
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.8
PRK09064407 5-aminolevulinate synthase; Validated 99.8
PLN02483489 serine palmitoyltransferase 99.8
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.8
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.8
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.8
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.8
PRK15029 755 arginine decarboxylase; Provisional 99.79
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.79
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.79
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.79
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.79
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.79
PLN02721353 threonine aldolase 99.79
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.78
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.78
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.78
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.78
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.78
PRK08114395 cystathionine beta-lyase; Provisional 99.78
PRK07179407 hypothetical protein; Provisional 99.78
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.78
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.77
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.77
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.77
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.77
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.77
PRK06108382 aspartate aminotransferase; Provisional 99.77
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.77
PLN02483489 serine palmitoyltransferase 99.77
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.76
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.76
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.76
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.76
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.76
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.76
PRK13392410 5-aminolevulinate synthase; Provisional 99.76
PLN02822481 serine palmitoyltransferase 99.76
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.75
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.75
PRK06225380 aspartate aminotransferase; Provisional 99.75
PRK13393406 5-aminolevulinate synthase; Provisional 99.75
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.75
PRK13578 720 ornithine decarboxylase; Provisional 99.75
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.75
PRK09064407 5-aminolevulinate synthase; Validated 99.75
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.75
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.74
PRK15029755 arginine decarboxylase; Provisional 99.74
PRK05957389 aspartate aminotransferase; Provisional 99.74
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.74
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.74
PRK05764393 aspartate aminotransferase; Provisional 99.74
PLN02624474 ornithine-delta-aminotransferase 99.74
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.74
PRK09028394 cystathionine beta-lyase; Provisional 99.73
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.73
PRK07678451 aminotransferase; Validated 99.73
PRK08064390 cystathionine beta-lyase; Provisional 99.73
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.73
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.73
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.73
PRK15400 714 lysine decarboxylase CadA; Provisional 99.73
PRK07324373 transaminase; Validated 99.73
PRK06767386 methionine gamma-lyase; Provisional 99.73
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.72
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.72
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.72
PRK05968389 hypothetical protein; Provisional 99.72
PRK07682378 hypothetical protein; Validated 99.72
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.72
PRK09082386 methionine aminotransferase; Validated 99.72
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.72
PLN00175413 aminotransferase family protein; Provisional 99.72
PRK07681399 aspartate aminotransferase; Provisional 99.72
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.72
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.72
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.72
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.72
PRK09105370 putative aminotransferase; Provisional 99.72
PLN02822481 serine palmitoyltransferase 99.72
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.71
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.71
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.71
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.71
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.7
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.7
PRK07482461 hypothetical protein; Provisional 99.7
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.7
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.7
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.7
PLN02263470 serine decarboxylase 99.7
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.7
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.7
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.7
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.7
PRK08361391 aspartate aminotransferase; Provisional 99.7
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.7
PRK13578720 ornithine decarboxylase; Provisional 99.7
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.7
PRK07309391 aromatic amino acid aminotransferase; Validated 99.7
PRK06207405 aspartate aminotransferase; Provisional 99.7
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.7
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.7
PRK07582366 cystathionine gamma-lyase; Validated 99.7
PRK05965459 hypothetical protein; Provisional 99.7
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.69
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.69
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.69
PRK08064390 cystathionine beta-lyase; Provisional 99.69
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.69
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.69
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.69
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.69
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.69
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.69
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.69
PLN02880490 tyrosine decarboxylase 99.69
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.69
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.69
PRK06290410 aspartate aminotransferase; Provisional 99.69
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.69
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.69
PRK06541460 hypothetical protein; Provisional 99.69
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.68
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.68
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.68
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.68
PRK05967395 cystathionine beta-lyase; Provisional 99.68
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.68
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.68
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.68
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.68
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.68
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.68
PRK05942394 aspartate aminotransferase; Provisional 99.68
PRK12414384 putative aminotransferase; Provisional 99.68
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.68
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.68
PRK04311464 selenocysteine synthase; Provisional 99.68
PLN02590539 probable tyrosine decarboxylase 99.68
PRK06234400 methionine gamma-lyase; Provisional 99.68
PRK06105460 aminotransferase; Provisional 99.68
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.68
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.68
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.68
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.68
PRK03321352 putative aminotransferase; Provisional 99.68
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.67
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.67
PRK08912387 hypothetical protein; Provisional 99.67
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.67
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.67
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.67
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.67
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.67
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.67
PRK06062451 hypothetical protein; Provisional 99.67
PRK07777387 aminotransferase; Validated 99.67
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.67
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.67
PRK08114395 cystathionine beta-lyase; Provisional 99.67
PRK13580493 serine hydroxymethyltransferase; Provisional 99.67
PRK05968389 hypothetical protein; Provisional 99.67
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.67
PLN02509464 cystathionine beta-lyase 99.67
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.67
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.67
PRK08960387 hypothetical protein; Provisional 99.66
PRK07337388 aminotransferase; Validated 99.66
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.66
PRK07050394 cystathionine beta-lyase; Provisional 99.66
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.66
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.66
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.66
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.66
PRK08861388 cystathionine gamma-synthase; Provisional 99.66
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.66
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.66
PRK07550386 hypothetical protein; Provisional 99.66
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.66
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.66
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.66
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.66
PRK10534333 L-threonine aldolase; Provisional 99.66
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.66
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.65
PRK08068389 transaminase; Reviewed 99.65
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.65
PLN02242418 methionine gamma-lyase 99.65
PRK07483443 hypothetical protein; Provisional 99.65
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.65
PRK06767386 methionine gamma-lyase; Provisional 99.65
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.65
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.65
PRK08249398 cystathionine gamma-synthase; Provisional 99.65
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.65
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.65
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.65
PRK07505402 hypothetical protein; Provisional 99.65
PRK12403460 putative aminotransferase; Provisional 99.65
PRK08861388 cystathionine gamma-synthase; Provisional 99.65
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.65
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.65
PRK07811388 cystathionine gamma-synthase; Provisional 99.65
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.65
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.65
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.64
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.64
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.64
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.64
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.64
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.64
PRK08574385 cystathionine gamma-synthase; Provisional 99.64
PRK09028394 cystathionine beta-lyase; Provisional 99.64
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.64
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.64
PLN02187462 rooty/superroot1 99.64
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.64
PRK07503403 methionine gamma-lyase; Provisional 99.64
PLN02656409 tyrosine transaminase 99.64
PRK06917447 hypothetical protein; Provisional 99.64
PRK09792421 4-aminobutyrate transaminase; Provisional 99.64
PRK07269364 cystathionine gamma-synthase; Reviewed 99.64
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.64
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.64
PRK15399713 lysine decarboxylase LdcC; Provisional 99.64
PRK07671377 cystathionine beta-lyase; Provisional 99.63
PLN00144382 acetylornithine transaminase 99.63
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.63
PLN02242418 methionine gamma-lyase 99.63
PRK07481449 hypothetical protein; Provisional 99.63
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.63
PRK06348384 aspartate aminotransferase; Provisional 99.63
PRK07582366 cystathionine gamma-lyase; Validated 99.63
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.63
PRK07480456 putative aminotransferase; Validated 99.63
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.63
PRK09148405 aminotransferase; Validated 99.63
PRK08247366 cystathionine gamma-synthase; Reviewed 99.63
PRK06234400 methionine gamma-lyase; Provisional 99.63
PTZ00433412 tyrosine aminotransferase; Provisional 99.63
PRK07568397 aspartate aminotransferase; Provisional 99.63
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.62
PRK15400714 lysine decarboxylase CadA; Provisional 99.62
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.62
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.62
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.62
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.62
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.62
PRK07908349 hypothetical protein; Provisional 99.62
PRK06107402 aspartate aminotransferase; Provisional 99.62
PRK07683387 aminotransferase A; Validated 99.62
PRK07046453 aminotransferase; Validated 99.62
PRK07036466 hypothetical protein; Provisional 99.62
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.62
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.62
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.62
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.62
PRK08776405 cystathionine gamma-synthase; Provisional 99.61
PRK08574385 cystathionine gamma-synthase; Provisional 99.61
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.61
PRK08045386 cystathionine gamma-synthase; Provisional 99.61
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.61
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.61
PRK06460376 hypothetical protein; Provisional 99.61
PRK08363398 alanine aminotransferase; Validated 99.61
PRK07503403 methionine gamma-lyase; Provisional 99.61
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.61
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.61
PRK08249398 cystathionine gamma-synthase; Provisional 99.61
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.61
PRK08776405 cystathionine gamma-synthase; Provisional 99.6
PRK07050394 cystathionine beta-lyase; Provisional 99.6
PRK04311464 selenocysteine synthase; Provisional 99.6
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.6
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.6
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.6
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.6
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.6
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.6
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.6
PRK02627396 acetylornithine aminotransferase; Provisional 99.6
PRK05939397 hypothetical protein; Provisional 99.6
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.59
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.59
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.59
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.59
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 99.59
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.59
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.59
PRK07811388 cystathionine gamma-synthase; Provisional 99.59
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.59
PLN02721353 threonine aldolase 99.59
PRK05939397 hypothetical protein; Provisional 99.59
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.59
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.58
PRK06434384 cystathionine gamma-lyase; Validated 99.58
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.58
PLN03226475 serine hydroxymethyltransferase; Provisional 99.58
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.58
PRK09265404 aminotransferase AlaT; Validated 99.57
PLN02509464 cystathionine beta-lyase 99.57
PRK06836394 aspartate aminotransferase; Provisional 99.57
PRK08636403 aspartate aminotransferase; Provisional 99.57
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 99.57
PRK061481013 hypothetical protein; Provisional 99.57
COG1982557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.57
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.57
PRK06460376 hypothetical protein; Provisional 99.57
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.56
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.56
PRK08175395 aminotransferase; Validated 99.56
PRK05967395 cystathionine beta-lyase; Provisional 99.56
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.56
PRK04260375 acetylornithine aminotransferase; Provisional 99.56
PRK08045386 cystathionine gamma-synthase; Provisional 99.56
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.56
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.56
PRK08297443 L-lysine aminotransferase; Provisional 99.56
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.56
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.55
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.55
PRK06149972 hypothetical protein; Provisional 99.55
PTZ00377481 alanine aminotransferase; Provisional 99.55
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.55
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.54
PLN02271586 serine hydroxymethyltransferase 99.54
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.54
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.54
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.54
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.54
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.54
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.54
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.54
PRK05839374 hypothetical protein; Provisional 99.53
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.53
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.53
PTZ00376404 aspartate aminotransferase; Provisional 99.53
PRK07671377 cystathionine beta-lyase; Provisional 99.52
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.52
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.52
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.52
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.52
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.51
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.51
PRK07269364 cystathionine gamma-synthase; Reviewed 99.51
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.51
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.51
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.5
PRK09275527 aspartate aminotransferase; Provisional 99.5
PRK06225380 aspartate aminotransferase; Provisional 99.5
KOG0629510 consensus Glutamate decarboxylase and related prot 99.5
PRK08247366 cystathionine gamma-synthase; Reviewed 99.49
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.49
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.49
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.49
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.49
PLN02452365 phosphoserine transaminase 99.49
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.48
PRK05957389 aspartate aminotransferase; Provisional 99.48
PRK06855433 aminotransferase; Validated 99.48
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.48
PRK09105370 putative aminotransferase; Provisional 99.48
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.48
PRK07049427 methionine gamma-lyase; Validated 99.48
PRK06108382 aspartate aminotransferase; Provisional 99.48
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.47
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.47
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.46
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.46
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.46
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-175  Score=1437.48  Aligned_cols=884  Identities=69%  Similarity=1.114  Sum_probs=833.4

Q ss_pred             cccccccccCCCCccccccCCCCCHHHHHHHHHHhCCCCHHHhhhhcCCCcc-ccCCCCCCCCCCCCCHHHHHHHHHHHH
Q 001990           83 QTRGISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSI-RIDSMKFSKFDEGLTESQMIEHMQKLA  161 (985)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ml~~~g~~~~~~l~~~~ip~~~-~~~~~~lp~~~~~~se~e~~~~~~~~~  161 (985)
                      .++++...++++.|+|..|||+|++.|+++||+++|++++|+|++++||++| +++++.+|   ++++|.|+++|++++|
T Consensus        37 ~~~~~~~~~~~~~d~F~~RHigp~~~dq~~ml~tlG~~dl~~l~~~~VP~~Ir~~~~l~~~---~~~~E~eml~~l~~ia  113 (1001)
T KOG2040|consen   37 ATRSQSERIFPPLDTFPRRHIGPSPTDQQQMLDTLGYKDLDELIEKTVPKSIRLKRPLKMD---KPLCESEMLQHLEDIA  113 (1001)
T ss_pred             hhcchhhhccCcccccccccCCCCchHHHHHHHhcChhhHHHHHHhhcchhhcccchhcCC---CCcCHHHHHHHHHHHH
Confidence            4456667788999999999999999999999999999999999999999999 88999997   8999999999999999


Q ss_pred             cCCCccceecCCCCCCCCCcHHHHHHHHhCCccccccCCChhhHhhHHHHHHHHHHHHHHHhhCCCCcceeeccchHHHH
Q 001990          162 SMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAA  241 (985)
Q Consensus       162 ~~n~~~~~~lG~g~~~~~~p~~v~~~i~~~~~~~t~~~py~~e~sqg~l~~i~e~q~~ia~L~g~~~~~~sl~~~~ta~~  241 (985)
                      +||+.|.+|+|.|||++.+|++|.|+++++|+|||.|||||||||||+||.+.+||+++++|||++.+|+|+.|.|||++
T Consensus       114 ~kNk~~ksfIGmGYyn~~vP~~I~RNilenp~W~TqYTPYQ~EIsQGRLEsllNyQTmi~dlTGL~~aNASLLDEgTAaa  193 (1001)
T KOG2040|consen  114 SKNKIWKSFIGMGYYNTHVPAVILRNILENPGWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMANASLLDEGTAAA  193 (1001)
T ss_pred             hhhhHHHHhhccccccccCcHHHHHHhhhCCcceeccCCCchhhhhhhHHHHhhhHHhhhhccCCcccchhhhccchhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhcCCCCEEEEcCCCChhHHHHHHHhhcCCCeEEEEeCchhhhccCCCEeEEEEEcCCCCeeeccHHHHHHH
Q 001990          242 EAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKSGDVCGVLVQYPGTEGEVLDYGDFIKN  321 (985)
Q Consensus       242 ea~~~a~~~~~~~g~~Vlv~~~~h~s~~~~~~~~a~~~gi~v~~~~~~~l~~l~~~t~~V~v~~pn~~G~i~dl~~I~~~  321 (985)
                      |||.|+.+.+  ++++++|+..+||+++++++++++++|++++..++++.....+++++|++|+|++.|.|.|..++++.
T Consensus       194 EAm~l~~~~~--krkk~vvd~~~hpqtlsV~~TRa~~~~i~v~~~~~~~~~~s~~~v~gvlvQYP~t~G~i~d~~el~~~  271 (1001)
T KOG2040|consen  194 EAMALCNRIN--KRKKFVVDSNCHPQTLSVVKTRAKGFGIKVVVSDIKEADYSSKDVSGVLVQYPDTEGSVLDFDELVEL  271 (1001)
T ss_pred             HHHHHHHhhc--ccceEEecCCCCcchhhhhhccccccceeEEecCHHHhhccccceeEEEEEcCCCCCcccCHHHHHHH
Confidence            9999998876  77889999999999999999999999999988877654434567999999999999999999999999


Q ss_pred             HHhCCcEEEEEeccccccCCCCCCcccceEEEecCccccccCCCCCCceEEEEEchhhHhcCCCceeeeeecCCCCcceE
Q 001990          322 AHANGVKVVMATDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALR  401 (985)
Q Consensus       322 a~~~galliV~a~~~alg~l~~p~~~GaDi~v~s~k~lg~P~~~GGP~~G~l~~~~~~~~~lp~~~vG~s~d~~g~~~~~  401 (985)
                      +|+.|.++++++|++++.++++|++|||||++||+|.||+|+|+||||+|||+|++++.|.||||++|+|+|+.|+++|+
T Consensus       272 a~~~~s~vv~atDLLaLtiLrpPgefGaDIavGSsQRFGVPlGYGGPHAaFfAv~~~l~R~mPGRiiGvtkD~~gk~a~R  351 (1001)
T KOG2040|consen  272 AHANGSLVVMATDLLALTILRPPGEFGADIAVGSSQRFGVPLGYGGPHAAFFAVSESLVRMMPGRIIGVTKDALGKEAYR  351 (1001)
T ss_pred             hhccCceEEEeehhhHHHccCChhhcCceeeeccccccCccccCCCchHHHHHHHHHHHhhCCCceEeeeecccccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecccccccccccccCCCccchhHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHHHHHHHhcCCCEEEcCCCCcceEEEe
Q 001990          402 VAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGLPFFDTVKVK  481 (985)
Q Consensus       402 l~l~tre~~~rre~atsni~t~~~l~a~~aa~y~~~~g~~Gl~~i~~~~~~~a~~l~~~L~~~g~~~~~~~~~~~~~~i~  481 (985)
                      |.||||||||||+||||||||+|+|+|+++++|+.|+|++||++|++|++..+.+|..+|+..| .++.++++|+++.|.
T Consensus       352 LALQTREQHIrRDKATSNICTAQALLANmaAmyaiYHGp~gL~~IArrvh~~T~~l~~~l~~ag-hel~~k~fFDTLkI~  430 (1001)
T KOG2040|consen  352 LALQTREQHIRRDKATSNICTAQALLANMAAMYAIYHGPHGLKEIARRVHNLTLILAEGLKNAG-HELQHKPFFDTLKIR  430 (1001)
T ss_pred             HHHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhcCcHHHHHHHHHHHHHHHHHHHHHhhcc-hhhccccccceEEEE
Confidence            9999999999999999999999999999999999999999999999999999999999999988 888888999999999


Q ss_pred             cCC-HHHHHHHHHHcCceeeeecCCeEEEEeccCCCHHHHHHHHHHHhCCCCCCCCHHhhhhhh-----hccCCCCccCC
Q 001990          482 CAD-AHAIASAAYKIEMNLRVVDSNTVTASFDETTTLEDVDKLFIVFAGGKSVPFTAASLAEEV-----ETAIPSGLTRE  555 (985)
Q Consensus       482 ~~~-~~~l~~~L~~~Gi~~~~~~~~~lris~~~~~t~edid~ll~~l~~~~~~~~~~~~l~~~~-----~~~ip~~~~~~  555 (985)
                      +.. ++++.++..+++|+++.++++.+.+|+.|+.+++|+|.+++.|.+.     |..++..+.     ....|+.++|+
T Consensus       431 ~~~s~~~~l~rA~~~~iNlr~~ed~tigvslDETv~~~DvddLl~vf~~~-----ss~~~~~E~~~~e~~~~~~s~f~Rt  505 (1001)
T KOG2040|consen  431 CGCSAEEVLDRAAKRQINLRLVEDGTIGVSLDETVTEKDVDDLLWVFNEE-----SSVELVAESMGEECNGIPPSVFKRT  505 (1001)
T ss_pred             ecCcHHHHHHHHHhhcCceEEeecCceEEeecccccHHHHHHHHHHHccC-----ChHHHHHHhhhhhccCCCCcccccC
Confidence            987 8999999989999999999999999999999999999999999965     344443322     12468999999


Q ss_pred             CCCCCCccccccCCHHHHHHHHHHHhcCccCcCcccccccceecccCccccccccccccccccCCCCcchhhhcHHHHHH
Q 001990          556 SPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFN  635 (985)
Q Consensus       556 ~~~~~~pv~~~~~se~e~~~~l~~l~~~~~~~~~~~~~lGs~~~~~~~~~~~~~~~~~~f~~~~p~~p~e~~~G~~~~~~  635 (985)
                      ++||++|||+.++||++++|||++|.+||+++.++||+||||||++|+..|+.|+.|++|+|.|||+|.|+.||+.+++.
T Consensus       506 s~~L~hpVFn~yhSEt~lvRYm~kLenKDlSLvhSMiPLGSCTMKLNsttEmmPiTwp~fanIHPF~P~eQaqGY~~lf~  585 (1001)
T KOG2040|consen  506 SPYLTHPVFNSYHSETELVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTTEMMPITWPEFANIHPFAPVEQAQGYQQLFT  585 (1001)
T ss_pred             CccccchhhhhcccHHHHHHHHHHhhccchhhhhhcccccceeeeccccceeccccchhhccCCCCCchHHHhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCCccceecChHHHHHHHHHHHHHHHHHhcCCCCCCEEEEcCCCCCCcHHHHHhcCcEEEEEeCCCCCCC
Q 001990          636 NLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNI  715 (985)
Q Consensus       636 el~~~la~l~G~~~~~~~~~sGa~g~~a~l~air~~~~~~g~~~~~~Vlv~~~~Hg~~~~~~~~~G~~v~~v~~~~~g~i  715 (985)
                      +++++||+++|.|..++++|||++|++++++++|+|++++|+..|+.+++|.++||+||+++++.|++|+.|.++.+|.+
T Consensus       586 ~Le~~Lc~iTG~D~~s~QPNsGA~GEYaGL~~IRaY~~~kge~hRnvClIPvSAHGTNPASA~MagmkvvpV~~~~~G~i  665 (1001)
T KOG2040|consen  586 ELEKDLCEITGFDSFSLQPNSGAQGEYAGLRVIRAYLESKGEGHRNVCLIPVSAHGTNPASAAMAGMKVVPVGCDANGNI  665 (1001)
T ss_pred             HHHHHhheeecccceeecCCCCcccchhhHHHHHHHHHhccCCcceeEEEeecccCCChhhHHhcCCEEEEeeccCCCCc
Confidence            99999999999999999999999999999999999999999888899999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHhcCCCeEEEEEEcCCCccccccCHHHHHHHHHHcCCEEEEEccccccccCCCCCCcCCCcEEEeCCcccc
Q 001990          716 NIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGYIGADVCHLNLHKTF  795 (985)
Q Consensus       716 Dle~L~~~i~~~~~~t~~Vvi~~pn~~G~i~~di~eI~~la~~~g~lliVD~a~~~~~~g~~~~g~~g~Di~~~s~hKtl  795 (985)
                      |+.+|+++.++|+++.+++|++||+++|+++++|+++++++|+||..+++|||+.++++|+++||++|+|+++.++||||
T Consensus       666 d~~dLk~kaekh~~~Laa~MvTYPST~GvfE~~i~d~cd~iHehGGQVYlDGANMNAqVGlc~pGd~GaDV~HLNLHKTF  745 (1001)
T KOG2040|consen  666 DMVDLKAKAEKHKDNLAALMVTYPSTHGVFEEGIDDICDIIHEHGGQVYLDGANMNAQVGLCRPGDIGADVCHLNLHKTF  745 (1001)
T ss_pred             cHHHHHHHHHHhhhhhheeEEecccccccccccHHHHHHHHHhcCCEEEecCCCccceecccCCccccccceeeccccee
Confidence            99999999999999999999999999999998999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCcceeeeecccccCcCCCCccccCCCCCCCCCCCCCCCcccccchhhhHHHHHHHHHHHhchhhHHHHHHHH
Q 001990          796 CIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIA  875 (985)
Q Consensus       796 ~~p~g~GGPg~G~l~~~~~l~~~lpg~~~g~~~~~~~~~~~~~t~~i~s~~~g~~~~~~~A~a~l~~lg~~gl~~~~~~~  875 (985)
                      |+|||+||||+|.+.+++++.+++|+..+....   +.+.....+.++++|||+++++..+|+|++++|..|+++..+..
T Consensus       746 cIPHGGGGPg~gPIgVK~HLapfLP~HpVvs~~---~~~~~~~~gsVsaaP~Gsa~ILpISwaYikmMG~~GL~~as~~A  822 (1001)
T KOG2040|consen  746 CIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSPG---RPEDTSPVGSVSAAPWGSALILPISWAYIKMMGSGGLKDASKIA  822 (1001)
T ss_pred             eecCCCCCCCCCccchhhhccccCCCCCccCCC---CCCCCCCccceeccCCCcceeehhHHHHHHHhcccccchhhHHH
Confidence            999999999999999999999999987654221   01112345567888999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCCeeEcCCCCceeEEEEEEecCccccCCCCHHHHHHHHHHCCCccCCCCCCCCCEEEEeccCCCCH
Q 001990          876 ILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESK  955 (985)
Q Consensus       876 ~~~a~~l~~~L~~~~~i~~~g~~~~~~~~~vv~~~~~~~~~g~~~~~l~~~L~e~Gi~~~~~~~pv~~~lris~t~~~t~  955 (985)
                      +.|++|+.++|+..+++++.+.++.+.|+|++|+++||+..|+++.+++++|.++|+++++++||++++++|.||+..++
T Consensus       823 iLNaNYMakRLe~hYkil~~~~~~~vaHEFIlD~r~fK~~agieavDvAKRL~DYgFHaPTmswPV~gtLMIEPTESE~k  902 (1001)
T KOG2040|consen  823 ILNANYMAKRLESHYKILFRGENGLVAHEFILDLRPFKKTAGIEAVDVAKRLMDYGFHAPTMSWPVAGTLMIEPTESEDK  902 (1001)
T ss_pred             hhhhHHHHHHHhhccceeEecCCcceeeeeeeechhhccccCCcHHHHHHHHHhccCCCCccccccCCceEeccCccccH
Confidence            99999999999999999998887889999999999998878999999999999999999999999999999999999999


Q ss_pred             HhhchHHHHHHHHHHHHHHHH--HccCCCC
Q 001990          956 VCHNREDLFFQILLSLTKFTT--FAGRVGQ  983 (985)
Q Consensus       956 eeId~~~~~i~aL~~i~~~~~--~~~~~~~  983 (985)
                      +|+|   +|+++|..|.+|+.  +.|+.++
T Consensus       903 ~ElD---RfcdAliSIreEI~~ie~G~~dk  929 (1001)
T KOG2040|consen  903 AELD---RFCDALISIREEIAQIEEGRQDK  929 (1001)
T ss_pred             HHHH---HHHHHHHHHHHHHHHHHccCCCc
Confidence            9999   99999999999886  3555543

>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
1wyt_B474 Crystal Structure Of Glycine Decarboxylase (P-Prote 6e-65
1wyt_A438 Crystal Structure Of Glycine Decarboxylase (P-Prote 1e-56
>pdb|1WYT|B Chain B, Crystal Structure Of Glycine Decarboxylase (P-Protein) Of The Glycine Cleavage System, In Apo Form Length = 474 Back     alignment and structure 
Iteration: 1

 Score =  246 bits (627), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 154/420 (36%), Positives = 238/420 (56%), Gaps = 27/420 (6%)
Query: 543 EVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLN 602
           + E  IP    RE P     V      E  L+R+   L  +++ +  +  PLGSCTMK N
Sbjct: 25  KAEDLIPKEHLREVPPRLPEV-----DELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYN 79
Query: 603 ATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEY 662
                       FA++HP+     AQG   +   LGE+L  +TG D+ +L+P AGA GE 
Sbjct: 80  PKLHEEAARL--FADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGAHGEL 137
Query: 663 AGLMVIRAYHKARGD-HHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELR 721
            G+++IRAYH+ RG+   R V ++P SAHG+NPATA+M G ++  + +  +G +++E L+
Sbjct: 138 TGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDLEALK 197
Query: 722 KAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGY 781
           +    +   ++ LM+T P+T G++E  I EI ++  + G Q+Y DGAN+NA +G   PG 
Sbjct: 198 RELGPH---VAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWARPGD 254
Query: 782 IGADVCHLNLHKTFCIXXXXXXXXXXXXXVKKHLAPFLPSHPVVSTG--GIPAP-EKSQP 838
           +G DV HLNLHKTF +             VK HLAP+LP  P+V  G  G     ++ + 
Sbjct: 255 MGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPV-PLVERGEEGFYLDFDRPKS 313
Query: 839 LGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL-EKHYPILFRGV 897
           +G + +  +G+ L L  ++ YI  +G +GL +A+ +A+LNA Y+ + L EK Y + +   
Sbjct: 314 IGRVRSF-YGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPY--- 369
Query: 898 NGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWP--VPGTLMIEPTESESK 955
           +G   HEF+      +   G    D+AK L++ GFH PT+ +P  V   LM+EPTE+E+K
Sbjct: 370 DGPSMHEFVA-----QPPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMVEPTETEAK 424
>pdb|1WYT|A Chain A, Crystal Structure Of Glycine Decarboxylase (P-Protein) Of The Glycine Cleavage System, In Apo Form Length = 438 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 0.0
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 0.0
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 1e-09
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 2e-09
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 8e-04
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-09
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 2e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 6e-05
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 7e-05
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 2e-04
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Length = 474 Back     alignment and structure
 Score =  708 bits (1829), Expect = 0.0
 Identities = 162/427 (37%), Positives = 248/427 (58%), Gaps = 25/427 (5%)

Query: 535 FTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPL 594
                   + E  IP    RE P     V      E  L+R+   L  +++ +  +  PL
Sbjct: 17  LKLVKAVPKAEDLIPKEHLREVPPRLPEV-----DELTLVRHYTGLSRRQVGVDTTFYPL 71

Query: 595 GSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQP 654
           GSCTMK N   ++       FA++HP+     AQG   +   LGE+L  +TG D+ +L+P
Sbjct: 72  GSCTMKYNP--KLHEEAARLFADLHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEP 129

Query: 655 NAGAAGEYAGLMVIRAYHKARGD-HHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKG 713
            AGA GE  G+++IRAYH+ RG+   R V ++P SAHG+NPATA+M G ++  + +  +G
Sbjct: 130 AAGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEG 189

Query: 714 NINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQ 773
            +++E L++       +++ LM+T P+T G++E  I EI ++  + G Q+Y DGAN+NA 
Sbjct: 190 EVDLEALKRELG---PHVAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAI 246

Query: 774 VGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVSTGG--IP 831
           +G   PG +G DV HLNLHKTF +PHGGGGPG GP+GVK HLAP+LP   V         
Sbjct: 247 MGWARPGDMGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYL 306

Query: 832 APEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL-EKHY 890
             ++ + +G +  + +G+ L L  ++ YI  +G +GL +A+ +A+LNA Y+ + L EK Y
Sbjct: 307 DFDRPKSIGRV-RSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGY 365

Query: 891 PILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWP--VPGTLMIE 948
            + +   +G   HEF+      +   G    D+AK L++ GFH PT+ +P  V   LM+E
Sbjct: 366 RVPY---DGPSMHEFV-----AQPPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMVE 417

Query: 949 PTESESK 955
           PTE+E+K
Sbjct: 418 PTETEAK 424
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Length = 438 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Length = 438 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 100.0
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 100.0
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 100.0
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 100.0
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.97
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.96
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.96
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.95
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.94
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.94
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.94
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.94
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.94
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.93
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.93
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.93
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.93
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.93
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.92
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.91
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.91
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.91
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.91
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.9
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.9
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.9
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.9
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.9
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.9
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.89
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.89
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.89
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.89
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.89
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.89
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.89
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.89
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.89
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.89
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.89
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.89
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.89
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.89
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.89
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.89
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.89
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.88
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.88
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.88
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.88
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.88
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.88
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.88
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.88
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.88
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.87
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.87
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.86
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.86
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.86
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.86
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.86
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.85
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.85
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.85
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.85
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.85
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.85
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.85
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.85
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.85
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.85
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.85
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.85
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.85
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.85
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.85
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.85
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.85
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.84
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.84
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.84
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.84
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.84
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.84
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.83
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.83
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.83
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.83
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.83
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.83
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.83
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.83
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.83
2fnu_A375 Aminotransferase; protein-product complex, structu 99.83
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.83
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.83
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.83
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.83
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.82
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.82
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.82
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.82
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.82
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.82
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.82
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.82
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.82
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.82
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.82
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.82
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.82
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.81
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.81
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.81
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.81
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.81
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.81
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.81
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.81
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.81
3ele_A398 Amino transferase; RER070207001803, structural gen 99.81
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.81
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.81
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.81
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.81
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.81
1svv_A359 Threonine aldolase; structural genomics, structura 99.8
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.8
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.8
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.8
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.8
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.8
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.8
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.8
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.8
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.8
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.8
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.8
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.8
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.8
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.8
3hmu_A472 Aminotransferase, class III; structural genomics, 99.8
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.8
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.8
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.79
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.79
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.79
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.79
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.79
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.79
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.79
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.79
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.79
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.79
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.79
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.79
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.79
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.79
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.78
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.78
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.78
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.78
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.78
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.78
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.78
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.78
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.78
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.78
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.78
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.78
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.78
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.78
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.77
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.77
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.77
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.77
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.77
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.77
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.77
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.77
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.77
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.77
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.77
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.77
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.77
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.77
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.77
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.76
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.76
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.76
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.76
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.76
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.76
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.76
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.76
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.76
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.76
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.76
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.76
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.76
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.76
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.76
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.76
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.76
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.76
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.76
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.76
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.75
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.75
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.75
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.75
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.75
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.75
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.75
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.75
3rq1_A418 Aminotransferase class I and II; structural genomi 99.75
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.75
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.75
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.75
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.74
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.74
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.74
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.74
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.74
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.74
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.74
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.74
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.74
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.74
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.74
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.74
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.74
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.74
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.74
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.73
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.73
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.73
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.73
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.73
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.72
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.72
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.72
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.72
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.72
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.72
2fnu_A375 Aminotransferase; protein-product complex, structu 99.72
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.72
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.72
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.71
1svv_A359 Threonine aldolase; structural genomics, structura 99.71
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.71
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.71
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.71
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.71
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.71
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.71
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.71
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.71
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.71
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.71
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.71
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.71
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.71
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.71
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.71
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.7
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.7
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.7
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.7
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.7
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.7
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.69
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.69
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.69
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.69
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.69
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.69
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.69
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.69
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.69
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.69
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.69
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.69
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.69
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.69
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.68
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.68
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.68
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.68
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.68
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.68
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.68
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.68
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.68
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.68
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.67
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.67
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.67
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.67
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.67
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.67
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.67
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.67
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.67
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.66
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.66
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.66
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.66
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.66
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.66
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.66
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.66
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.66
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.66
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.66
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.66
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.66
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.65
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.65
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.65
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.65
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.65
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.65
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.65
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.65
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.65
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.64
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.64
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.64
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.64
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.64
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.64
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.63
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.63
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.63
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.63
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.63
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.63
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.63
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.63
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.63
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.63
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.63
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.63
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.63
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.62
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.62
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.62
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.62
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.62
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.62
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.62
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.62
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.62
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.62
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.62
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.61
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.61
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.61
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.61
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.61
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.61
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.61
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.61
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.6
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.6
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.6
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.6
3ele_A398 Amino transferase; RER070207001803, structural gen 99.6
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.6
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.6
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.59
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.59
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.59
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.59
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.37
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.59
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.58
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.36
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.58
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.58
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.57
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.57
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.56
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.56
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.55
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.55
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.55
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.54
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.54
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.53
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.53
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.53
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.52
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.51
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.51
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.51
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.5
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.5
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.49
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.48
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.48
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.47
3rq1_A418 Aminotransferase class I and II; structural genomi 99.47
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.46
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.46
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.45
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.44
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.43
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.43
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.41
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.41
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.4
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.4
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.39
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.39
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.39
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.37
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.35
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.35
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.34
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.34
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.32
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.31
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.31
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.31
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.3
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.28
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.28
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.28
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.27
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.27
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.27
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.27
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.26
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.26
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.25
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.25
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.25
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.24
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.24
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.23
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.22
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.22
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.22
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.22
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.2
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.2
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 98.83
3hmu_A472 Aminotransferase, class III; structural genomics, 99.19
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.19
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.18
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.17
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.16
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.15
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.13
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.12
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.09
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.08
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.03
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 98.99
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 98.98
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 98.98
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 98.92
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 98.27
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 98.62
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 98.49
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 98.41
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 98.33
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.06
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-60  Score=558.41  Aligned_cols=421  Identities=34%  Similarity=0.519  Sum_probs=382.2

Q ss_pred             ccCCCCCHHHHHHHHHHhCCCCHHHhhhhcCCCcc-ccCCCCCCCCCCCCCHHHHHHHHHHHHcCCCc-cceecCCCCCC
Q 001990          100 RRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSI-RIDSMKFSKFDEGLTESQMIEHMQKLASMNKV-YKSFIGMGYYN  177 (985)
Q Consensus       100 ~~~~~~~~~~~~~ml~~~g~~~~~~l~~~~ip~~~-~~~~~~lp~~~~~~se~e~~~~~~~~~~~n~~-~~~~lG~g~~~  177 (985)
                      ++|||||++|+++||++||++|+||||++ ||+++ ++ +++||   +++||.+++++++.++++|.. +.+|+|.|+|+
T Consensus         1 ~~~~~~~~~~~~~ml~~~g~~~~~~~~~~-~p~~~~~~-~~~lp---~~~~~~~~~~~~~~l~~~~~~~~~~~~~~g~~~   75 (438)
T 1wyu_A            1 MDYTPHTEEEIREMLRRVGAASLEDLFAH-LPKEILSP-PIDLP---EPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRS   75 (438)
T ss_dssp             CCCCCCCHHHHHHHHHHHTCSSTGGGGTT-SCGGGSSC-CCCCC---CCCCHHHHHHHHHHHHHTSCCCTTCCCCSSCCC
T ss_pred             CCCCCcCHHHHHHHHHHcCCCCHHHHHHh-CcHHHhcC-CCCCC---CCCCHHHHHHHHHHHHhcCcCccccccCCCccC
Confidence            48999999999999999999999999998 99999 77 88997   789999999999999999987 88999999999


Q ss_pred             CCCcHHHHHHHHhCCccccccCCChhhHhhHHHHHHHHHHHHHHHhhCCCCcceeeccchHHHHHHHHHHhhhhcCCCCE
Q 001990          178 THVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKT  257 (985)
Q Consensus       178 ~~~p~~v~~~i~~~~~~~t~~~py~~e~sqg~l~~i~e~q~~ia~L~g~~~~~~sl~~~~ta~~ea~~~a~~~~~~~g~~  257 (985)
                      +..|+.+ ++++++++|++.|+||||+++||.++.+.++++++|+++|++++++++++|+|+++|++++++++.  +||+
T Consensus        76 ~~~p~~v-~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~la~~~g~~~~~i~~~~g~taa~ea~~~a~~~~--~gd~  152 (438)
T 1wyu_A           76 HHVPPVV-QALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLEIANASMYDGATALAEGVLLALRET--GRMG  152 (438)
T ss_dssp             CCCCHHH-HHHHTSHHHHHCCSCCSGGGCHHHHHHHHHHHHHHHHHHTSSEECSCBSSHHHHHHHHHHHHHHHH--TCCE
T ss_pred             CcCcHHH-HHHHhcchhhhcCCCCcchhhhhHHHHHHHHHHHHHHHhCCCccceEEeCcHHHHHHHHHHHHhcC--CCCE
Confidence            9999999 478888899999999999999999999999999999999999888899999999999998887665  7899


Q ss_pred             EEEcCCCChhHHHHHHHhhcCCCeEEEEeCchh----hhccCCCEeEEEEEcCCCCeeeccHHHHHHHHHhCCcEEEEEe
Q 001990          258 FIIASNCHPQTIDICITRADGFDIKVVVSDLKD----IDYKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMAT  333 (985)
Q Consensus       258 Vlv~~~~h~s~~~~~~~~a~~~gi~v~~~~~~~----l~~l~~~t~~V~v~~pn~~G~i~dl~~I~~~a~~~galliV~a  333 (985)
                      ||+++..|+++..+|+.+++..|++++.++.++    +++++++|++|++++||++|.+.|+++|+++||++|++++|++
T Consensus       153 Viv~~~~h~s~~~~~~~~a~~~G~~v~~v~~~~~~~d~~~i~~~t~~v~i~~pn~tG~~~~l~~i~~la~~~g~~vivd~  232 (438)
T 1wyu_A          153 VLVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEGGRTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAHGAGALFVAVA  232 (438)
T ss_dssp             EEEETTSCHHHHHHHHHHHHHTTCEEEEECCBTTBCCCCCCCTTEEEEEEESSCTTSBCCCHHHHHHHHHHTTCEEEEEC
T ss_pred             EEEcCccCHhHHHHHHHHHHHCCCEEEEEcCcCCccCHHHhCCCeEEEEEECCCCCeEEecHHHHHHHHHHcCCEEEEEe
Confidence            999999999999999888888899999998633    2225678999999999999999999999999999999999877


Q ss_pred             ccccccCCCCCCcccceEEEecCccccccCCCCCCceEEEEEchhhHhcCCCceeeeeecCCCCcceEEecccccccccc
Q 001990          334 DLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRR  413 (985)
Q Consensus       334 ~~~alg~l~~p~~~GaDi~v~s~k~lg~P~~~GGP~~G~l~~~~~~~~~lp~~~vG~s~d~~g~~~~~l~l~tre~~~rr  413 (985)
                      |..++|.+..++++|+|++++++|+|+.|+++|||++|++++++++++++|++++|++.+.+|.+.|.+++|+|++++||
T Consensus       233 d~~a~g~~~~~~~~g~D~~~~s~kk~~~~~~~~Gp~~G~l~~~~~~~~~l~~~~~g~~~~~~~~~~~~~~l~~~~~~~r~  312 (438)
T 1wyu_A          233 DPLSLGVLKPPGAYGADIAVGDGQSLGLPMGFGGPHFGFLATKKAFVRQLPGRLVSETVDVEGRRGFILTLQAREQYIRR  312 (438)
T ss_dssp             CTTGGGTBCCHHHHTCSEEEEECTTTTCCCGGGCSCCEEEEECGGGGGGCCSCCEEEEEBTTSCEEEEECCGGGSHHHHG
T ss_pred             chhhccCcCCCccCCCCEEEECCcccCCCccCCCCCeeEEEEcHHHHHhCCCceeccccccCCCcceeeeccccccccch
Confidence            76778877777889999999999999999999999999999999999999999999988877878899999999999999


Q ss_pred             cccCCCccchhHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHHHHHHHhcCCCEEEcCC-CCcceEEEecCC-HHHHHHH
Q 001990          414 DKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQGL-PFFDTVKVKCAD-AHAIASA  491 (985)
Q Consensus       414 e~atsni~t~~~l~a~~aa~y~~~~g~~Gl~~i~~~~~~~a~~l~~~L~~~g~~~~~~~-~~~~~~~i~~~~-~~~l~~~  491 (985)
                      +++|+|+|+++.+.++.+++|+.+++++|++++.++..+++++++++|+++.|+++..+ +++..+.+..+. ..++.++
T Consensus       313 ~~~t~~~~~~~~~~a~~aa~~l~~~~~~g~~~~~~~~~~~~~~l~~~L~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  392 (438)
T 1wyu_A          313 AKAKSNITTNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFALALPKDPEAVRRA  392 (438)
T ss_dssp             GGSSCCCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCEECSCSSBCSEEEEECSSCHHHHHHH
T ss_pred             hcccCCccchHHHHHHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHHHHhcCCCeEECCCCCeEEEEEEeCCCCHHHHHHH
Confidence            99999999999999998888889999999999999999999999999999833998854 567777777654 8899999


Q ss_pred             HHHcCcee--eee---cCCeEEEEeccCCCHHHHHHHHHHHh
Q 001990          492 AYKIEMNL--RVV---DSNTVTASFDETTTLEDVDKLFIVFA  528 (985)
Q Consensus       492 L~~~Gi~~--~~~---~~~~lris~~~~~t~edid~ll~~l~  528 (985)
                      |.++||.+  +..   .++.+|+|+++++|++|+++++++|+
T Consensus       393 L~~~gi~v~~~~~~~~~~~~lRis~~~~~t~edi~~~~~~l~  434 (438)
T 1wyu_A          393 LAERGFHGATPVPREYGENLALFAATELHEEEDLLALREALK  434 (438)
T ss_dssp             HHHTTCCCCEECCTTSCSSEEEEECCTTCCHHHHHHHHHHHH
T ss_pred             HHHCCceeccccccccCCCeEEEEecccCCHHHHHHHHHHHH
Confidence            99999988  322   26899999999999999999999986
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 985
d1wyub1471 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 1e-106
d1wyub1471 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 3e-47
d1wyua1437 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarbox 4e-85
d1wyua1437 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarbox 2e-78
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 3e-42
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 6e-15
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-40
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-22
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 3e-35
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 3e-29
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 5e-28
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 6e-16
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 0.001
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 0.002
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Length = 471 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Glycine dehydrogenase subunits (GDC-P)
domain: Glycine dehydrogenase subunit 2 (P-protein)
species: Thermus thermophilus [TaxId: 274]

 Score =  336 bits (861), Expect = e-106
 Identities = 148/433 (34%), Positives = 218/433 (50%), Gaps = 25/433 (5%)

Query: 531 KSVP----FTAASLAEEVETAIPSGLTRESPYLTHPVFNKYHTEHELLRYIHLLQSKELS 586
           +S              + E  IP    RE P     V      E  L+R+   L  +++ 
Sbjct: 8   RSRKGRRGLKLVKAVPKAEDLIPKEHLREVPPRLPEV-----DELTLVRHYTGLSRRQVG 62

Query: 587 LCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITG 646
           +  +  PLGSCTMK N            FA++HP+     AQG   +   LGE+L  +TG
Sbjct: 63  VDTTFYPLGSCTMKYNPKLHEEAARL--FADLHPYQDPRTAQGALRLMWELGEYLKALTG 120

Query: 647 FDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVS 706
            D+ +L+P AGA GE  G+++IRAYH+ RG+      ++   +   +    A      V 
Sbjct: 121 MDAITLEPAAGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAGYQVR 180

Query: 707 VGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMD 766
                       E  K           LM+T P+T G++E  I EI ++  + G Q+Y D
Sbjct: 181 EIPSGPEGEVDLEALKRELGPHVA--ALMLTNPNTLGLFERRILEISRLCKEAGVQLYYD 238

Query: 767 GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS 826
           GAN+NA +G   PG +G DV HLNLHKTF +PHGGGGPG GP+GVK HLAP+LP   V  
Sbjct: 239 GANLNAIMGWARPGDMGFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVER 298

Query: 827 TGGIPAPEKSQPLGTIAAAPW-GSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKR 885
                  +  +P        + G+ L L  ++ YI  +G +GL +A+ +A+LNA Y+ + 
Sbjct: 299 GEEGFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKEL 358

Query: 886 LEKH-YPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWP--VP 942
           L++  Y + +   +G   HEF+      +   G    D+AK L++ GFH PT+ +P  V 
Sbjct: 359 LKEKGYRVPY---DGPSMHEFV-----AQPPEGFRALDLAKGLLELGFHPPTVYFPLIVK 410

Query: 943 GTLMIEPTESESK 955
             LM+EPTE+E+K
Sbjct: 411 EALMVEPTETEAK 423
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Length = 471 Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Length = 437 Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Length = 437 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 100.0
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 100.0
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 100.0
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 100.0
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.97
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.96
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.96
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.96
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.96
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.94
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.94
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.94
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.94
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.92
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.92
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.9
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.89
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.89
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.89
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.88
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.87
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.87
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.87
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.86
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.86
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.86
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.85
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.84
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.84
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.84
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.83
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.83
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.83
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.83
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.82
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.82
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.82
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.82
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.82
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.8
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.79
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.79
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.78
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.78
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.78
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.77
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.77
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.76
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.76
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.75
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.75
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.75
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.74
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.73
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.73
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.71
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.71
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.7
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.7
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.69
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.68
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.68
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.68
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.67
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.67
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.67
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.67
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.66
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.66
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.66
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.65
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.65
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.65
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.65
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.64
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.64
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.64
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.64
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.63
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.62
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.61
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.61
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.6
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.6
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.6
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.59
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.59
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.57
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.57
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.57
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.56
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.56
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.55
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.55
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.54
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.54
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.54
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.53
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.51
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.51
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.5
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.48
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.47
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.47
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.46
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.45
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.44
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.44
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.44
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.43
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.43
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.42
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.42
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.42
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.42
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.42
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.41
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.39
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.38
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.38
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.37
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.37
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.37
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.35
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.35
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.34
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.32
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.31
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.3
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.29
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.29
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.28
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.28
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.23
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.22
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.22
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.21
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.2
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.19
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.18
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.18
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.18
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.17
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.15
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.15
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.14
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.14
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.13
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.13
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.11
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.07
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.96
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 98.94
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 98.93
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 98.89
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.85
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.8
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 98.71
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.68
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 98.59
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 98.5
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 98.49
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.45
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.44
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.42
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.27
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 98.27
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 98.19
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 98.19
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 98.1
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 98.02
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Glycine dehydrogenase subunits (GDC-P)
domain: Glycine dehydrogenase (decarboxylating) subunit 1
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.7e-87  Score=766.13  Aligned_cols=423  Identities=33%  Similarity=0.506  Sum_probs=399.8

Q ss_pred             ccCCCCCHHHHHHHHHHhCCCCHHHhhhhcCCCccccCCCCCCCCCCCCCHHHHHHHHHHHHcCCCc-cceecCCCCCCC
Q 001990          100 RRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKV-YKSFIGMGYYNT  178 (985)
Q Consensus       100 ~~~~~~~~~~~~~ml~~~g~~~~~~l~~~~ip~~~~~~~~~lp~~~~~~se~e~~~~~~~~~~~n~~-~~~~lG~g~~~~  178 (985)
                      +||||+|++|+++||++||++|+||||++ ||+++++++++||   +++||.|++||+++|+++|.. ..+|+|+|+|.|
T Consensus         1 m~y~p~s~~d~~~mL~~iG~~s~~dl~~~-IP~~~~~~~~~lp---~~~sE~e~~r~~~~ls~kN~~~~~~fig~G~~~~   76 (437)
T d1wyua1           1 MDYTPHTEEEIREMLRRVGAASLEDLFAH-LPKEILSPPIDLP---EPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSH   76 (437)
T ss_dssp             CCCCCCCHHHHHHHHHHHTCSSTGGGGTT-SCGGGSSCCCCCC---CCCCHHHHHHHHHHHHHTSCCCTTCCCCSSCCCC
T ss_pred             CCCCCcCHHHHHHHHHHcCCCCHHHHHHh-ccHHHhcCCCCCC---CCCCHHHHHHHHHHHHhCCCCcCccccCcccCCc
Confidence            58999999999999999999999999987 9999977789998   789999999999999999975 579999999999


Q ss_pred             CCcHHHHHHHHhCCccccccCCChhhHhhHHHHHHHHHHHHHHHhhCCCCcceeeccchHHHHHHHHHHhhhhcCCCCEE
Q 001990          179 HVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTF  258 (985)
Q Consensus       179 ~~p~~v~~~i~~~~~~~t~~~py~~e~sqg~l~~i~e~q~~ia~L~g~~~~~~sl~~~~ta~~ea~~~a~~~~~~~g~~V  258 (985)
                      ++|+++. ++++|++|+|+|||||||++||+||+++|+|+++|+|||||.+|+++++|+++.+++++|+.+.+  +++++
T Consensus        77 ~~p~~i~-~~~~~~~~~t~ytPyqpE~sQG~Lq~l~e~q~~l~eltGmd~~n~s~~~ga~a~~~~~~~~~~~~--~~~~~  153 (437)
T d1wyua1          77 HVPPVVQ-ALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLEIANASMYDGATALAEGVLLALRET--GRMGV  153 (437)
T ss_dssp             CCCHHHH-HHHTSHHHHHCCSCCSGGGCHHHHHHHHHHHHHHHHHHTSSEECSCBSSHHHHHHHHHHHHHHHH--TCCEE
T ss_pred             eeCHHHH-HHHhChhhhhhCCCcchHHHHHHHHHHHHHHHHHHHhhCCCccccCchHHHHHHHHHHHHHHhhh--ccccc
Confidence            9999995 89999999999999999999999999999999999999999999999999999999999998877  67899


Q ss_pred             EEcCCCChhHHHHHHHhhcCCCeEEEEeCchhhhc----cCCCEeEEEEEcCCCCeeeccHHHHHHHHHhCCcEEEEEec
Q 001990          259 IIASNCHPQTIDICITRADGFDIKVVVSDLKDIDY----KSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATD  334 (985)
Q Consensus       259 lv~~~~h~s~~~~~~~~a~~~gi~v~~~~~~~l~~----l~~~t~~V~v~~pn~~G~i~dl~~I~~~a~~~galliV~a~  334 (985)
                      ++++.+||++..++.++++..|++++.+|.++...    +++++++|++|+||++|.++|+++|++++|+.|+++++++|
T Consensus       154 ~v~~~~~p~~~~v~~t~a~~~g~~vv~v~~~~~~~~~~~~~~~~Aavmi~~Pnt~G~~ed~~~i~~~~h~~G~l~~~~ad  233 (437)
T d1wyua1         154 LVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEGGRTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAHGAGALFVAVAD  233 (437)
T ss_dssp             EEETTSCHHHHHHHHHHHHHTTCEEEEECCBTTBCCCCCCCTTEEEEEEESSCTTSBCCCHHHHHHHHHHTTCEEEEECC
T ss_pred             ccccccChHHhhhhhhhcccceeeEEeeecccccchhhhhccceeEEEEccccccccccchHHHHHHhhhccceEEeeec
Confidence            99999999999999999999999999998865432    67899999999999999999999999999999999999999


Q ss_pred             cccccCCCCCCcccceEEEecCccccccCCCCCCceEEEEEchhhHhcCCCceeeeeecCCCCcceEEeccccccccccc
Q 001990          335 LLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIVGVSIDSSGKPALRVAMQTREQHIRRD  414 (985)
Q Consensus       335 ~~alg~l~~p~~~GaDi~v~s~k~lg~P~~~GGP~~G~l~~~~~~~~~lp~~~vG~s~d~~g~~~~~l~l~tre~~~rre  414 (985)
                      +++++++++|+++||||+++++|+||+|+++||||+||++++++++|++|||++|.++|.+|+++|++++|+||||||||
T Consensus       234 ~~al~~l~~Pg~~GaDi~~g~~q~fg~p~g~GGP~~G~~a~~~~l~r~lPgrivg~s~d~~G~~~~~l~lqtreqhIrRe  313 (437)
T d1wyua1         234 PLSLGVLKPPGAYGADIAVGDGQSLGLPMGFGGPHFGFLATKKAFVRQLPGRLVSETVDVEGRRGFILTLQAREQYIRRA  313 (437)
T ss_dssp             TTGGGTBCCHHHHTCSEEEEECTTTTCCCGGGCSCCEEEEECGGGGGGCCSCCEEEEEBTTSCEEEEECCGGGSHHHHGG
T ss_pred             hhhhhccccccccccceEeeccceeccccCCCcCccccccccchhhccccccccccccccCCcccceeeccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCccchhHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHHHHHHHhcCCCEEEc-CCCCcceEEEecCC-HHHHHHHH
Q 001990          415 KATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGTFALGLKKLGTVEVQ-GLPFFDTVKVKCAD-AHAIASAA  492 (985)
Q Consensus       415 ~atsni~t~~~l~a~~aa~y~~~~g~~Gl~~i~~~~~~~a~~l~~~L~~~g~~~~~-~~~~~~~~~i~~~~-~~~l~~~L  492 (985)
                      ||||||||+++++++++++|+.++|++||+++++++..+|+|++++|.+++|++++ +.++|++|+++.+. +.+++++|
T Consensus       314 katsnict~q~l~a~~a~~Y~~~lG~~GL~~ia~~a~~~A~yl~~~L~~~~g~~~~~~~~~f~ef~v~~~~~~~~i~k~L  393 (437)
T d1wyua1         314 KAKSNITTNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFALALPKDPEAVRRAL  393 (437)
T ss_dssp             GSSCCCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCEECSCSSBCSEEEEECSSCHHHHHHHH
T ss_pred             ccccchhhHHHHHHHHHHHHhhhcCcccHHHHHHHHHHHHHHHHHHhhhcCCeeccCCCCeeeEEEEECCCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999998559877 46889999999876 99999999


Q ss_pred             HHcCceeee-----ecCCeEEEEeccCCCHHHHHHHHHHHhC
Q 001990          493 YKIEMNLRV-----VDSNTVTASFDETTTLEDVDKLFIVFAG  529 (985)
Q Consensus       493 ~~~Gi~~~~-----~~~~~lris~~~~~t~edid~ll~~l~~  529 (985)
                      .++||+.+.     ..++++++++||.+|++|||+|+++|++
T Consensus       394 ~d~G~~~~~~~~~~~~~~~lli~~TE~~tkeeiD~~v~al~e  435 (437)
T d1wyua1         394 AERGFHGATPVPREYGENLALFAATELHEEEDLLALREALKE  435 (437)
T ss_dssp             HHTTCCCCEECCTTSCSSEEEEECCTTCCHHHHHHHHHHHHH
T ss_pred             HhCCCCCCcccccCCCCCeEEEecCCCCCHHHHHHHHHHHHH
Confidence            999997543     2368999999999999999999999963
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure