Citrus Sinensis ID: 002055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970----
MKPNMICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPEDVNGEEDEDEDENDVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
ccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccEEcccccccccccEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccHHHHHHHccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHHHcccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHccccccccccccccEEEEEccccccccccEEEEEEEEEcccEEEHHHHcccEEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHEEEEEEEEEc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccHcccccccccccccHHHHcHHcccEEEccccccccccccHHHcccccccEEEccccccccccccccccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEEccccccccccccccccccccEEEEccccccccccccHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEcccccEEEEcccccccccccEEEEEccccccccccHHHHccccccEEEEccccccccccHHHHHHHccccEEEccccccccccccccccccEEEEEEcccccccccccccccccEEEccccccccccccccccccccccccEEEEEccccccccccHHHccccccEEEEcccccccccccccHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHHcHHHHHHHcccccccccccccccccccccHHHHHHHEHccccccHHHccccEEEEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccHHHccEEEcccccccccccccHHHcccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEHHHHccc
MKPNMICVLVFAFLLFELLAIATISISfcngssyhvgcLESEREALLRFKQdlqdpsyrlaSWIGNRDCCAWAGIFCDNVTGHIVelnlrnpftyyvqpdqyeanprsmlvgkvnpslldlkhlsyldlsfndfqgvpiprfigsmgnlkylnlsgsrfvgmiphqlgnlssLQYLVLSRNFLHLVNfgwlsglsflehldfSYVNLSKASDWLLVTHMLPSLVeldlsncqlhifpplpvanfstlttldlshnqfdnsfvpswvFGLSHLLFLNLgynnfhgpipeglqsltslkhldlsfnhfnssiPNLLCRLTHLEHlslshnslegriprSMARLCNLKRLYLSGAKLNQEISEILDIfsgcvpngleslvlpnssifghlTDQIglfknldsldlsnnsivglvpqsfgrlsSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGentltlkvrrdwippfqlielglrscnvgsrfplwlysqkdlqfldlfnsgisgtfpnrLLKSASQLYLLDlghnqihgeltnltkaSQLSFLRLMANnlsgplplissnligldlsgnsfsgsIFHFLCYTINAGMKLQFLFLDRnilqgnlpdcWMSYQNLMMLdlsnnkfignlptsfgsLSSLVSLHLRknrlsgtmpislknctslmtldvgeneffgnipswFGEMFSIMVFLILRSNyfhgllptkLCDLAFLQILDLadnnlsgtlpnciHNLTAmatvnpftgnaikysiplnstyalgsVTEQALVVMKGVAADYSEILNLVRIIDVsknffsgtlpiglTNLKALQSLNLSyniftgripetiGAMRSLesidfsvnkftgeipqsmssltflnhlnlsnnyltgkipsstqlqsfnascflgnnlcgaplpknctdenvsipedvngeedededendvdYWLYVSVALGFVVGFWCfigpllvnrrwRYKYCNFLDGVGDRIVSFVRKCT
MKPNMICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLShnslegripRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRlsgtmpislkNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPEDVNGEEDEDEDENDVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
MKPNMICvlvfafllfellaIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPslldlkhlsyldlsFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRlthlehlslshnslEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPedvngeedededendvdYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
****MICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNC**********************DVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVR***
******C*LVFAFLLFELLAIATISISFCNGSSYH*GCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLP**************************VDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
MKPNMICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPED***********NDVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
**PNMICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCT********************NDVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPNMICVLVFAFLLFELLAIATISISFCNGSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPEDVNGEEDEDEDENDVDYWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRIVSFVRKCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query974 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.796 0.621 0.302 4e-74
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.775 0.603 0.309 6e-72
Q9C9H7847 Receptor-like protein 12 no no 0.652 0.750 0.311 4e-69
Q9FL28 1173 LRR receptor-like serine/ no no 0.678 0.563 0.311 2e-66
O49318 1124 Probable leucine-rich rep no no 0.636 0.551 0.305 2e-61
Q9LVP0 1102 Probable leucine-rich rep no no 0.662 0.585 0.308 2e-60
Q9LYN8 1192 Leucine-rich repeat recep no no 0.733 0.598 0.293 3e-60
Q9SHI2 1101 Leucine-rich repeat recep no no 0.655 0.579 0.308 2e-54
Q9LHP4 1141 Receptor-like protein kin no no 0.603 0.515 0.298 2e-53
Q9FZ59 1088 Leucine-rich repeat recep no no 0.632 0.566 0.301 6e-53
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  280 bits (716), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 279/921 (30%), Positives = 427/921 (46%), Gaps = 145/921 (15%)

Query: 37  GCLESEREALLRFKQDL------QDPSYRLASW-IGNRDCCAWAGIFCDNVTG--HIVEL 87
           G + ++ + LL  K+ L       DP   L  W   N + C+W G+ CDN TG   ++ L
Sbjct: 21  GIINNDLQTLLEVKKSLVTNPQEDDP---LRQWNSDNINYCSWTGVTCDN-TGLFRVIAL 76

Query: 88  NLRNPFTYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMG 147
           NL                    L G ++P      +L +LDLS N+  G PIP  + ++ 
Sbjct: 77  NLTG----------------LGLTGSISPWFGRFDNLIHLDLSSNNLVG-PIPTALSNLT 119

Query: 148 NLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNL 207
           +L+ L L  ++  G IP QLG+L +++ L +  N L                        
Sbjct: 120 SLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNEL------------------------ 155

Query: 208 SKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVF 267
               D       L +L  L L++C+L    P  +     + +L L  N  +   +P+ + 
Sbjct: 156 --VGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGP-IPAELG 212

Query: 268 GLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSH 327
             S L       N  +G IP  L  L +L+ L+L+ N     IP+ L  ++ L++LSL  
Sbjct: 213 NCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMA 272

Query: 328 NSLEGRIPRSMARLCNLKRLYLSGAKLNQEI-------SEILDI------FSGCVPNG-- 372
           N L+G IP+S+A L NL+ L LS   L  EI       S++LD+       SG +P    
Sbjct: 273 NQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSIC 332

Query: 373 -----LESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLY 427
                LE LVL  + + G +  ++   ++L  LDLSNNS+ G +P++   L  L  L L+
Sbjct: 333 SNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLH 392

Query: 428 RNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLW 487
            N L GTLS     NLT L   ++  N L  K+ ++     +L  L L         P  
Sbjct: 393 NNTLEGTLSP-SISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQE 451

Query: 488 LYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGEL-TNLTKASQLSFLR 546
           + +   L+ +D+F +   G  P  + +   +L LL L  N++ G L  +L    QL+ L 
Sbjct: 452 IGNCTSLKMIDMFGNHFEGEIPPSIGR-LKELNLLHLRQNELVGGLPASLGNCHQLNILD 510

Query: 547 LMANNLSGPLP--------------------------LIS-SNLIGLDLSGNSFSGSIFH 579
           L  N LSG +P                          LIS  NL  ++LS N  +G+I H
Sbjct: 511 LADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTI-H 569

Query: 580 FLCYTINAGMKLQFLFLD--RNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLS 637
            LC + +      +L  D   N  +  +P    + QNL  L L  N+  G +P + G + 
Sbjct: 570 PLCGSSS------YLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIR 623

Query: 638 SLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRSNY 697
            L  L +  N L+GT+P+ L  C  L  +D+  N   G IP W G++ S +  L L SN 
Sbjct: 624 ELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKL-SQLGELKLSSNQ 682

Query: 698 FHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTY 757
           F   LPT+L +   L +L L  N+L+G++P  I NL A+  +N    N    S+P     
Sbjct: 683 FVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLN-LDKNQFSGSLP----Q 737

Query: 758 ALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQS-LNLSYN 816
           A+G +++                   +  + +S+N  +G +P+ +  L+ LQS L+LSYN
Sbjct: 738 AMGKLSK-------------------LYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYN 778

Query: 817 IFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQL 876
            FTG IP TIG +  LE++D S N+ TGE+P S+  +  L +LN+S N L GK+    Q 
Sbjct: 779 NFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKL--KKQF 836

Query: 877 QSFNASCFLGNN-LCGAPLPK 896
             + A  FLGN  LCG+PL +
Sbjct: 837 SRWPADSFLGNTGLCGSPLSR 857
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query974
2240728851024 predicted protein [Populus trichocarpa] 0.943 0.897 0.497 0.0
3154367201020 verticillium wilt resistance-like protei 0.966 0.922 0.474 0.0
2099706071045 M18S-3Ap [Malus floribunda] 0.957 0.892 0.466 0.0
255581850 1082 leucine-rich repeat receptor protein kin 0.969 0.872 0.442 0.0
350284739978 receptor-like protein [Malus x domestica 0.938 0.934 0.479 0.0
350284749980 receptor-like protein [Malus baccata] 0.936 0.930 0.479 0.0
350284751980 receptor-like protein [Malus baccata] 0.936 0.930 0.479 0.0
14330716980 HcrVf2 protein [Malus floribunda] gi|350 0.936 0.930 0.479 0.0
3502847731041 receptor-like protein [Malus x domestica 0.947 0.886 0.458 0.0
350284759980 receptor-like protein [Malus micromalus] 0.940 0.934 0.469 0.0
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1003 (49%), Positives = 627/1003 (62%), Gaps = 84/1003 (8%)

Query: 33   SYHVGCLESEREALLRFKQDLQDPSYRLASWIG-NRDCCAWAGIFCDNVTGHIVELNLRN 91
            S+  GC + ER+ALL+FK DL+DPS RLASW G   DCC W G+ CDNVTGH++EL LR+
Sbjct: 32   SFTQGCSQIERDALLKFKHDLKDPSNRLASWAGFGGDCCTWRGVICDNVTGHVIELRLRS 91

Query: 92   -PFTYYVQPD----QYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSM 146
              F  Y+       QYE   + +L G++NPSL+ LKHL YLDL  NDF GV IP+FIG +
Sbjct: 92   ISFADYLASSGASTQYEDYLKLILSGRINPSLVSLKHLRYLDLRNNDFGGVQIPKFIGLI 151

Query: 147  GNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNF--LHLVNFGWLSGLSFLEHLDFSY 204
            G+LK+L+LS + F G IPH LGNLS L YL L   +   ++ N  WLS LS LE LD S 
Sbjct: 152  GSLKHLDLSDAGFAGTIPHGLGNLSDLNYLNLHDYYSQFNVENLNWLSQLSSLEFLDLSL 211

Query: 205  VNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFV-- 262
            V+L    +WL V + LPSLVEL LS CQL   PP+   NFS+L+ LDLS N  D S +  
Sbjct: 212  VHLGNVFNWLEVINTLPSLVELHLSYCQLPPVPPILYVNFSSLSILDLSSNYVDESAISM 271

Query: 263  ---PSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTH 319
               P WV  L  LL LNL  NNF GPIP GLQ+LT LK LDLS NHF+SSIP  L    H
Sbjct: 272  LNFPRWVSHLKTLLSLNLANNNFQGPIPNGLQNLTLLKALDLSINHFSSSIPEWLYGFEH 331

Query: 320  LEHLSLSHNSL---------------------------EGRIPRSMARLCNLKRLYLSGA 352
            L+ L+L  N+L                           EG IP S  +LCNL+ L LS  
Sbjct: 332  LKLLNLGSNNLQGVLSSAIGNMTSLISLDLSLNHELKFEGGIPGSFKKLCNLRTLSLSNV 391

Query: 353  KLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVP 412
            KLNQ+I+E+L++  GCV   +ESL L    +FG LT+ +G F+NL  L L +NSI G +P
Sbjct: 392  KLNQDIAEVLEVLLGCVSEEVESLDLAGCLLFGQLTNHLGKFRNLAYLGLRSNSISGPIP 451

Query: 413  QSFGRLSSLRVLQLYRNKLHGTL------------------------SEIHFVNLTKLSV 448
             + G L SLR L L  NKL+GTL                        SE+HF NL  L  
Sbjct: 452  MALGELVSLRSLVLSDNKLNGTLPKSFGELTKLEEMDISHNLFQGEVSEVHFANLKNLRN 511

Query: 449  FLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTF 508
            F    N L L+V  DWIPP QL+ + LRS NVG +FP W+   + L +LD+ NS IS T 
Sbjct: 512  FSAAGNQLNLRVSPDWIPP-QLVFIDLRSWNVGPQFPKWVRPLEHLSYLDISNSSISSTI 570

Query: 509  PNRLLKSASQLYLLDLGHNQIHGELTNLTK---ASQLSFLRLMANNLSGPLPLISSNLIG 565
            P      + ++  L+L HNQI G + +  K    +    + L +N   GPLP I SN+  
Sbjct: 571  PIWFWTMSFRMEYLNLSHNQIQGVIPSKLKLDFTASYPLVDLSSNQFKGPLPSIFSNVGA 630

Query: 566  LDLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKF 625
            LDLS NSFSGS+ +FLC+ I+    +Q L L  N+L G +PDCW S+Q L+ + LSNNK 
Sbjct: 631  LDLSNNSFSGSMLNFLCHKIDELKNMQVLNLGENLLSGVIPDCWSSWQYLVAIKLSNNKL 690

Query: 626  IGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMF 685
             GN+P S G+LS L SLH+R + LSG +PISLKNCT L+TLDV ENE  G++P+W G+ F
Sbjct: 691  SGNIPDSIGALSLLESLHIRNSSLSGKLPISLKNCTKLITLDVAENELVGSMPAWIGKRF 750

Query: 686  SIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGN 745
            S MV L +R+N FHG +P +LC+LA LQILDLA N LS ++P C + L+AMAT N   G 
Sbjct: 751  SSMVVLNMRANKFHGRIPRELCNLASLQILDLAHNRLSWSIPTCFNKLSAMATRNDSLG- 809

Query: 746  AIKYSIPLNSTYALGSVT-EQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTN 804
                 I L+S    GS T +  L+VMKG   +YS IL  VR ID+S N   G +P  +T 
Sbjct: 810  ----KIYLDS----GSSTFDNVLLVMKGKVVEYSTILKFVRSIDLSSNALCGEIPEEVTR 861

Query: 805  LKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNN 864
            L  LQSLNLS N  TGRIPE IG++R LES+DFSVN+ +GEIPQSMS LTFL+HLNLS+N
Sbjct: 862  LSELQSLNLSQNSLTGRIPEGIGSLRYLESMDFSVNQLSGEIPQSMSDLTFLSHLNLSDN 921

Query: 865  YLTGKIPSSTQLQSFNASCFLGNNLCGAPLPKNCTDENVSIPEDVNGEEDEDEDENDVD- 923
             L G+IPS TQLQSF  S F GN LCG PL KNC+ +N       + E + +ED N +  
Sbjct: 922  RLRGRIPSGTQLQSFGPSSFSGNELCGPPLSKNCSVDN-----KFHVEHEREEDGNGLKG 976

Query: 924  YWLYVSVALGFVVGFWCFIGPLLVNRRWRYKYCNFLDGVGDRI 966
             W YVS+ LGF+VGFW  +GPL+ NRRWRY Y +FLD + D+I
Sbjct: 977  RWFYVSMVLGFIVGFWGVVGPLMFNRRWRYVYYHFLDRLRDQI 1019

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|255581850|ref|XP_002531725.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223528628|gb|EEF30645.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|350284739|gb|AEQ27741.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284749|gb|AEQ27746.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|350284751|gb|AEQ27747.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|14330716|emb|CAC40826.1| HcrVf2 protein [Malus floribunda] gi|350284757|gb|AEQ27750.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284773|gb|AEQ27758.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284759|gb|AEQ27751.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query974
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.867 0.933 0.364 9.1e-116
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.919 0.879 0.308 2.8e-82
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.806 0.879 0.302 2.8e-82
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.741 0.890 0.32 1.3e-77
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.869 0.861 0.294 4.5e-75
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.813 0.827 0.295 2.2e-73
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.792 0.818 0.300 2.6e-71
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.895 0.877 0.282 1.1e-70
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.780 0.607 0.297 1.1e-69
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.751 0.836 0.305 7.2e-68
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1141 (406.7 bits), Expect = 9.1e-116, P = 9.1e-116
 Identities = 327/898 (36%), Positives = 462/898 (51%)

Query:    31 GSSYHVGCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLR 90
             GS+    C+ +ER+ALL F+  L D S RL SW G  DCC W G+ CD  T H+V+++LR
Sbjct:    26 GSAASPKCISTERQALLTFRAALTDLSSRLFSWSGP-DCCNWPGVLCDARTSHVVKIDLR 84

Query:    91 NPFTYYVQPDQYEANPRSMLVGKVNPXXXXXXXXXXXXXXFNDFQGVPIPRFIGSMGNLK 150
             NP +  V+ D+Y+   R  L GK++P               NDF  + IP FIG + +L+
Sbjct:    85 NP-SQDVRSDEYK---RGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLR 140

Query:   151 YLNLSGSRFVGMIPHQLGNLSSLQYLVL-SRNF-------LHLVNFGWLSGLSF-LEHLD 201
             YLNLS S F G IP  LGNLS L+ L L + +F       L   N  WLS LS  L++L+
Sbjct:   141 YLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLN 200

Query:   202 FSYVNLSKASD-WLLVTHMLPSLVELDLSNCQLHIFPPL--PVANFSTLTTLDLSHNQFD 258
               YVNLS A + WL     + +L EL L N +L   PP     A+   L  LDLS N   
Sbjct:   201 MGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSL- 259

Query:   259 NSFVPSWVFGLSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFN-HFNSSIPNLLCRX 317
             NS +P+W+FGL++L  L L ++   G IP G ++L  L+ LDLS N      IP++L   
Sbjct:   260 NSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDL 319

Query:   318 XXXXXXXXXXXXXEGRIPRSMARLCNLKR-----LYLSGAKLNQEISEILDIFSGCVPNG 372
                           G+I   +      K      L LS  KL   + E L    G + N 
Sbjct:   320 PQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESL----GSLRN- 374

Query:   373 LESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLH 432
             L++L L ++S  G +   IG   +L  LDLSNN++ G + +S G+L+ L  L L  N   
Sbjct:   375 LQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWG 434

Query:   433 GTLSEIHFVNLTKL-SVFLVGE--NTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLY 489
             G L + HFVNL  L S+ L  E   +L  K+   WIPPF+L  + + +C +G  FP+WL 
Sbjct:   435 GVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGL-FPMWLQ 493

Query:   490 SQKDLQFLDLFNSGISGTFPNRLLKS-ASQLYLLDLGHNQIHGELTNLTKASQLSFLRLM 548
              Q  L F+ L N+GI  T P+      +S++  L L +N+I G L       +L+ + L 
Sbjct:   494 VQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLS 553

Query:   549 ANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGM-KLQFLFLDRNILQGNLPD 607
             +NN  G  PL S+N   L L  N+FSGS    L   I+  M +++ ++L  N   GN+P 
Sbjct:   554 SNNFEGTFPLWSTNATELRLYENNFSGS----LPQNIDVLMPRMEKIYLFSNSFTGNIPS 609

Query:   608 CWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLD 667
                    L +L L  N F G+ P  +     L  + + +N LSG +P SL    SL  L 
Sbjct:   610 SLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLL 669

Query:   668 VGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLP 727
             + +N   G IP       S +  + L  N   G LP+ +  L+ L +L L  N+ +G +P
Sbjct:   670 LNQNSLEGKIPESLRNC-SGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIP 728

Query:   728 NCIHNLTAMATVNPFTGNAIKYSIPL---NST-YALGSVTE--QALVVMKGVAADYSEIL 781
             + + N+  +  ++  +GN I   IP    N T  A G+  E  Q LV +   A +Y  I 
Sbjct:   729 DDLCNVPNLRILD-LSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIA 787

Query:   782 NLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNK 841
             N    I++S N  SG +P  +  L  L+ LNLS N   G IPE I  +  LE++D S NK
Sbjct:   788 NS---INLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNK 844

Query:   842 FTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGNNL-CGAPLPKNC 898
             F+G IPQS ++++ L  LNLS N L G IP   + Q  + S ++GN L CG PLPK C
Sbjct:   845 FSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQ--DPSIYIGNELLCGKPLPKKC 900
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query974
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-65
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-29
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-14
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  237 bits (606), Expect = 4e-65
 Identities = 210/692 (30%), Positives = 305/692 (44%), Gaps = 139/692 (20%)

Query: 42  EREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQ 101
           E E LL FK  + DP   L++W  + D C W GI C+N +  +V ++L            
Sbjct: 30  ELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSS-RVVSIDL------------ 76

Query: 102 YEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFI-GSMGNLKYLNLSGSRFV 160
                   + GK++ ++  L ++  ++LS N   G PIP  I  +  +L+YLNLS + F 
Sbjct: 77  ----SGKNISGKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFT 131

Query: 161 GMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDWLLVTHML 220
           G IP   G++ +L+ L LS N L        SG    +   FS                 
Sbjct: 132 GSIPR--GSIPNLETLDLSNNML--------SGEIPNDIGSFS----------------- 164

Query: 221 PSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNLGYN 280
            SL  LDL    L    P  + N ++L  L L+ NQ     +P  +  +  L ++ LGYN
Sbjct: 165 -SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQ-IPRELGQMKSLKWIYLGYN 222

Query: 281 NFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMAR 340
           N  G IP  +  LTSL HLDL +N+    IP+ L  L +L++L L  N L G IP S+  
Sbjct: 223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS 282

Query: 341 LCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSL 400
           L  L  L LS   L+ EI E+                             +   +NL+ L
Sbjct: 283 LQKLISLDLSDNSLSGEIPEL-----------------------------VIQLQNLEIL 313

Query: 401 DLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKV 460
            L +N+  G +P +   L  L+VLQL+ NK  G +                         
Sbjct: 314 HLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI------------------------- 348

Query: 461 RRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLY 520
                                   P  L    +L  LDL  + ++G  P  L  S   L+
Sbjct: 349 ------------------------PKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSG-NLF 383

Query: 521 LLDLGHNQIHGEL-TNLTKASQLSFLRLMANNLSGPLPLISSNL---IGLDLSGNSFSGS 576
            L L  N + GE+  +L     L  +RL  N+ SG LP   + L     LD+S N+  G 
Sbjct: 384 KLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGR 443

Query: 577 IFHFLCYTINAGM-KLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGS 635
           I      +    M  LQ L L RN   G LPD + S + L  LDLS N+F G +P   GS
Sbjct: 444 I-----NSRKWDMPSLQMLSLARNKFFGGLPDSFGS-KRLENLDLSRNQFSGAVPRKLGS 497

Query: 636 LSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRS 695
           LS L+ L L +N+LSG +P  L +C  L++LD+  N+  G IP+ F EM  ++  L L  
Sbjct: 498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM-PVLSQLDLSQ 556

Query: 696 NYFHGLLPTKLCDLAFLQILDLADNNLSGTLP 727
           N   G +P  L ++  L  ++++ N+L G+LP
Sbjct: 557 NQLSGEIPKNLGNVESLVQVNISHNHLHGSLP 588

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 974
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.56
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.69
PRK15386426 type III secretion protein GogB; Provisional 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.6
KOG4341483 consensus F-box protein containing LRR [General fu 97.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.49
KOG4341483 consensus F-box protein containing LRR [General fu 97.46
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.46
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.24
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.04
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.86
KOG4308478 consensus LRR-containing protein [Function unknown 94.41
KOG4308478 consensus LRR-containing protein [Function unknown 94.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.22
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.29
smart0037026 LRR Leucine-rich repeats, outliers. 86.29
smart0037026 LRR Leucine-rich repeats, outliers. 85.54
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.54
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.25
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.88
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-71  Score=703.94  Aligned_cols=583  Identities=35%  Similarity=0.564  Sum_probs=406.8

Q ss_pred             CHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceeeCCCCCceEEEEcCCCCccccCCCccccCCCccccccccCcC
Q 002055           39 LESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGKVNPSL  118 (974)
Q Consensus        39 ~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~~~l~~~l  118 (974)
                      +++|+.||++||+++.+|.+.+.+|+.+.+||.|+||+|+. .++|+.|+|+++                .+.|.+++.+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~----------------~i~~~~~~~~   89 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGK----------------NISGKISSAI   89 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCC----------------CccccCChHH
Confidence            35899999999999988887889998788999999999985 679999999983                6777888888


Q ss_pred             cCCCCCCEEECCCCCCCCCCCCcccC-CCCCCCEEeCCCCCCCCCCccccCCCCCCCEEEcCCCCccccCccccCCCCCC
Q 002055          119 LDLKHLSYLDLSFNDFQGVPIPRFIG-SMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFL  197 (974)
Q Consensus       119 ~~l~~L~~L~Ls~n~i~~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L  197 (974)
                      ..+++|++|+|++|.+.+. +|..+. .+++|++|+|++|++++.+|.  +.+++|++|++++|.               
T Consensus        90 ~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~---------------  151 (968)
T PLN00113         90 FRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNM---------------  151 (968)
T ss_pred             hCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCc---------------
Confidence            8889999999998888764 676544 788888888888888776664  234444444444443               


Q ss_pred             CeecCccccCCCcchhHHhhcCCCCCcEEEcCCCCCCCCCCCCCcCCCCCCEEeCCCCCCCCCCChhhhcCCCCCcEEEc
Q 002055          198 EHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLLFLNL  277 (974)
Q Consensus       198 ~~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L~~L~L  277 (974)
                                                         +++..+..++++++|++|++++|.+.+.. |..+.++++|++|++
T Consensus       152 -----------------------------------~~~~~p~~~~~l~~L~~L~L~~n~l~~~~-p~~~~~l~~L~~L~L  195 (968)
T PLN00113        152 -----------------------------------LSGEIPNDIGSFSSLKVLDLGGNVLVGKI-PNSLTNLTSLEFLTL  195 (968)
T ss_pred             -----------------------------------ccccCChHHhcCCCCCEEECccCcccccC-ChhhhhCcCCCeeec
Confidence                                               33333334455555555555555555443 555566666666666


Q ss_pred             cCcccccCCCcccCCCCCCCEEEcCCCCCCCCchhhhhcCCCCCEEECcCCCCCCCchHhhhcCCCCcEEEccCCCCCCc
Q 002055          278 GYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLYLSGAKLNQE  357 (974)
Q Consensus       278 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~  357 (974)
                      ++|.+.+.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+++.+|..++++++|+.|++++|.+.+.
T Consensus       196 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  275 (968)
T PLN00113        196 ASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGP  275 (968)
T ss_pred             cCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeecc
Confidence            66666655666666666666666666666666666666666666666666666666666666666666665555555443


Q ss_pred             chhhhhhhcccCCCCCceeeCCCCCCcccccccccCCCCCCEEeccCccCCCCcccccCCCCCCCEEEccCCcccceech
Q 002055          358 ISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSE  437 (974)
Q Consensus       358 ~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~i~~  437 (974)
                                                   +|..+.++++|++|++++|.+.+.+|..+.++++|+.|++++|.+.+.+|.
T Consensus       276 -----------------------------~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~  326 (968)
T PLN00113        276 -----------------------------IPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV  326 (968)
T ss_pred             -----------------------------CchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh
Confidence                                         333455566666677776666666666666677777777776666544432


Q ss_pred             hhhcCCCCCcEEEcCCccccccccCCCCCcccceeEeccCCCCCCCCCccccCCCCCCEEeCCCCCCcCCcChhHHhhcC
Q 002055          438 IHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSAS  517 (974)
Q Consensus       438 ~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~p~~l~~~~~L~~L~Ls~n~~~~~~p~~~~~~l~  517 (974)
                       .+.                                                .+++|+.|++++|.+.+.+|..+     
T Consensus       327 -~~~------------------------------------------------~l~~L~~L~L~~n~l~~~~p~~l-----  352 (968)
T PLN00113        327 -ALT------------------------------------------------SLPRLQVLQLWSNKFSGEIPKNL-----  352 (968)
T ss_pred             -hHh------------------------------------------------cCCCCCEEECcCCCCcCcCChHH-----
Confidence             122                                                22223333333333332222211     


Q ss_pred             cCceEEeccccccccccccccccccceeeccCccCCCCCCCCCCCCcEEECcCCccccccchhhHHhhhcCCcccccccc
Q 002055          518 QLYLLDLGHNQIHGELTNLTKASQLSFLRLMANNLSGPLPLISSNLIGLDLSGNSFSGSIFHFLCYTINAGMKLQFLFLD  597 (974)
Q Consensus       518 ~L~~L~Ls~n~l~~~~~~l~~~~~L~~L~l~~n~l~~~~p~~~~~L~~L~Ls~n~l~~~~~~~~~~~l~~~~~L~~L~Ls  597 (974)
                                                                                          +.+++|+.|+++
T Consensus       353 --------------------------------------------------------------------~~~~~L~~L~Ls  364 (968)
T PLN00113        353 --------------------------------------------------------------------GKHNNLTVLDLS  364 (968)
T ss_pred             --------------------------------------------------------------------hCCCCCcEEECC
Confidence                                                                                112233344444


Q ss_pred             cccccccCCcccccCCCCCeeeCCCccccccCCccccCCCCccEEEccCCcccccCCcccccCCCCCeEeccCCcccccC
Q 002055          598 RNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNI  677 (974)
Q Consensus       598 ~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  677 (974)
                      +|.+++.+|..+..+++|+.|++++|++.+.+|..++.+++|+.|++++|++++.+|..+.++++|+.|++++|++++.+
T Consensus       365 ~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  444 (968)
T PLN00113        365 TNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI  444 (968)
T ss_pred             CCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCcc
Confidence            44444444444555555555555555555555555555566666666666666555655666666666666666666655


Q ss_pred             chhHHhhhhhhhhhhccCCccccccCccccCCCCCcEEEccCCcCCCCCChhhcccccccccCCCccCccccccCCCccc
Q 002055          678 PSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTY  757 (974)
Q Consensus       678 p~~~~~~~~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~  757 (974)
                      |..+. .+++|+.|++++|++.+.+|..+ ..++|+.||+++|+++|.+|..+.++++|                     
T Consensus       445 ~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L---------------------  501 (968)
T PLN00113        445 NSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL---------------------  501 (968)
T ss_pred             Chhhc-cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhcc---------------------
Confidence            55544 45566666666666666666544 34789999999999999999887766655                     


Q ss_pred             cccccceeeEEEEecccchhhhccceeeEEEeccccceecCCcccccccCCCEEEccCceeeeeccccccccCCCCEEEC
Q 002055          758 ALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDF  837 (974)
Q Consensus       758 ~~~~~~~~~~~~~~~~~~~~~~~l~~l~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~LdL  837 (974)
                                                 +.|||++|+++|.+|..++++++|++|+|++|+++|.+|..++.+++|+.|||
T Consensus       502 ---------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L  554 (968)
T PLN00113        502 ---------------------------MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL  554 (968)
T ss_pred             ---------------------------CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEEC
Confidence                                       68999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCccccCCCCCCeeecccCeeeecCCCCcccCcccccccCCC-CCCCCC
Q 002055          838 SVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCFLGN-NLCGAP  893 (974)
Q Consensus       838 s~N~l~g~iP~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~~n-~lcg~~  893 (974)
                      ++|+++|.+|..+.++++|++|++++|+++|.||..+++.++..++|.|| .+||.+
T Consensus       555 s~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        555 SQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999999999999999999 899865

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query974
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-45
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-45
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-18
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 8e-09
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 1e-08
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 8e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-08
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-08
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-05
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 9e-07
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-06
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-05
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  182 bits (461), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 209/740 (28%), Positives = 300/740 (40%), Gaps = 167/740 (22%)
Query: 245 STLTTLDLSHNQFDNSFVPSWVFG-LSHLLFLNLGYN--NFHGPIPEGLQSLTSLKHLDL 301
           ++LT+LDLS N            G  S L FLN+  N  +F G +  GL+ L SL+ LDL
Sbjct: 100 ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLK-LNSLEVLDL 158
Query: 302 SFNHFNSSIPNLLCRXXXXXXXXXXXXXXEGRIPRSMARLC-NLKRLYLSGAKLNQEISE 360
           S N  + +                        +   ++  C  LK L +SG K++ ++  
Sbjct: 159 SANSISGA----------------------NVVGWVLSDGCGELKHLAISGNKISGDVD- 195
Query: 361 ILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSS 420
                S CV                          NL+ LD+S+N+    +P   G  S+
Sbjct: 196 ----VSRCV--------------------------NLEFLDVSSNNFSTGIP-FLGDCSA 224
Query: 421 LRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNV 480
           L+ L +  NKL G  S       T+L +  +  N          IPP  L          
Sbjct: 225 LQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFV-----GPIPPLPL---------- 268
Query: 481 GSRFPLWLYSQKDLQFLDLFNSGISGTFPNRLLKSASQLYLLDLGHNQIHGE-------- 532
                      K LQ+L L  +  +G  P+ L  +   L  LDL  N  +G         
Sbjct: 269 -----------KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 317
Query: 533 ------------------LTNLTKASQLSFLRLMANNLSGPLPL----ISSNLIGLDLSG 570
                             +  L K   L  L L  N  SG LP     +S++L+ LDLS 
Sbjct: 318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 377
Query: 571 NSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLP 630
           N+FSG I   LC   N    LQ L+L  N   G +P    +   L+ L LS N   G +P
Sbjct: 378 NNFSGPILPNLCQ--NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 435
Query: 631 TSFGSLSSLVSLHL------------------------RKNRLSGTMPISLKNCTSLMTL 666
           +S GSLS L  L L                          N L+G +P  L NCT+L  +
Sbjct: 436 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWI 495
Query: 667 DVGENEFFGNIPSWFGEMFSIMVFLILRSNYFHGLLPTKLCDLAFLQILDLADNNLSGTL 726
            +  N   G IP W G + ++ + L L +N F G +P +L D   L  LDL  N  +GT+
Sbjct: 496 SLSNNRLTGEIPKWIGRLENLAI-LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI 554
Query: 727 PNCIHNLTAMATVNPFTGNA---IKYSIPLNSTYALGSVTEQALV--------------- 768
           P  +   +     N   G     IK        +  G++ E   +               
Sbjct: 555 PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN 614
Query: 769 ----VMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTNLKALQSLNLSYNIFTGRIPE 824
               V  G  +   +    +  +D+S N  SG +P  + ++  L  LNL +N  +G IP+
Sbjct: 615 ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPD 674
Query: 825 TIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSFNASCF 884
            +G +R L  +D S NK  G IPQ+MS+LT L  ++LSNN L+G IP   Q ++F  + F
Sbjct: 675 EVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKF 734
Query: 885 LGN-NLCGAPLPKNCTDENV 903
           L N  LCG PLP+ C   N 
Sbjct: 735 LNNPGLCGYPLPR-CDPSNA 753
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query974
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-83
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-72
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-65
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-59
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-62
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-40
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-52
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-52
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-50
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-42
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-35
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-40
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-30
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-30
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-06
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  575 bits (1485), Expect = 0.0
 Identities = 229/878 (26%), Positives = 340/878 (38%), Gaps = 146/878 (16%)

Query: 37  GCLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYY 96
             L  E   L+ FK  L D +  L  W  N++ C + G+ C +    +  ++L +     
Sbjct: 8   QSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCRD--DKVTSIDLSS----- 59

Query: 97  VQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSG 156
                    P ++    V+ SLL L  L  L LS +   G  +  F     +L  L+LS 
Sbjct: 60  --------KPLNVGFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSASLTSLDLSR 109

Query: 157 SRFVGMIP--HQLGNLSSLQYLVLSRNFLHLV-NFGWLSGLSFLEHLDFSYVNLSKA-SD 212
           +   G +     LG+ S L++L +S N L           L+ LE LD S  ++S A   
Sbjct: 110 NSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVV 169

Query: 213 WLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHL 272
             +++     L  L +S  ++     + V+    L  LD+S N F ++ +P  +   S L
Sbjct: 170 GWVLSDGCGELKHLAISGNKIS--GDVDVSRCVNLEFLDVSSNNF-STGIPF-LGDCSAL 225

Query: 273 LFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEG 332
             L++  N   G     + + T LK L++S N F   IP     L  L++LSL+ N   G
Sbjct: 226 QHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYLSLAENKFTG 283

Query: 333 RIPRSMARLCNLKRLYLSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIG 392
            IP                                               + G       
Sbjct: 284 EIP---------------------------------------------DFLSGACD---- 294

Query: 393 LFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYRNKLHGTLSEIHFVNLTKLSVFLVG 452
               L  LDLS N   G VP  FG  S L  L L  N   G L     + +  L V  + 
Sbjct: 295 ---TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS 351

Query: 453 ENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYS-QKDLQFLDLFNSGISGTFPNR 511
            N  +                           P  L +    L  LDL ++  SG     
Sbjct: 352 FNEFS------------------------GELPESLTNLSASLLTLDLSSNNFSGPILPN 387

Query: 512 LLKS-ASQLYLLDLGHNQIHGEL-TNLTKASQLSFLRLMANNLSGPLPL---ISSNLIGL 566
           L ++  + L  L L +N   G++   L+  S+L  L L  N LSG +P      S L  L
Sbjct: 388 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 447

Query: 567 DLSGNSFSGSIFHFLCYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFI 626
            L  N   G I   L Y       L+ L LD N L G +P    +  NL  + LSNN+  
Sbjct: 448 KLWLNMLEGEIPQELMY----VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT 503

Query: 627 GNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCTSLMTLDVGENEFFGNIPSWFGEMFS 686
           G +P   G L +L  L L  N  SG +P  L +C SL+ LD+  N F G IP+   +   
Sbjct: 504 GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS- 562

Query: 687 IMVFLILRSNYFHGLLPTKLCDLAFLQILDLADN--NLSGTLPNCIHNLTAMATVNPFTG 744
                 + +N+  G     + +    +    A N     G     ++ L+     N  T 
Sbjct: 563 ----GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN-ITS 617

Query: 745 NAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLPIGLTN 804
                                             +    +  +D+S N  SG +P  + +
Sbjct: 618 RVYGGHTS-----------------------PTFDNNGSMMFLDMSYNMLSGYIPKEIGS 654

Query: 805 LKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNN 864
           +  L  LNL +N  +G IP+ +G +R L  +D S NK  G IPQ+MS+LT L  ++LSNN
Sbjct: 655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN 714

Query: 865 YLTGKIPSSTQLQSFNASCFLGN-NLCGAPLPKNCTDE 901
            L+G IP   Q ++F  + FL N  LCG PLP+     
Sbjct: 715 NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSN 752
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query974
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.43
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.98
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.71
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.6
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.69
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.38
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.28
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-91  Score=863.81  Aligned_cols=704  Identities=32%  Similarity=0.442  Sum_probs=476.6

Q ss_pred             CCHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceeeCCCCCceEEEEcCCCCccccCCCccccCCCcccccc---c
Q 002055           38 CLESEREALLRFKQDLQDPSYRLASWIGNRDCCAWAGIFCDNVTGHIVELNLRNPFTYYVQPDQYEANPRSMLVGK---V  114 (974)
Q Consensus        38 ~~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~~~---l  114 (974)
                      +.++|++||++||+++.||. .+++|+.+++||.|+||+|+  .+||++|+|++.                .+.|.   +
T Consensus         9 ~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~----------------~l~g~~~~l   69 (768)
T 3rgz_A            9 SLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSK----------------PLNVGFSAV   69 (768)
T ss_dssp             CHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTS----------------CCCEEHHHH
T ss_pred             CCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCC----------------CcCCccCcc
Confidence            45789999999999999988 89999888999999999998  689999999984                77787   8


Q ss_pred             cCcCcCCCCCCEEECCCCCCCCCCCCcccCCCCCCCEEeCCCCCCCCCCcc--ccCCCCCCCEEEcCCCCccccCcccc-
Q 002055          115 NPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPH--QLGNLSSLQYLVLSRNFLHLVNFGWL-  191 (974)
Q Consensus       115 ~~~l~~l~~L~~L~Ls~n~i~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~--~~~~l~~L~~L~Ls~n~i~~~~~~~l-  191 (974)
                      |+++.++++|+.++++.+.+..  +|..++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+....+..+ 
T Consensus        70 ~~~l~~L~~L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~  147 (768)
T 3rgz_A           70 SSSLLSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGG  147 (768)
T ss_dssp             HHHTTTCTTCCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSC
T ss_pred             ChhHhccCcccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHh
Confidence            9999999999999999998753  678899999999999999999998888  89999999999999887764433322 


Q ss_pred             CCCCCCCeecCccccCCCcchhHHhhcCCCCCcEEEcCCCCCCCCCCCC---CcCCCCCCEEeCCCCCCCCCCChhhhcC
Q 002055          192 SGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLP---VANFSTLTTLDLSHNQFDNSFVPSWVFG  268 (974)
Q Consensus       192 ~~l~~L~~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~~l~~  268 (974)
                      .++++|++|++++|.++                          +..+..   +.++++|++|++++|.+++.. +  +..
T Consensus       148 ~~l~~L~~L~Ls~n~l~--------------------------~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~-~--~~~  198 (768)
T 3rgz_A          148 LKLNSLEVLDLSANSIS--------------------------GANVVGWVLSDGCGELKHLAISGNKISGDV-D--VSR  198 (768)
T ss_dssp             CCCTTCSEEECCSSCCE--------------------------EETHHHHHHTTCCTTCCEEECCSSEEESCC-B--CTT
T ss_pred             ccCCCCCEEECCCCccC--------------------------CcCChhhhhhccCCCCCEEECCCCcccccC-C--ccc
Confidence            33333333333333332                          222222   344555555555555554422 1  244


Q ss_pred             CCCCcEEEccCcccccCCCcccCCCCCCCEEEcCCCCCCCCchhhhhcCCCCCEEECcCCCCCCCchHhhhcCCCCcEEE
Q 002055          269 LSHLLFLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLY  348 (974)
Q Consensus       269 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~  348 (974)
                      +++|++|++++|.+++.+|. ++++++|++|++++|.+++.+|..++++++|++|++++|.+++.+|..  .+++     
T Consensus       199 l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~-----  270 (768)
T 3rgz_A          199 CVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKS-----  270 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTT-----
T ss_pred             CCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCC-----
Confidence            55555555555555544444 555555555555555555555555555555555555555554444332  3444     


Q ss_pred             ccCCCCCCcchhhhhhhcccCCCCCceeeCCCCCCcccccccccCC-CCCCEEeccCccCCCCcccccCCCCCCCEEEcc
Q 002055          349 LSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLF-KNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLY  427 (974)
Q Consensus       349 L~~n~l~~~~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~  427 (974)
                                              |++|++++|.+.+.+|..+... ++|++|++++|.+++.+|..++++++|++|+++
T Consensus       271 ------------------------L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~  326 (768)
T 3rgz_A          271 ------------------------LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS  326 (768)
T ss_dssp             ------------------------CCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECC
T ss_pred             ------------------------CCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECC
Confidence                                    5555555555555555555443 666666666666666666666666666666666


Q ss_pred             CCcccceechhhhcCCCCCcEEEcCCccccccccCCCCCcccceeEeccCCCCCCCCCccccCCC-CCCEEeCCCCCCcC
Q 002055          428 RNKLHGTLSEIHFVNLTKLSVFLVGENTLTLKVRRDWIPPFQLIELGLRSCNVGSRFPLWLYSQK-DLQFLDLFNSGISG  506 (974)
Q Consensus       428 ~n~l~~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~p~~l~~~~-~L~~L~Ls~n~~~~  506 (974)
                      +|+++|.+|...+.++++|+.|++++|.+....+.                        .+..++ +|++|++++|++.+
T Consensus       327 ~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~------------------------~l~~l~~~L~~L~Ls~N~l~~  382 (768)
T 3rgz_A          327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE------------------------SLTNLSASLLTLDLSSNNFSG  382 (768)
T ss_dssp             SSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCT------------------------THHHHTTTCSEEECCSSEEEE
T ss_pred             CCcccCcCCHHHHhcCCCCCEEeCcCCccCccccH------------------------HHHhhhcCCcEEEccCCCcCC
Confidence            66666666654466666666666665555433222                        222222 33333333333333


Q ss_pred             CcChhHHhh-cCcCceEEecccccccccc-ccccccccceeeccCccCCCCCCCC---CCCCcEEECcCCccccccchhh
Q 002055          507 TFPNRLLKS-ASQLYLLDLGHNQIHGELT-NLTKASQLSFLRLMANNLSGPLPLI---SSNLIGLDLSGNSFSGSIFHFL  581 (974)
Q Consensus       507 ~~p~~~~~~-l~~L~~L~Ls~n~l~~~~~-~l~~~~~L~~L~l~~n~l~~~~p~~---~~~L~~L~Ls~n~l~~~~~~~~  581 (974)
                      .+|..+... +++|++|++++|.+++.+| .+..+++|+.|++++|.+++.+|..   +++|+.|++++|++++.+|.  
T Consensus       383 ~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~--  460 (768)
T 3rgz_A          383 PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ--  460 (768)
T ss_dssp             ECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCG--
T ss_pred             CcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCH--
Confidence            333322211 2334444444444443333 3344444444444444444443332   23445555555555544442  


Q ss_pred             HHhhhcCCcccccccccccccccCCcccccCCCCCeeeCCCccccccCCccccCCCCccEEEccCCcccccCCcccccCC
Q 002055          582 CYTINAGMKLQFLFLDRNILQGNLPDCWMSYQNLMMLDLSNNKFIGNLPTSFGSLSSLVSLHLRKNRLSGTMPISLKNCT  661 (974)
Q Consensus       582 ~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~  661 (974)
                        .+..+++|++|++++|.+++.+|..+.++++|++|++++|++++.+|.+++.+++|++|++++|+++|.+|..+++++
T Consensus       461 --~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~  538 (768)
T 3rgz_A          461 --ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCR  538 (768)
T ss_dssp             --GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCT
T ss_pred             --HHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCC
Confidence              344567788888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             CCCeEeccCCcccccCchhHHhhhhhhhhhhccC-Cc---------------------cccccCccccCCCCCcEEEccC
Q 002055          662 SLMTLDVGENEFFGNIPSWFGEMFSIMVFLILRS-NY---------------------FHGLLPTKLCDLAFLQILDLAD  719 (974)
Q Consensus       662 ~L~~L~Ls~N~l~~~~p~~~~~~~~~L~~L~L~~-N~---------------------l~~~~p~~l~~l~~L~~L~Ls~  719 (974)
                      +|+.|++++|+++|.+|.++.. ...+..+.+.. +.                     +.|..|..+..++.++.++++.
T Consensus       539 ~L~~L~Ls~N~l~g~ip~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~  617 (768)
T 3rgz_A          539 SLIWLDLNTNLFNGTIPAAMFK-QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS  617 (768)
T ss_dssp             TCCEEECCSSEEESBCCGGGGT-TTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTS
T ss_pred             CCCEEECCCCccCCcCChHHhc-ccchhhhhccccccccccccccccccccccccccccccccchhhhcccccccccccc
Confidence            8888888888888888877763 33333333322 11                     2233333333444444444444


Q ss_pred             CcCCCCCChhhcccccccccCCCccCccccccCCCccccccccceeeEEEEecccchhhhccceeeEEEeccccceecCC
Q 002055          720 NNLSGTLPNCIHNLTAMATVNPFTGNAIKYSIPLNSTYALGSVTEQALVVMKGVAADYSEILNLVRIIDVSKNFFSGTLP  799 (974)
Q Consensus       720 N~l~g~ip~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~LdLs~N~l~g~ip  799 (974)
                      |.++|.+|..++                                                .++.|+.||||+|+++|.||
T Consensus       618 ~~~~g~~~~~~~------------------------------------------------~l~~L~~LdLs~N~l~g~ip  649 (768)
T 3rgz_A          618 RVYGGHTSPTFD------------------------------------------------NNGSMMFLDMSYNMLSGYIP  649 (768)
T ss_dssp             CEEEEECCCSCS------------------------------------------------SSBCCCEEECCSSCCBSCCC
T ss_pred             ceecccCchhhh------------------------------------------------ccccccEEECcCCcccccCC
Confidence            444444444433                                                34455899999999999999


Q ss_pred             cccccccCCCEEEccCceeeeeccccccccCCCCEEECCCCcccccCCccccCCCCCCeeecccCeeeecCCCCcccCcc
Q 002055          800 IGLTNLKALQSLNLSYNIFTGRIPETIGAMRSLESIDFSVNKFTGEIPQSMSSLTFLNHLNLSNNYLTGKIPSSTQLQSF  879 (974)
Q Consensus       800 ~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~LdLs~N~l~g~iP~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~  879 (974)
                      .+++++++|+.|||++|+++|.||++++++++|++||||+|+++|.||.+++++++|++||+|+|+++|+||.+++|++|
T Consensus       650 ~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~  729 (768)
T 3rgz_A          650 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETF  729 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGS
T ss_pred             HHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCC-CCCCCCCCCCCCCC
Q 002055          880 NASCFLGN-NLCGAPLPKNCTDE  901 (974)
Q Consensus       880 ~~~~~~~n-~lcg~~~~~~c~~~  901 (974)
                      +..+|.|| +|||.|+. .|...
T Consensus       730 ~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          730 PPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             CGGGGCSCTEEESTTSC-CCCSC
T ss_pred             CHHHhcCCchhcCCCCc-CCCCC
Confidence            99999999 99999987 78643
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 974
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 97.5 bits (241), Expect = 1e-22
 Identities = 72/318 (22%), Positives = 116/318 (36%), Gaps = 24/318 (7%)

Query: 38  CLESEREALLRFKQDLQDPSYRLASWIGNRDCC--AWAGIFCDN--VTGHIVELNLRNPF 93
           C   +++ALL+ K+DL +P+  L+SW+   DCC   W G+ CD    T  +  L+L    
Sbjct: 3   CNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 94  TYYVQPDQYEANPRSMLVGKVNPSLLDLKHLSYLDLSFNDFQGVPIPRFIGSMGNLKYLN 153
                P              +  SL +L +L++L +   +    PIP  I  +  L YL 
Sbjct: 62  LPKPYP--------------IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY 107

Query: 154 LSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFGWLSGLSFLEHLDFSYVNLSKASDW 213
           ++ +   G IP  L  + +L  L  S N L       +S L  L  + F   N    +  
Sbjct: 108 ITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG-NRISGAIP 166

Query: 214 LLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGLSHLL 273
                       + +S  +L    P   AN +        +    ++ V           
Sbjct: 167 DSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSD---KNT 223

Query: 274 FLNLGYNNFHGPIPEGLQSLTSLKHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGR 333
                  N        +    +L  LDL  N    ++P  L +L  L  L++S N+L G 
Sbjct: 224 QKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE 283

Query: 334 IPRSMARLCNLKRLYLSG 351
           IP     L        + 
Sbjct: 284 IP-QGGNLQRFDVSAYAN 300
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query974
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.76
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3e-37  Score=335.99  Aligned_cols=293  Identities=31%  Similarity=0.521  Sum_probs=184.1

Q ss_pred             CCCHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCcc--ccceeeCCCC--CceEEEEcCCCCccccCCCccccCCCccccc
Q 002055           37 GCLESEREALLRFKQDLQDPSYRLASWIGNRDCCA--WAGIFCDNVT--GHIVELNLRNPFTYYVQPDQYEANPRSMLVG  112 (974)
Q Consensus        37 ~~~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~~  112 (974)
                      -|.++||+||++||+++.+|. .+++|..++|||.  |+||+|+..+  +||++|+|++.                .+.|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~----------------~l~g   64 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL----------------NLPK   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC----------------CCSS
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC----------------CCCC
Confidence            399999999999999999874 6899998899994  9999998643  48999999884                4544


Q ss_pred             --cccCcCcCCCCCCEEECCC-CCCCCCCCCcccCCCCCCCEEeCCCCCCCCCCccccCCCCCCCEEEcCCCCccccCcc
Q 002055          113 --KVNPSLLDLKHLSYLDLSF-NDFQGVPIPRFIGSMGNLKYLNLSGSRFVGMIPHQLGNLSSLQYLVLSRNFLHLVNFG  189 (974)
Q Consensus       113 --~l~~~l~~l~~L~~L~Ls~-n~i~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~i~~~~~~  189 (974)
                        .+|++++++++|++|+|++ |++++. +|..++++++|++|+|++|++.+..+..+.++.+|+++++++|.+      
T Consensus        65 ~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~------  137 (313)
T d1ogqa_          65 PYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL------  137 (313)
T ss_dssp             CEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE------
T ss_pred             CCCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccc------
Confidence              4566777777777777765 556553 666666666666666666666655555554444444444443322      


Q ss_pred             ccCCCCCCCeecCccccCCCcchhHHhhcCCCCCcEEEcCCCCCCCCCCCCCcCCCCCCEEeCCCCCCCCCCChhhhcCC
Q 002055          190 WLSGLSFLEHLDFSYVNLSKASDWLLVTHMLPSLVELDLSNCQLHIFPPLPVANFSTLTTLDLSHNQFDNSFVPSWVFGL  269 (974)
Q Consensus       190 ~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~l  269 (974)
                                                                                          .+.. |..+..+
T Consensus       138 --------------------------------------------------------------------~~~~-p~~l~~l  148 (313)
T d1ogqa_         138 --------------------------------------------------------------------SGTL-PPSISSL  148 (313)
T ss_dssp             --------------------------------------------------------------------ESCC-CGGGGGC
T ss_pred             --------------------------------------------------------------------cccC-chhhccC
Confidence                                                                                2222 4445555


Q ss_pred             CCCcEEEccCcccccCCCcccCCCCCC-CEEEcCCCCCCCCchhhhhcCCCCCEEECcCCCCCCCchHhhhcCCCCcEEE
Q 002055          270 SHLLFLNLGYNNFHGPIPEGLQSLTSL-KHLDLSFNHFNSSIPNLLCRLTHLEHLSLSHNSLEGRIPRSMARLCNLKRLY  348 (974)
Q Consensus       270 ~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~  348 (974)
                      ++++++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ .++++.+...+.+|..+..+++++.++
T Consensus       149 ~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~  227 (313)
T d1ogqa_         149 PNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIH  227 (313)
T ss_dssp             TTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEE
T ss_pred             cccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccc
Confidence            555555555555555555555555543 556666666665555555555433 566666666666666666666666666


Q ss_pred             ccCCCCCCcchhhhhhhcccCCCCCceeeCCCCCCcccccccccCCCCCCEEeccCccCCCCcccccCCCCCCCEEEccC
Q 002055          349 LSGAKLNQEISEILDIFSGCVPNGLESLVLPNSSIFGHLTDQIGLFKNLDSLDLSNNSIVGLVPQSFGRLSSLRVLQLYR  428 (974)
Q Consensus       349 L~~n~l~~~~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  428 (974)
                      +++|.+.+.++.                              ++.+++|+.|++++|+++|.+|..++++++|++|+|++
T Consensus       228 ~~~~~l~~~~~~------------------------------~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~  277 (313)
T d1ogqa_         228 LAKNSLAFDLGK------------------------------VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSF  277 (313)
T ss_dssp             CCSSEECCBGGG------------------------------CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccc------------------------------cccccccccccCccCeecccCChHHhCCCCCCEEECcC
Confidence            666655443332                              34445566666666666655666666666666666666


Q ss_pred             CcccceechhhhcCCCCCcEEEcCCcc
Q 002055          429 NKLHGTLSEIHFVNLTKLSVFLVGENT  455 (974)
Q Consensus       429 n~l~~~i~~~~~~~l~~L~~L~l~~n~  455 (974)
                      |+++|.+|.  +.++++|+.+++++|+
T Consensus       278 N~l~g~iP~--~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         278 NNLCGEIPQ--GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             SEEEEECCC--STTGGGSCGGGTCSSS
T ss_pred             CcccccCCC--cccCCCCCHHHhCCCc
Confidence            666666653  3455566666665554
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure