Citrus Sinensis ID: 002014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980--
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
cccccccHHHHHHHHHHHHccccEEccccEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHcccHHHHHHHHccccccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccHHcHHHcccccccEEEEccccccccccHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHccccEEEEEEcccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEcccccHHHHHHHHcccEEEEEEEEcccEEEEEEccHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHccccccHHHHEEEEEEEEcccEEEEccccccc
cccccccHHHHHHHHHHHHcccEEEccccEEEEcHHHHHHHHHHHHHHHccccccccccEEEccccccccHHHHHHHHHHHHHHHHccEEEEEcccccccccccEEccHHHHccEEEEccccccHHHHHHHHHHHHHHHHEEEHccHHHHHHHHHHccccccccccHHHccEEcccccHHHHHHHHHHHcHccEEEEccccccEEHHcHHHcccccEEEcccccccccccccccccccEEEEEccccHHHHccHHHHHHHcEcccccccHccHHHHHHHHccccHcEEEcccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccHHHccccccccccHHcccccccccccccccccccccccccccccccccccccHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccEEcccccccEEEccccccccccccccccccHccccccccccEEEcccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHcccccHHHcHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccccHccccccEEccccccccHHHHHcccccccccccHHHHHHEEEEEEEcccccccEEEEEEEcccccEEEEEEEEEEcccccccEEEccccHHHHHHHEEHccEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHcccccHEHHEEEEEEEcccccEEEEcccccc
MAIVTGDRYLEKLVKFVEQqagpliegsivlklnpaglHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLkvvsalpppardptplsllpfcrlkvlelrgcdlstSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEikdspqwnrlsfvscscnRLVIMDESlqllpavetldlsrnkfakvdnlrkcvnlkhldlgFNNLRSIAAFSEVSCHIVKLVLRNNAlttlrgienlkslegldisYNIISTFSELEFLASLPYLLNlwlegnplccsrwyRAQVFSYfahpaklkvdgkeisTRELWERQLIIARRqkrpagfgfyspakgnadgdgnanrkRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaEIIDLMSRVEHMKRERSILWLREFKEWMdhtsenfvdgsicsgatlmnceednyiknkrsqphlaesskyvsgsvqasgdesstnilesensyadmptglhayqsfdhigslgitggfslpgigrmelrqenekpylhdgagaatvqsksfhqdtftiqdrrmvenihespltpidditdafsssarpgspphyredILHRRHNLVAEILQLSAESYsvvssdsktscsdddfreygpsmlevdqsinpeheyssAEVHSLLNLFeedhndqpheidcqrencknngfsaggndgevdssvNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLngnlniseadnvgeqgkhifglnyllrtsdkkqtrenavmtpYISGIGSVAKFLSSVKEDFVEDyfnknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFwcsedkvihlspyisn
maivtgdrYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVsalpppardptplsLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEikdspqwnrlSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLrnnalttlrgienlksleglDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPaklkvdgkeistRELWERQLIIArrqkrpagfgfyspakgnadgdgnanrKRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaeIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAEsskyvsgsvqasgdeSSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHespltpidditdaFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYsvvssdsktscsddDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLleknkrkhtrRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEdkvihlspyisn
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSrlealrelerllagaplDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLsaesysvvssdsktscsdddFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
***VTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPP****PTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFY**************************************************************IIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNY*******************************************TGLHAYQSFDHIGSLGITGGFSLPGIGRM*****************************FTI***************************************ILHRRHNLVAEILQLS*************************************************************************************************************************LQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSD****RENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPY***
****TGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELW*************************************************************************************************************************************************************************************************************************************************************************************ILHRRHNLVAEILQLSA**********************************************************************************************************************************SEADNVGEQGKHIFGLNYL******************ISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYI**
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGN***************************************NEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNK*************************TNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAE***************DDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
***VTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKR******************************************************************DAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKN*R*******************************NSYADMPTGLHAYQ***********G**SL***GR***************************************************************GSPPHYREDILHRRHNLVAEILQLSAESYSVVSS*************************N*************************HEIDCQ**NCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKT*A**NLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYIS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query982 2.2.26 [Sep-21-2011]
Q6P4K6 1129 Serine/threonine-protein yes no 0.364 0.317 0.293 2e-25
Q8N1F8 1099 Serine/threonine-protein yes no 0.247 0.221 0.333 3e-21
Q5F4791073 Serine/threonine-protein yes no 0.225 0.205 0.307 1e-20
Q6IRN0 1137 Serine/threonine-protein N/A no 0.350 0.302 0.291 3e-20
Q80TM9 1593 Nischarin OS=Mus musculus yes no 0.226 0.139 0.311 3e-19
Q3TAA71072 Serine/threonine-protein no no 0.324 0.297 0.300 9e-19
Q9Y2I1 1504 Nischarin OS=Homo sapiens no no 0.208 0.136 0.315 1e-18
Q4G017 1502 Nischarin OS=Rattus norve no no 0.226 0.147 0.304 5e-18
Q4LDG9190 Dynein light chain 1, axo no no 0.115 0.594 0.371 7e-10
Q6DHB1192 Dynein light chain 1, axo no no 0.115 0.588 0.380 9e-10
>sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 114/388 (29%), Positives = 191/388 (49%), Gaps = 30/388 (7%)

Query: 10  LEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSD 69
           ++ L + + +    +++GS +L L    L  V       R  E+L    P    +A  + 
Sbjct: 10  VQALAQILHEHGDKVLDGSRILALLTPCLQVVT------RLFEQLFPRGPGTGFQALPAH 63

Query: 70  LGDHRALEQLRRILKLL---TSLKVVSALPPPARDPTP--LSLLPFCRLKVLELRGCDLS 124
             D   + + + +L +L    SLK+V     PA  P    +++ PF  L+ LELR C L 
Sbjct: 64  PADSVPILRAQFMLDMLQKTPSLKLVH----PAECPRQFDVNIFPFKSLRSLELR-C-LP 117

Query: 125 TSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMD 184
               +GL  +   LE + C+   ++L  V A    ++  +  W  L  +  S N L  +D
Sbjct: 118 PHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDLSSALPWLVLHTLDFSYNTLKNLD 177

Query: 185 ESLQLLPAVETLDLSRNKFAKVDNLRKCVN-LKHLDLGFNNLRSIAAFS-EVSCHIVKLV 242
            SL+LL +++ LDLS N+  +  +  K ++ L++L+LG+N+L ++   S   +  +  L+
Sbjct: 178 GSLELLNSLKILDLSHNQITECGSYLKVLSELQYLNLGYNHLTAVPELSVGNTAKLHSLI 237

Query: 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYR 302
           L++N L+   G+ENL +L+ LD+SYN++   S+L  LA L  L  L+LEGNPL   + YR
Sbjct: 238 LKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPLYFQKDYR 297

Query: 303 AQVFSYFAHPAKLKV--DGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
           A    + +H A   V  DGK +S+ E+   Q    + + +P+     S   G+     +A
Sbjct: 298 ALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDLTDSYSA 357

Query: 361 NRK------RKKA---CRLASIESEEES 379
             K      RKK+    R ASI    +S
Sbjct: 358 AEKSAPRLPRKKSRVKVRTASISERSDS 385

Xenopus tropicalis (taxid: 8364)
>sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 Back     alignment and function description
>sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 Back     alignment and function description
>sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 Back     alignment and function description
>sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 Back     alignment and function description
>sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 Back     alignment and function description
>sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 Back     alignment and function description
>sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 Back     alignment and function description
>sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 Back     alignment and function description
>sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query982
359491520 1089 PREDICTED: uncharacterized protein LOC10 0.922 0.831 0.593 0.0
356524698 1091 PREDICTED: uncharacterized protein LOC10 0.939 0.846 0.559 0.0
449527667977 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.934 0.939 0.545 0.0
449439162 1090 PREDICTED: uncharacterized protein LOC10 0.938 0.845 0.547 0.0
297734346992 unnamed protein product [Vitis vinifera] 0.857 0.848 0.551 0.0
425626121063 Outer arm dynein light chain 1 protein [ 0.943 0.872 0.502 0.0
2978471221066 leucine-rich repeat family protein [Arab 0.941 0.867 0.505 0.0
425718031051 Outer arm dynein light chain 1 protein [ 0.943 0.882 0.502 0.0
357521685 1238 hypothetical protein MTR_8g107440 [Medic 0.826 0.655 0.568 0.0
2978304301009 hypothetical protein ARALYDRAFT_898146 [ 0.871 0.848 0.491 0.0
>gi|359491520|ref|XP_002278916.2| PREDICTED: uncharacterized protein LOC100250985 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1051 bits (2717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/998 (59%), Positives = 706/998 (70%), Gaps = 92/998 (9%)

Query: 1   MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPL 60
           MAIVTGDRYLE LVKFVE+QAGPLIEGS+VLKLNP GLHYVQSRLEAL ELE LLAGAP+
Sbjct: 1   MAIVTGDRYLESLVKFVEKQAGPLIEGSVVLKLNPVGLHYVQSRLEALHELESLLAGAPV 60

Query: 61  DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
           DYLRAY+SDLGDHRALEQLRRIL+LLTSLKVVS LPP  RDPT LSLLPF RL+VLELRG
Sbjct: 61  DYLRAYISDLGDHRALEQLRRILRLLTSLKVVSVLPPSVRDPTRLSLLPFGRLRVLELRG 120

Query: 121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
           CDLSTSAA+GLLELRHTLEKIICHNST+ALRH+FASRIV IKDSPQW RLSFVSC+CN L
Sbjct: 121 CDLSTSAARGLLELRHTLEKIICHNSTDALRHLFASRIVAIKDSPQWKRLSFVSCACNGL 180

Query: 181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
           ++MDESLQLLPAVETLDLSRNKF+KVDNLRKC  LKHLDLGFN+LR+I++FSEVSCHIVK
Sbjct: 181 LLMDESLQLLPAVETLDLSRNKFSKVDNLRKCTKLKHLDLGFNHLRTISSFSEVSCHIVK 240

Query: 241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
           LV+RNNALTTLRGIENLKSLE LD+SYN+IS FSE+E LA LP L  LWLEGNP+CC+RW
Sbjct: 241 LVMRNNALTTLRGIENLKSLEDLDLSYNVISNFSEIEILAGLPSLRRLWLEGNPICCARW 300

Query: 301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
           YRAQVFS+FAHP K+K+D  EISTRE W+RQ+IIA RQKRPA FGFY PA+ +A G+G  
Sbjct: 301 YRAQVFSFFAHPDKVKLDEMEISTREFWKRQIIIASRQKRPASFGFYYPAREDA-GEGGI 359

Query: 361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
           + KRKK  RLA IE+ E S  + SD++SVSCDNE+ SKE+N  SDD+AEI+DLM RVE M
Sbjct: 360 STKRKKLSRLACIET-EGSMYICSDQDSVSCDNEVRSKEDNAISDDEAEIVDLMKRVELM 418

Query: 421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVS 480
           K+ERS+LWLREFKEWMD  S++F +G+     ++++   +NY++ K  Q HL ESS+YVS
Sbjct: 419 KKERSVLWLREFKEWMDLASDSFAEGN--KYGSVLDSGTENYMRKKAGQRHLGESSRYVS 476

Query: 481 GSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQEN 540
            SVQASGDES T+ILES NS+AD+  GL   Q  D  G  G                   
Sbjct: 477 DSVQASGDESGTDILESNNSFADISIGL-VPQYVDRSGESG------------------- 516

Query: 541 EKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPP 600
                                  F ++D            T +D I D  S S  PGSPP
Sbjct: 517 ---------------------SMFALRD------------TGVDAIQDQ-SKSYSPGSPP 542

Query: 601 HYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHE 660
           HY+ED+LHRRH LV +ILQLSAESYSV SSDS TS   +D  E   S+ EV+QS+N E  
Sbjct: 543 HYQEDLLHRRHILVEDILQLSAESYSVASSDSNTS-DSNDLCEVESSVSEVEQSVNEEIS 601

Query: 661 YSSAEVHSLLNLFEEDHNDQPHEIDCQRENCK--------------------------NN 694
             S   HSL   F   + +Q H+I   REN +                          +N
Sbjct: 602 NRSVG-HSLTTFFGNIYYEQRHQIPLVRENGRYLLDSHAGQASATLKLLKPEQSLQLCSN 660

Query: 695 GFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISE 754
            F AG +DGE+ S  N+EA  L+K K K   R I  + + N V + E  Q L GN +   
Sbjct: 661 DFCAGAHDGEIASLSNEEADWLDKKKCKRKPRKIVSVSQNNMVGRAEDSQTLVGNPDFCG 720

Query: 755 ADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFL---SSVKEDFVEDY 811
            D   EQG+ IFG N+     D +QT  +A +TP I   G +   L   ++  +DF+++Y
Sbjct: 721 GDMEDEQGEQIFGWNFWDGFVDGEQTCASATITPLIDDAGRILSGLRGPTTGADDFIKNY 780

Query: 812 FNKNVADSKSHETCMQY--TVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGS 869
           FN N+ADS  +ETC QY  + C+ LE +  +  REVA+L SSE+K YVLL  VT DG+G+
Sbjct: 781 FNLNIADSSVNETCKQYMRSSCF-LELESRYTEREVAILLSSEHKLYVLLVDVTFDGSGT 839

Query: 870 ILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSA 929
           IL LLGCH++ED+REVL+G+GLQV+RV  E  A Y+ +TRS+EKSRQL CTLQ+      
Sbjct: 840 ILKLLGCHRLEDVREVLVGVGLQVVRVYIERDAAYMFLTRSMEKSRQLLCTLQVVDSNET 899

Query: 930 NDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFW 967
             KCSLRSLEQVQVELFEK ICGG K+ IFQYS+VLFW
Sbjct: 900 CSKCSLRSLEQVQVELFEKHICGGSKISIFQYSLVLFW 937

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356524698|ref|XP_003530965.1| PREDICTED: uncharacterized protein LOC100788364 [Glycine max] Back     alignment and taxonomy information
>gi|449527667|ref|XP_004170831.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228525 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439162|ref|XP_004137356.1| PREDICTED: uncharacterized protein LOC101203626 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734346|emb|CBI15593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42562612|ref|NP_175287.2| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194190|gb|AEE32311.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847122|ref|XP_002891442.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297337284|gb|EFH67701.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42571803|ref|NP_973992.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194191|gb|AEE32312.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357521685|ref|XP_003631131.1| hypothetical protein MTR_8g107440 [Medicago truncatula] gi|355525153|gb|AET05607.1| hypothetical protein MTR_8g107440 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297830430|ref|XP_002883097.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] gi|297328937|gb|EFH59356.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query982
TAIR|locus:21980651063 AT1G48540 [Arabidopsis thalian 0.619 0.571 0.582 7.2e-224
TAIR|locus:20885251010 AT3G17920 [Arabidopsis thalian 0.487 0.474 0.675 3.2e-221
UNIPROTKB|Q5F4791073 STK11IP "Serine/threonine-prot 0.246 0.225 0.306 3.2e-23
RGD|13050461072 Stk11ip "serine/threonine kina 0.252 0.231 0.329 1.6e-22
UNIPROTKB|F1ML951073 STK11IP "Uncharacterized prote 0.252 0.231 0.321 2.7e-22
ZFIN|ZDB-GENE-040426-1022 1160 stk11ip "serine/threonine kina 0.319 0.270 0.276 1.6e-21
MGI|MGI:19189781072 Stk11ip "serine/threonine kina 0.252 0.231 0.329 1.6e-21
UNIPROTKB|C9JQV3 1088 STK11IP "Serine/threonine-prot 0.247 0.223 0.333 2.3e-21
UNIPROTKB|Q8N1F8 1099 STK11IP "Serine/threonine-prot 0.247 0.221 0.333 2.4e-21
UNIPROTKB|F1P3Y6 1001 F1P3Y6 "Uncharacterized protei 0.225 0.220 0.307 4.4e-21
TAIR|locus:2198065 AT1G48540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1806 (640.8 bits), Expect = 7.2e-224, Sum P(2) = 7.2e-224
 Identities = 362/621 (58%), Positives = 455/621 (73%)

Query:     1 MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSXXXXXXXXXXXXXXXXX 60
             MAIVTGDRY+EKL KF+E +A  L+E +++LKLNPAGLHY+                   
Sbjct:     1 MAIVTGDRYVEKLQKFLEDEAESLLEETMILKLNPAGLHYLHLRLDSLRELERMLSNAPV 60

Query:    61 DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
             DYLRAYVSDLGD+RALEQLRRIL++LTSLKVVS LP PARDPTPLSL PF  LKVLELR 
Sbjct:    61 DYLRAYVSDLGDYRALEQLRRILRILTSLKVVSTLPSPARDPTPLSLFPFGSLKVLELRR 120

Query:   121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
             CDLSTS AKGL+ELRHTLEKIICHNST+ALRHVFASRI EI +SP+WN+L+ +SC+CNRL
Sbjct:   121 CDLSTSPAKGLIELRHTLEKIICHNSTDALRHVFASRIAEITNSPEWNKLAVISCACNRL 180

Query:   181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
             V+MDESLQLLPA E+LDLSRNKF KVDNLR+C  LKHLDLGFN+LR+++  S+VSCH+VK
Sbjct:   181 VLMDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVK 240

Query:   241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
             LVLRNNALTTLRGIENLKSL+GLD+SYNIIS FSELEFL SL  L  LWLEGNP+CC+RW
Sbjct:   241 LVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARW 300

Query:   301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
             YRA VFSY A P +LK+DGK+I TRE W+RQ+I+A RQ  PA +GFYSPA+   + +G+ 
Sbjct:   301 YRAHVFSYVALPDELKLDGKQIGTREFWKRQIIVAHRQSEPASYGFYSPAREEDNEEGSC 360

Query:   361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
             NRK+KK CRLASI SE EST V SD ES +CD+E    +EN+  + +A+I  L+S+VEH+
Sbjct:   361 NRKKKKICRLASIHSEAESTYVNSDHESATCDHE---NKENMKFNQEADIFGLISKVEHL 417

Query:   421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKR-SQPHLAESSKYV 479
             K+ERS+LWLREFKEWMD ++E+F D  +C  +  +N E+  Y K +  S+ H   + +Y 
Sbjct:   418 KKERSVLWLREFKEWMDRSTEDFAD--VCKDSQGINLEKKYYTKIREISRHHGGGTPRYT 475

Query:   480 SGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQE 539
             SGS++AS  +S    LE   S  D   G+   +  +   +  IT   S   +   +  Q+
Sbjct:   476 SGSLRASRAKSYRKNLECNGSCVDHKAGMDYMKYVEGNETQKITDDISSISLQSTDRNQK 535

Query:   540 NEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSP 599
             +++  +HD   + +V+       T  +   ++ EN + S L    DIT   + S  PGSP
Sbjct:   536 HQE-CVHDEMESLSVEPNDLLPTT--LAKEKLAENGNMSTL----DITQHMTGSTYPGSP 588

Query:   600 PHYREDILHRRHNLVAEILQL 620
             PHY++D+L+RRHNLV EILQL
Sbjct:   589 PHYQKDVLYRRHNLVEEILQL 609
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2088525 AT3G17920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F479 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305046 Stk11ip "serine/threonine kinase 11 interacting protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ML95 STK11IP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1022 stk11ip "serine/threonine kinase 11 interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1918978 Stk11ip "serine/threonine kinase 11 interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQV3 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N1F8 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3Y6 F1P3Y6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 54.6 bits (131), Expect = 1e-07
 Identities = 60/207 (28%), Positives = 87/207 (42%), Gaps = 18/207 (8%)

Query: 102 PTPLSLLPFCRLKVLELRGCDLST-----SAAKGLLELRH---TLEKIICHNST-NALRH 152
           P+PL  LP   LK L+L   DLS      S    L  L      +  +       +AL  
Sbjct: 156 PSPLRNLPN--LKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEE 213

Query: 153 VFASR---IVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNL 209
           +  S    I  +        LS +  S N+L  + ES+  L  +ETLDLS N+ + + +L
Sbjct: 214 LDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSL 273

Query: 210 RKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLR-GIENLKSLEGLDISYN 268
               NL+ LDL  N+L S A        ++  +L N  LT     ++    L   +I  N
Sbjct: 274 GSLTNLRELDLSGNSL-SNALPLIALLLLLLELLLNLLLTLKALELKLNSILLNNNILSN 332

Query: 269 IISTFSELEFLASLPYLLNLWLEGNPL 295
             ++  E   L+ L  L NLW   N L
Sbjct: 333 GETSSPEA--LSILESLNNLWTLDNAL 357

Length = 394
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 982
KOG18591096 consensus Leucine-rich repeat proteins [General fu 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG4237498 consensus Extracellular matrix protein slit, conta 99.72
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.69
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.67
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.66
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
PLN032101153 Resistant to P. syringae 6; Provisional 99.56
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
PLN032101153 Resistant to P. syringae 6; Provisional 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.42
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.81
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.8
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.62
PLN03150623 hypothetical protein; Provisional 98.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
PLN03150623 hypothetical protein; Provisional 98.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.17
KOG2123388 consensus Uncharacterized conserved protein [Funct 98.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.16
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.92
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.6
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.51
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.26
PRK15386426 type III secretion protein GogB; Provisional 97.18
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.16
PRK15386426 type III secretion protein GogB; Provisional 97.15
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.68
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.3
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 95.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.35
KOG4308478 consensus LRR-containing protein [Function unknown 94.23
KOG4308478 consensus LRR-containing protein [Function unknown 92.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 89.72
KOG4341483 consensus F-box protein containing LRR [General fu 87.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 86.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 85.52
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 80.1
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-94  Score=827.12  Aligned_cols=936  Identities=41%  Similarity=0.576  Sum_probs=804.4

Q ss_pred             cchhHHHHHHHHHhhcCcchhcCCcEEEec-CCCccchHhhhhcccccccccCCCCccccccccccCCCCCCchhhHHHh
Q 002014            5 TGDRYLEKLVKFVEQQAGPLIEGSIVLKLN-PAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRIL   83 (982)
Q Consensus         5 ~g~~~~~~lv~~l~~~~~~lL~sl~~L~L~-~~~L~~Lp~~L~~L~~Le~L~~~~~~~~l~l~~LdLs~n~~L~~Lp~~L   83 (982)
                      +|++|++.+-.||...++.++.+..+|.|+ +..++....++..+++|+....+.+.+++++.+.+.++.+.+.++...+
T Consensus         1 ~~d~~l~kLa~lLre~gD~lLsg~~tL~L~~p~l~~lnh~~l~s~~EL~lg~~g~~~~~f~a~~s~~ads~vl~qLq~i~   80 (1096)
T KOG1859|consen    1 TGDRYLEKLANLLRENGDKLLSGTFTLKLNGPALLHLNHLRLISLRELELGLSGAPVDYFRAYVSDNADSRVLEQLQRIL   80 (1096)
T ss_pred             CccHHHHHHHHHHHhcccceecceeEEEeccHHHHHHHHHHHHhhHHHhhccCCCCCceeEEecCCcccchHHHHHHHHH
Confidence            589999999999999999999999999999 6777777778888899998888999999999999999999999999888


Q ss_pred             cCCCCCcEEEccCCCCCCCC-CcCCCCCCCccEEEeeCCCCCccchhhHHhhhhhhHhhhccCCCccchhhcccchhccc
Q 002014           84 KLLTSLKVVSALPPPARDPT-PLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIK  162 (982)
Q Consensus        84 ~~L~~Lk~L~Ls~N~L~~~i-P~sf~~L~nL~~LdLS~N~Lss~~p~~L~~L~~LLeLLL~~N~L~~L~~l~~~~l~~L~  162 (982)
                      .-+++++.|.+-.-.-.+.. |-.+..+..|++|.|.++.|..  ..++..+.+.++.++++|.+..+..++...+.++.
T Consensus        81 d~lqkt~~lkl~~~pa~~pt~pi~ifpF~sLr~LElrg~~L~~--~~GL~~lr~qLe~LIC~~Sl~Al~~v~ascggd~~  158 (1096)
T KOG1859|consen   81 DFLQKTKVLKLLPSPARDPTEPISIFPFRSLRVLELRGCDLST--AKGLQELRHQLEKLICHNSLDALRHVFASCGGDIS  158 (1096)
T ss_pred             HHHhhheeeeecccCCCCCCCCceeccccceeeEEecCcchhh--hhhhHHHHHhhhhhhhhccHHHHHHHHHHhccccc
Confidence            88999999988877766665 7788899999999999999976  77899999999999999999999999999999999


Q ss_pred             CCCCCCCccEEEccCCccccchhhcCCCCCCCEEEcCCCCCCCCCCcCCCCCCCEEEcCCCCCCCccccccccccceeec
Q 002014          163 DSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV  242 (982)
Q Consensus       163 ~l~~L~~Lq~LdLS~N~Lt~LP~sL~~L~~L~~LdLS~N~Lt~l~~L~~L~sL~~LdLS~N~Ls~L~~l~~~L~sL~~L~  242 (982)
                      +.+.|..|...++++|.|..+..++.-++.|+.|+|++|+++.+..+..|+.|++|||++|.++.+|.+...-..|..|+
T Consensus       159 ns~~Wn~L~~a~fsyN~L~~mD~SLqll~ale~LnLshNk~~~v~~Lr~l~~LkhLDlsyN~L~~vp~l~~~gc~L~~L~  238 (1096)
T KOG1859|consen  159 NSPVWNKLATASFSYNRLVLMDESLQLLPALESLNLSHNKFTKVDNLRRLPKLKHLDLSYNCLRHVPQLSMVGCKLQLLN  238 (1096)
T ss_pred             cchhhhhHhhhhcchhhHHhHHHHHHHHHHhhhhccchhhhhhhHHHHhcccccccccccchhccccccchhhhhheeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999998765555699999


Q ss_pred             ccCCcCCCcccCCCCCCCCEEECcCCCCCCCchhhhhcCCCCCcEEEecCCCCCCCcccchhHhhhcC---CCceeecCC
Q 002014          243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFA---HPAKLKVDG  319 (982)
Q Consensus       243 Ls~N~Ls~L~~L~~L~sL~~LdLS~N~Ls~l~~l~~L~~Lp~L~~L~LsgNpLs~~~~~r~~v~~~l~---~L~lL~Ldg  319 (982)
                      |++|.++.+.++.++.+|+.|||++|.|.+...+..++.+..|+.|+|.|||++|.+|+|...+.++.   .+..+.|||
T Consensus       239 lrnN~l~tL~gie~LksL~~LDlsyNll~~hseL~pLwsLs~L~~L~LeGNPl~c~p~hRaataqYl~~~~a~~~f~LDg  318 (1096)
T KOG1859|consen  239 LRNNALTTLRGIENLKSLYGLDLSYNLLSEHSELEPLWSLSSLIVLWLEGNPLCCAPWHRAATAQYLHKNSAPVKFKLDG  318 (1096)
T ss_pred             ecccHHHhhhhHHhhhhhhccchhHhhhhcchhhhHHHHHHHHHHHhhcCCccccCHHHHHHHHhHhccccCCcceEecc
Confidence            99999999999999999999999999999998888899999999999999999999999999988887   688899999


Q ss_pred             CccChHHHHHHHHHHHhhcCCCCCccccCCCCCCCCCCCchhhhhhhhhhhhcccccccccccC--CCCCCCCCCccccc
Q 002014          320 KEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVG--SDRESVSCDNEIES  397 (982)
Q Consensus       320 N~Is~~e~~~~~~l~~~~~~~~~~~~~~~P~~~~~~~~~~~~~k~kk~rRL~~i~~~e~~~c~~--Sd~~S~~c~~~s~s  397 (982)
                      ..++..+.++.+.....+...|..|+.|+|+.......+++.++++++.|++.+..+++.+.+.  |+.++..|+-+.++
T Consensus       319 k~l~~~efwk~~s~~~hr~~~p~s~~~~S~a~~~~~~dgS~~~s~gki~tl~~ihs~~~s~~v~r~S~~e~at~DpE~~s  398 (1096)
T KOG1859|consen  319 KALGGREFWKRQSGVSHRSSRPASYGFYSPARSENTSDGSQFRSKGKIYTLASIHSEDESTYVNRISDCESATCDPEESS  398 (1096)
T ss_pred             eeccchhhhhhhhheecCCCCCCCCCCCCchhccCCCccchhhhcCceeecccccchhhhheeccccccccccCCccccc
Confidence            9999999999999999999999999999999999998999999999999999999999988887  78888888877665


Q ss_pred             c--ccccCCCchHHHHHHHHHHHHHHhhhhhhhHHHhHhhhccccccccCCceeecccccCccchhhhhcccCCcccccc
Q 002014          398 K--EENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAES  475 (982)
Q Consensus       398 k--de~~~sd~d~ei~dl~~klE~lkke~s~~Wl~ef~ewm~e~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~  475 (982)
                      .  .+++....+....+++.++++++++++..|+|+|+|||+....++.++.+....+.+++++ +.+.+....+..+.+
T Consensus       399 ~~~t~a~~f~q~~pe~el~s~~~hl~~~r~vl~lR~~~Ew~~~p~~~~~~~s~~sqpt~seq~~-~tk~rn~p~~e~~g~  477 (1096)
T KOG1859|consen  399 EINTEAAKFSQEAPEFELISKVEHLKKERSVLWLREFKEWLDSPNEDFMDVSKTSQPTESEQKY-YTKLRNEPLHEGSGT  477 (1096)
T ss_pred             cCCCccccccCCCchhhhccchHHHhhhhhHHHHHHHhhhhcCCchhhccccCCCCCcchhcCc-ccccCCCCcccccCC
Confidence            4  4444455555577999999999999999999999999999999999999999999999975 666666667777789


Q ss_pred             cccccccccccCCCCcccccccCCCccCCCCccccccccccCCCcccccCcccCCcccccccccccCCccCCCCCccccc
Q 002014          476 SKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQ  555 (982)
Q Consensus       476 s~~~~~~~~~s~~~~~~n~le~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  555 (982)
                      .+|+.|+...+-..+.+|.+|..++|+|+-+|+..+++.+...+..++.....+.-...|+||++   +.++++|....+
T Consensus       478 p~~tp~sl~~~i~~~p~~n~e~~~~~~~~~~g~~~e~~~e~~et~~et~~e~~~~~~et~ln~~~---~~c~legpp~~~  554 (1096)
T KOG1859|consen  478 PRYTPGSLHHNISSTPTNNVELASTFDATITGIKSEANDESGETLYETCTEGEETNQETDLNQKH---QLCTLEGPPDRH  554 (1096)
T ss_pred             CcCCCCccchhhccCcccchhhcccccccccchhhhcccccccccccccccchhhhhhhhccccc---eeccccCCcccc
Confidence            99999999999999999999999999999999999999999999999988888888889999655   999999999888


Q ss_pred             -------cccccccccccccccccccccCCCCcccCCcccCCCCCCCCCCCCchhhhHHHHhhhHHHHHHhhccCc----
Q 002014          556 -------SKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAES----  624 (982)
Q Consensus       556 -------~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~p~spp~~~~d~l~rr~~l~~~~lq~~~~~----  624 (982)
                             +.|.+-.++.+++.+..|||+|+.+    ++.+++..+.+|+|||||++|+|+||++|++||||++||+    
T Consensus       555 ~~~~~l~vss~~l~e~~l~~a~~dE~~~m~tl----ea~q~e~~s~~~sSp~~~~kD~L~~r~~lsl~il~ic~d~~~~~  630 (1096)
T KOG1859|consen  555 EELLRLYVSSSNLQEDPLSDAESDENGNMSTL----EAKQSETGSLTPSSPPHYQKDVLTRRANLSLEILQICADSRSIN  630 (1096)
T ss_pred             hhhheeecccccccccchhhhhhhcccceeee----ecccccccccCCCCCCCccccccccchhHHHHHHHhCccccccc
Confidence                   8888888999999999999999999    6888889999999999999999999999999999999999    


Q ss_pred             ceeecCCCCCcCCccCCCCCCCCcccccccCCcccccccccccccccccccccCCCCCcccccc-------------cc-
Q 002014          625 YSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQR-------------EN-  690 (982)
Q Consensus       625 ~~~~s~~~~~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~-  690 (982)
                      |+|+|+|+.++|+++++++.+.        .+.+..++...+.+..|++.=--|-..++-+...             ++ 
T Consensus       631 y~v~~~D~~ss~~e~en~ls~~--------~~~~~eq~~~~rdL~~~r~~i~~C~~cgt~F~~eqp~kg~~~kelr~pd~  702 (1096)
T KOG1859|consen  631 YSVASSDKQSSCSEVENYLSEE--------LESNLEQILLQRDLTENRISIYRCVNCGTQFLIEQPEKGSKIKELRCPDS  702 (1096)
T ss_pred             ceeecccccchhhhhhhcccHh--------hhhhHhhhhhhhhhhccccceeeeccccccccccCcccccchhhhcCcch
Confidence            9999999999999999998877        4455556777777777765211122222222222             12 


Q ss_pred             cc--ccccCCCCCCCCccccchhhhhHhHhhc--cccceeeeecccccccchhhhhhhhccCCccccCCccc-ccccccc
Q 002014          691 CK--NNGFSAGGNDGEVDSSVNQEAHLLEKNK--RKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNV-GEQGKHI  765 (982)
Q Consensus       691 ~~--~~~f~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~  765 (982)
                      +|  +.+|.+|.|.-+-.+.|+|+.+|.+|+-  |||++|.+..+++..-              +|-+.++. +-..-.|
T Consensus       703 ~k~~t~~v~~~~~s~~~~~~v~a~~rl~p~~~~~rkp~e~~~ap~~~es~--------------~ci~kg~~shl~~ad~  768 (1096)
T KOG1859|consen  703 RKVYTTNVTSGLHSLKPSGGVNAEPRLSPKMIVERKPVERLVAPINEESS--------------NCIGKGEASHLSDADI  768 (1096)
T ss_pred             hhcccccccccccccCCccceecccccCcchhhhccchhhhccccccccc--------------cccCccchhhhhhccc
Confidence            34  7899999999777799999999999977  9999999988887763              22222211 1111111


Q ss_pred             ccccccccc-ccccccccccccc-c-cc-ccccccccccccch-----hhh-HHHhhcccccCCchhhhhccceEE-EEE
Q 002014          766 FGLNYLLRT-SDKKQTRENAVMT-P-YI-SGIGSVAKFLSSVK-----EDF-VEDYFNKNVADSKSHETCMQYTVC-WIL  834 (982)
Q Consensus       766 ~~~~~~~~~-~~~~~~~~~~~~~-~-~~-~~~~~~~~~~~~~~-----~~~-~~~~f~~~~~~~~~~~~~~~~~~~-~~~  834 (982)
                      +.-. -... -||+ ..+|..-. - .+ |...|...|+.++.     ..| ++.||-...|.+..-|+|+.|+.| +|+
T Consensus       769 s~~~-e~~~~rDh~-fw~ns~lp~~c~~~~~~~rs~~FLe~E~~~~~~e~~q~~~~~paklav~S~~~~c~~~vS~~~i~  846 (1096)
T KOG1859|consen  769 SDSD-EDNTIRDHE-FWENSSLPHLCTSHDEVARSKSFLETEFGLLLAEQAQVEELFPAKLAVSSHVETCRSYVSCDVIL  846 (1096)
T ss_pred             CCcc-ccccccccc-hhccCCCCcccccchhhHHHHHHHHHHhhhhhhhhcccccccchhhccCCCCceeEEEecccchh
Confidence            1100 0001 1111 22333211 1 11 22334456766555     333 888999999999999999999999 999


Q ss_pred             ecCCccccee-------EEEEeecCCeeEEEEEeeeecCCcccccccccccchhhHHHhhhccceEEEEEe---------
Q 002014          835 EQDFMHRGRE-------VAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVST---------  898 (982)
Q Consensus       835 ~~~~~~~~~e-------~~~l~~s~~k~~~ll~~~~~~~~~~~~~~l~~~~~~~~~~v~~g~glq~~r~~~---------  898 (982)
                      |..+.|+|||       ++||++||||+||+|++|..|-.++.++++|.|-+.|+|.|.||||+|++++.-         
T Consensus       847 ~~~sTyeqre~~a~~lq~~Ll~~sqd~l~~gl~g~S~~le~sa~s~~c~~~~~d~q~~~~~l~~~~~~Les~~~~~~~~~  926 (1096)
T KOG1859|consen  847 QICSTYEQRETDAPQLQNVLLLSSQDKLYVGLVGVSTDLEKSALSALCSHFISDFQDVSVGLGLQKVLLESEATVFQPYK  926 (1096)
T ss_pred             hhhchhhhcCCCchhhhheeecccccceeeeeccccchhhhhhcccccccchhhhhhhhhHHHHHHHHHhccchhhhccc
Confidence            9999999999       999999999999999999999999999999999999999999999999988762         


Q ss_pred             ---------eCCceEEEEeccHHHHHHHh------------------h-----eeeeecccccCCc-----cccchhhHH
Q 002014          899 ---------EMGATYLLMTRSIEKSRQLF------------------C-----TLQIFYLVSANDK-----CSLRSLEQV  941 (982)
Q Consensus       899 ---------~~~~~~~~~~~~~~~~~~~~------------------~-----~~~~~~~~~~~~~-----~~~~s~e~~  941 (982)
                               --.--++|.+|+++|+++++                  .     .+...|....--.     ||..+.|+|
T Consensus       927 ~~~~~~~~i~hrl~~~f~~~~fkE~~e~f~~ra~lveG~~~~~~c~l~~~~~~flp~dDaa~sp~~~~~~a~s~~s~edi 1006 (1096)
T KOG1859|consen  927 FNYSDFNDIDHRLKLYFYQRKFKEDGELFKWRAKLVEGLVVMSNCKLYLMEAFFLPHDDAAKSPYQVVSVAVSRLSAEDI 1006 (1096)
T ss_pred             cccccccchhhhhhhhhhhhhhhhhhHHHHHHHHHhcCchhhhhhhhhhhHhhcccccccccCcccccchhhhhhhhhhc
Confidence                     22345789999999999996                  2     3455565555555     899999999


Q ss_pred             -------HHHHHHhhhcCCcc-eeeeeeeeeeEEeeCCceE
Q 002014          942 -------QVELFEKQICGGLK-VGIFQYSMVLFWCSEDKVI  974 (982)
Q Consensus       942 -------q~~~~~~~~~~~~~-~~~~~y~~~~~~~~~~~~~  974 (982)
                             +|.|||+++|++++ +.+|||.-+.|++.....+
T Consensus      1007 ~p~~~~~~v~l~e~~~ls~lS~l~~~q~~pl~~q~~~~~~v 1047 (1096)
T KOG1859|consen 1007 LPWKLWGGVVLLEHDMLSTLSLLNYLQQIPLPFQSKLNHQV 1047 (1096)
T ss_pred             CCcCCCCceEEEeccccchHHHHHHHhhCCchhhhhhcccc
Confidence                   99999999999999 9999999999888765544

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 3e-10
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 4e-10
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 9e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 9e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-04
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (49%), Gaps = 9/151 (5%)
Query: 183 MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 242
           MD +L  L A + L LS N   K+ +L    NL+ L LG N ++ I     V+  + +L 
Sbjct: 41  MDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELW 100
Query: 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLC------ 296
           +  N + +L GIE L +L  L +S N I+ + E++ LA+L  L +L L GNPL       
Sbjct: 101 ISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPLYNDYKEN 160
Query: 297 -CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 326
             +  YR +V      P   K+DG  +   E
Sbjct: 161 NATSEYRIEVVKRL--PNLKKLDGMPVDVDE 189
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  139 bits (351), Expect = 1e-37
 Identities = 55/179 (30%), Positives = 82/179 (45%), Gaps = 11/179 (6%)

Query: 157 RIVEIKDSPQWNRLSFVS--CSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVN 214
           RI E + S        V        +  MD +L  L A + L LS N   K+ +L    N
Sbjct: 12  RIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMEN 71

Query: 215 LKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFS 274
           L+ L LG N ++ I     V+  + +L +  N + +L GIE L +L  L +S N I+ + 
Sbjct: 72  LRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWG 131

Query: 275 ELEFLASLPYLLNLWLEGNPLC-------CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 326
           E++ LA+L  L +L L GNPL         +  YR +V     +  KL  DG  +   E
Sbjct: 132 EIDKLAALDKLEDLLLAGNPLYNDYKENNATSEYRIEVVKRLPNLKKL--DGMPVDVDE 188
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query982
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.44
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.32
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.24
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.64
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
Probab=99.92  E-value=4.4e-25  Score=247.97  Aligned_cols=294  Identities=14%  Similarity=0.127  Sum_probs=228.7

Q ss_pred             hcCCcEEEecCCCccchHhh-hhcccccccccCCC-C---------ccccccccccCCCCCCchhhHHHhcCCCCCcEEE
Q 002014           25 IEGSIVLKLNPAGLHYVQSR-LEALRELERLLAGA-P---------LDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVS   93 (982)
Q Consensus        25 L~sl~~L~L~~~~L~~Lp~~-L~~L~~Le~L~~~~-~---------~~~l~l~~LdLs~n~~L~~Lp~~L~~L~~Lk~L~   93 (982)
                      +.+.+.|++..+.+..+|.. +..+++|+.|.... .         .....+..+++++|...+..|..+..+++|++|+
T Consensus        44 l~~l~~l~l~~~~l~~l~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  123 (390)
T 3o6n_A           44 LNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLV  123 (390)
T ss_dssp             GCCCSEEEEESCEESEECTHHHHHCCCCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEE
T ss_pred             cCCceEEEecCCchhhCChhHhcccccCcEEECCCCcccccChhhccCCCCcCEEECCCCCCCcCCHHHhcCCCCCCEEE
Confidence            67788999999999999876 46777777765421 1         1122345677777775555566788888899999


Q ss_pred             ccCCCCCCCCCcCCCCCCCccEEEeeCCCCCccchhhHHhhhhhhHhhhccCCCccchhhcccchhc-------ccCCCC
Q 002014           94 ALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVE-------IKDSPQ  166 (982)
Q Consensus        94 Ls~N~L~~~iP~sf~~L~nL~~LdLS~N~Lss~~p~~L~~L~~LLeLLL~~N~L~~L~~l~~~~l~~-------L~~l~~  166 (982)
                      |++|.+....+..|..+++|++|+|++|.+++..|..+..+++|..+.+.+|.+..++......+..       +..+..
T Consensus       124 L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~L~~L~l~~n~l~~~~~  203 (390)
T 3o6n_A          124 LERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAI  203 (390)
T ss_dssp             CCSSCCCCCCTTTTTTCTTCCEEECCSSCCCBCCTTTTSSCTTCCEEECCSSCCSBCCGGGCTTCSEEECCSSCCSEEEC
T ss_pred             CCCCccCcCCHHHhcCCCCCcEEECCCCccCccChhhccCCCCCCEEECCCCcCCccccccccccceeecccccccccCC
Confidence            9888888666666788888999999988888877777888888888888888776554222221111       111123


Q ss_pred             CCCccEEEccCCccccchhhcCCCCCCCEEEcCCCCCCCCCCcCCCCCCCEEEcCCCCCCCccc-cccccccceeecccC
Q 002014          167 WNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAA-FSEVSCHIVKLVLRN  245 (982)
Q Consensus       167 L~~Lq~LdLS~N~Lt~LP~sL~~L~~L~~LdLS~N~Lt~l~~L~~L~sL~~LdLS~N~Ls~L~~-l~~~L~sL~~L~Ls~  245 (982)
                      .++|+.|++++|.+..+|..  .+++|+.|++++|.++.++.+..+++|+.|+|++|.++.+.+ .+..+++|+.|+|++
T Consensus       204 ~~~L~~L~l~~n~l~~~~~~--~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~  281 (390)
T 3o6n_A          204 PIAVEELDASHNSINVVRGP--VNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISN  281 (390)
T ss_dssp             CSSCSEEECCSSCCCEEECC--CCSSCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCEEESGGGTTCSSCCEEECCS
T ss_pred             CCcceEEECCCCeeeecccc--ccccccEEECCCCCCcccHHHcCCCCccEEECCCCcCCCcChhHccccccCCEEECCC
Confidence            45788888888888877653  357899999999999998889999999999999999998744 566789999999999


Q ss_pred             CcCCCcc-cCCCCCCCCEEECcCCCCCCCchhhhhcCCCCCcEEEecCCCCCCCcccchhHhhhcCCCceeecCCCccCh
Q 002014          246 NALTTLR-GIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEIST  324 (982)
Q Consensus       246 N~Ls~L~-~L~~L~sL~~LdLS~N~Ls~l~~l~~L~~Lp~L~~L~LsgNpLs~~~~~r~~v~~~l~~L~lL~LdgN~Is~  324 (982)
                      |+|+.++ .+..+++|+.|+|++|.|+.++  ..+..+++|+.|+|++|+++..+      +..++.++.++|.+|++.+
T Consensus       282 n~l~~~~~~~~~l~~L~~L~L~~n~l~~~~--~~~~~l~~L~~L~L~~N~i~~~~------~~~~~~L~~L~l~~N~~~~  353 (390)
T 3o6n_A          282 NRLVALNLYGQPIPTLKVLDLSHNHLLHVE--RNQPQFDRLENLYLDHNSIVTLK------LSTHHTLKNLTLSHNDWDC  353 (390)
T ss_dssp             SCCCEEECSSSCCTTCCEEECCSSCCCCCG--GGHHHHTTCSEEECCSSCCCCCC------CCTTCCCSEEECCSSCEEH
T ss_pred             CcCcccCcccCCCCCCCEEECCCCcceecC--ccccccCcCCEEECCCCccceeC------chhhccCCEEEcCCCCccc
Confidence            9999986 5678999999999999999987  45778999999999999998653      4567889999999999998


Q ss_pred             HHHH
Q 002014          325 RELW  328 (982)
Q Consensus       325 ~e~~  328 (982)
                      ....
T Consensus       354 ~~~~  357 (390)
T 3o6n_A          354 NSLR  357 (390)
T ss_dssp             HHHH
T ss_pred             hhHH
Confidence            7543
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 982
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-15
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-12
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-08
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 70.9 bits (173), Expect = 3e-15
 Identities = 30/121 (24%), Positives = 55/121 (45%)

Query: 195 TLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGI 254
            L L+      + +L + + + HLDL  N LR++         +  L   +NAL  + G+
Sbjct: 2   VLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGV 61

Query: 255 ENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAK 314
            NL  L+ L +  N +   + ++ L S P L+ L L+GN LC     + ++       + 
Sbjct: 62  ANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSS 121

Query: 315 L 315
           +
Sbjct: 122 I 122
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query982
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.02
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.91
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.91
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=1.9e-20  Score=198.37  Aligned_cols=177  Identities=25%  Similarity=0.243  Sum_probs=135.3

Q ss_pred             CccEEEeeCCCCCccchhhHHhhhhhhHhhhccCCCccchhhcccchhcccCCCCCCCccEEEccCCccccchhhcCCCC
Q 002014          112 RLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLP  191 (982)
Q Consensus       112 nL~~LdLS~N~Lss~~p~~L~~L~~LLeLLL~~N~L~~L~~l~~~~l~~L~~l~~L~~Lq~LdLS~N~Lt~LP~sL~~L~  191 (982)
                      +|++|+|++|.|+++.+..|.++++|.++.+.+|.+..++.           ...+++|++|+|++|+++.++..+..++
T Consensus        32 ~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-----------~~~l~~L~~L~Ls~N~l~~~~~~~~~l~  100 (266)
T d1p9ag_          32 DTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-----------DGTLPVLGTLDLSHNQLQSLPLLGQTLP  100 (266)
T ss_dssp             TCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-----------CSCCTTCCEEECCSSCCSSCCCCTTTCT
T ss_pred             CCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-----------cccccccccccccccccccccccccccc
Confidence            34444444444444333344444444444444443332221           1235689999999999998888899999


Q ss_pred             CCCEEEcCCCCCCCCC--CcCCCCCCCEEEcCCCCCCCccc-cccccccceeecccCCcCCCcc--cCCCCCCCCEEECc
Q 002014          192 AVETLDLSRNKFAKVD--NLRKCVNLKHLDLGFNNLRSIAA-FSEVSCHIVKLVLRNNALTTLR--GIENLKSLEGLDIS  266 (982)
Q Consensus       192 ~L~~LdLS~N~Lt~l~--~L~~L~sL~~LdLS~N~Ls~L~~-l~~~L~sL~~L~Ls~N~Ls~L~--~L~~L~sL~~LdLS  266 (982)
                      +|+.|++++|.+..++  .+..+.+++.|++++|.+..+++ .+..++.|+.|++++|+|+.++  .+..+++|++|+|+
T Consensus       101 ~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls  180 (266)
T d1p9ag_         101 ALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQ  180 (266)
T ss_dssp             TCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECC
T ss_pred             ccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecc
Confidence            9999999999998874  67788999999999999998876 4455789999999999999974  58889999999999


Q ss_pred             CCCCCCCchhhhhcCCCCCcEEEecCCCCCCCccc
Q 002014          267 YNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWY  301 (982)
Q Consensus       267 ~N~Ls~l~~l~~L~~Lp~L~~L~LsgNpLs~~~~~  301 (982)
                      +|+|+.+|  ..+..+++|+.|+|++||+.|+|.+
T Consensus       181 ~N~L~~lp--~~~~~~~~L~~L~L~~Np~~CdC~~  213 (266)
T d1p9ag_         181 ENSLYTIP--KGFFGSHLLPFAFLHGNPWLCNCEI  213 (266)
T ss_dssp             SSCCCCCC--TTTTTTCCCSEEECCSCCBCCSGGG
T ss_pred             cCCCcccC--hhHCCCCCCCEEEecCCCCCCCcch
Confidence            99999988  4567889999999999999999854
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure