Citrus Sinensis ID: 002073
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 972 | 2.2.26 [Sep-21-2011] | |||||||
| P93028 | 1080 | Ubiquitin-activating enzy | yes | no | 0.904 | 0.813 | 0.789 | 0.0 | |
| P92974 | 1077 | Ubiquitin-activating enzy | no | no | 0.891 | 0.805 | 0.791 | 0.0 | |
| P31251 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.834 | 0.771 | 0.791 | 0.0 | |
| P20973 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.834 | 0.771 | 0.791 | 0.0 | |
| P31252 | 1053 | Ubiquitin-activating enzy | N/A | no | 0.834 | 0.770 | 0.765 | 0.0 | |
| A3KMV5 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.855 | 0.786 | 0.460 | 0.0 | |
| P22314 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.855 | 0.786 | 0.464 | 0.0 | |
| Q29504 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.855 | 0.786 | 0.461 | 0.0 | |
| Q5U300 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.863 | 0.793 | 0.446 | 0.0 | |
| P31254 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.865 | 0.794 | 0.442 | 0.0 |
| >sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1456 bits (3770), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 708/897 (78%), Positives = 792/897 (88%), Gaps = 18/897 (2%)
Query: 69 KRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATADSNNNSSSSSSNNVVTG 128
KRASE A + ++ I + +++KK RI T S++ SSS ++ G
Sbjct: 4 KRASE------------ANDKNDNTIIGSDLASSKKRRIDFTESSSDKSSSILASGSSRG 51
Query: 129 KEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQG 188
G+ S+ + M GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM G
Sbjct: 52 FHGD------SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHG 105
Query: 189 LGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAV 248
LGAEIAKNLILAGVKSVTLHDE VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAV
Sbjct: 106 LGAEIAKNLILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAV 165
Query: 249 VLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFC 308
V+S+LT L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFC
Sbjct: 166 VVSSLTKSLNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFC 225
Query: 309 DFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELN 368
DFGPEF V+DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELN
Sbjct: 226 DFGPEFAVLDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELN 285
Query: 369 DGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLS 428
DGKPRKIKS RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL S
Sbjct: 286 DGKPRKIKSTRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFS 345
Query: 429 DFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDIN 488
DFSKFDRPP LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN GD +VE+++
Sbjct: 346 DFSKFDRPPLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVD 405
Query: 489 TKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDS 548
KLLRHF+FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS
Sbjct: 406 QKLLRHFSFGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDS 465
Query: 549 TEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLT 608
++F P NSRYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT
Sbjct: 466 SDFAPRNSRYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLT 525
Query: 609 ITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFD 668
+TDDD+IEKSNLSRQFLFRDWNIGQAKSTVAASAA INPR NIEALQNRVG ETENVFD
Sbjct: 526 VTDDDIIEKSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFD 585
Query: 669 DTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGAS 728
D FWEN+T V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGAS
Sbjct: 586 DAFWENLTVVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGAS 645
Query: 729 RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAG 788
RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AG
Sbjct: 646 RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAG 705
Query: 789 DAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAP 848
DAQARD LER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAP
Sbjct: 706 DAQARDTLERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAP 765
Query: 849 FWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVP 908
FWSAPKRFP PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK AEAVD+V+VP
Sbjct: 766 FWSAPKRFPRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVP 825
Query: 909 DFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEK 965
DF P++DAKI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL FR+KPIQFEK
Sbjct: 826 DFEPRQDAKIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEK 882
|
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP. Arabidopsis thaliana (taxid: 3702) |
| >sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Ube1ay PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 972 | ||||||
| 359478703 | 1100 | PREDICTED: ubiquitin-activating enzyme E | 0.920 | 0.813 | 0.835 | 0.0 | |
| 356498972 | 1106 | PREDICTED: ubiquitin-activating enzyme E | 0.931 | 0.818 | 0.834 | 0.0 | |
| 255571336 | 1107 | ubiquitin-activating enzyme E1, putative | 0.934 | 0.820 | 0.825 | 0.0 | |
| 356553102 | 1108 | PREDICTED: ubiquitin-activating enzyme E | 0.932 | 0.817 | 0.829 | 0.0 | |
| 357491029 | 1180 | Ubiquitin-activating enzyme E1 [Medicago | 0.921 | 0.759 | 0.809 | 0.0 | |
| 357491027 | 1179 | Ubiquitin-activating enzyme E1 [Medicago | 0.914 | 0.754 | 0.814 | 0.0 | |
| 356537581 | 1154 | PREDICTED: ubiquitin-activating enzyme E | 0.980 | 0.825 | 0.776 | 0.0 | |
| 359481277 | 1111 | PREDICTED: ubiquitin-activating enzyme E | 0.924 | 0.809 | 0.810 | 0.0 | |
| 224103881 | 907 | predicted protein [Populus trichocarpa] | 0.921 | 0.987 | 0.811 | 0.0 | |
| 449450834 | 1152 | PREDICTED: ubiquitin-activating enzyme E | 0.922 | 0.778 | 0.799 | 0.0 |
| >gi|359478703|ref|XP_002275617.2| PREDICTED: ubiquitin-activating enzyme E1 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1588 bits (4112), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 768/919 (83%), Positives = 833/919 (90%), Gaps = 24/919 (2%)
Query: 53 GFCVVFGSLLHYMLPRKRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATAD 112
GFC VF SLLHYMLPRKRA G VV ++++ N +S+ KKHRIS++A
Sbjct: 2 GFCGVFSSLLHYMLPRKRAVAGEVV-DDDSDNTG------------TSSIKKHRISSSAA 48
Query: 113 ------SNNNSSSSSSNNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLA 166
+NNNS SS NN NHS S E+ IM LG+ + DIDEDLHSRQLA
Sbjct: 49 GTETTVNNNNSGSSLGNN----SGNSNHS-GGSEVELQIMALGDGHPPDIDEDLHSRQLA 103
Query: 167 VYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSD 226
VYGRETMRRLFASN+LVSG+QGLGAEIAKNLILAGVKSVTLHDEGTVELWD+SSNF+FS+
Sbjct: 104 VYGRETMRRLFASNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGTVELWDMSSNFIFSE 163
Query: 227 NDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCH 286
ND+GKNRALASVQKLQELNNAVV+STLT+KLTKE LSDFQAVVFTDI +KAIEF+D+CH
Sbjct: 164 NDVGKNRALASVQKLQELNNAVVISTLTTKLTKEDLSDFQAVVFTDIYFEKAIEFNDYCH 223
Query: 287 NHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDE 346
+HQP I+FIKAEVRGLFGSVFCDFGPEFTV DVDGE+PHTGIIASISNDNPALVSCVDDE
Sbjct: 224 SHQPPIAFIKAEVRGLFGSVFCDFGPEFTVFDVDGEEPHTGIIASISNDNPALVSCVDDE 283
Query: 347 RLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQ 406
RLEFQDGDLVVFSEVHGMTELNDGKPRKIK+ARPYSFTLEEDTTN+GTY KGGIVTQVKQ
Sbjct: 284 RLEFQDGDLVVFSEVHGMTELNDGKPRKIKNARPYSFTLEEDTTNFGTYEKGGIVTQVKQ 343
Query: 407 PKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQ 466
PKVLNFKPLREAL DPGDFLLSDFSKFDRPP LHLAFQALD+F+SELGRFPVAGSEEDAQ
Sbjct: 344 PKVLNFKPLREALSDPGDFLLSDFSKFDRPPLLHLAFQALDRFISELGRFPVAGSEEDAQ 403
Query: 467 KLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF 526
KLI +++NINE LGDG++EDIN KLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF
Sbjct: 404 KLIFISSNINEGLGDGKLEDINPKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF 463
Query: 527 HPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGAL 586
HPL+QFFYFDSVESLPTE DS++FKP+NSRYDAQISVFG+KLQKKLEDA VF+VGSGAL
Sbjct: 464 HPLFQFFYFDSVESLPTEAPDSSDFKPLNSRYDAQISVFGSKLQKKLEDAVVFMVGSGAL 523
Query: 587 GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSI 646
GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAA +I
Sbjct: 524 GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAAQTI 583
Query: 647 NPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESG 706
NP L+IEALQNRVGPETENVF+D FWEN++ VINALDNVNARLYVDQRCLYFQKPLLESG
Sbjct: 584 NPCLHIEALQNRVGPETENVFNDAFWENLSVVINALDNVNARLYVDQRCLYFQKPLLESG 643
Query: 707 TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT 766
TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT
Sbjct: 644 TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT 703
Query: 767 PAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYF 826
PAEVNA+LSNP EY ++M NAGDAQARDNLERVLECL++E+CE FQDCITWARL+FEDYF
Sbjct: 704 PAEVNAFLSNPTEYASAMRNAGDAQARDNLERVLECLERERCETFQDCITWARLRFEDYF 763
Query: 827 SNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGI 886
NRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFS+AD HL+FVMAASILRAETFGI
Sbjct: 764 VNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSAADAGHLYFVMAASILRAETFGI 823
Query: 887 PIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLE 946
PIPDW +PK LAEAVDKV+VP+F PK D KI+TDEKAT+LSTASVDDAAVIN+L+ K+E
Sbjct: 824 PIPDWAKHPKKLAEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKIE 883
Query: 947 QCRKNLPSGFRLKPIQFEK 965
Q K+LP GFR+ PIQFEK
Sbjct: 884 QSWKSLPPGFRMNPIQFEK 902
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356498972|ref|XP_003518319.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255571336|ref|XP_002526617.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223534057|gb|EEF35776.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356553102|ref|XP_003544897.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357491029|ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517137|gb|AES98760.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357491027|ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517136|gb|AES98759.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356537581|ref|XP_003537305.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359481277|ref|XP_002267395.2| PREDICTED: ubiquitin-activating enzyme E1 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224103881|ref|XP_002313230.1| predicted protein [Populus trichocarpa] gi|222849638|gb|EEE87185.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449450834|ref|XP_004143167.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] gi|449519322|ref|XP_004166684.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 972 | ||||||
| TAIR|locus:2060854 | 1080 | UBA1 "ubiquitin-activating enz | 0.907 | 0.816 | 0.777 | 0.0 | |
| TAIR|locus:2164270 | 1077 | UBA 2 "ubiquitin activating en | 0.891 | 0.805 | 0.778 | 0.0 | |
| UNIPROTKB|A3KMV5 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.848 | 0.779 | 0.463 | 5e-202 | |
| UNIPROTKB|P22314 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.848 | 0.779 | 0.466 | 5.8e-201 | |
| UNIPROTKB|K7GRY0 | 970 | UBA1 "Uncharacterized protein" | 0.848 | 0.850 | 0.459 | 5.2e-200 | |
| UNIPROTKB|F1RWX8 | 1058 | UBA1 "Uncharacterized protein" | 0.849 | 0.780 | 0.458 | 1.1e-199 | |
| UNIPROTKB|E2RGH5 | 1057 | UBA1 "Uncharacterized protein" | 0.844 | 0.776 | 0.457 | 2.9e-197 | |
| UNIPROTKB|J9P920 | 858 | UBA1 "Uncharacterized protein" | 0.840 | 0.952 | 0.456 | 1.3e-196 | |
| RGD|1359327 | 1058 | Uba1 "ubiquitin-like modifier | 0.848 | 0.779 | 0.453 | 5.5e-196 | |
| ZFIN|ZDB-GENE-040426-2009 | 1058 | uba1 "ubiquitin-like modifier | 0.845 | 0.776 | 0.452 | 1.7e-194 |
| TAIR|locus:2060854 UBA1 "ubiquitin-activating enzyme 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3654 (1291.3 bits), Expect = 0., P = 0.
Identities = 691/889 (77%), Positives = 774/889 (87%)
Query: 77 VVNEETQNAAQESQNDIEIANASSATKKHRISATADXXXXXXXXXXXXVVTGKEGENHSI 136
++++ A ++ N I I + +++KK RI T G G+
Sbjct: 1 MLHKRASEANDKNDNTI-IGSDLASSKKRRIDFTESSSDKSSSILASGSSRGFHGD---- 55
Query: 137 SASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKN 196
S+ + M GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM GLGAEIAKN
Sbjct: 56 --SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKN 113
Query: 197 LILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSK 256
LILAGVKSVTLHDE VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAVV+S+LT
Sbjct: 114 LILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKS 173
Query: 257 LTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTV 316
L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFCDFGPEF V
Sbjct: 174 LNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAV 233
Query: 317 VDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIK 376
+DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELNDGKPRKIK
Sbjct: 234 LDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIK 293
Query: 377 SARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRP 436
S RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL SDFSKFDRP
Sbjct: 294 STRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDFSKFDRP 353
Query: 437 PPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFA 496
P LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN GD +VE+++ KLLRHF+
Sbjct: 354 PLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVDQKLLRHFS 413
Query: 497 FGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINS 556
FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS++F P NS
Sbjct: 414 FGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDSSDFAPRNS 473
Query: 557 RYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIE 616
RYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT+TDDD+IE
Sbjct: 474 RYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLTVTDDDIIE 533
Query: 617 KSNLSRQFLFRDWNIGQXXXXXXXXXXXXINPRLNIEALQNRVGPETENVFDDTFWENIT 676
KSNLSRQFLFRDWNIGQ INPR NIEALQNRVG ETENVFDD FWEN+T
Sbjct: 534 KSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFDDAFWENLT 593
Query: 677 CVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQA 736
V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGASRDPPEKQA
Sbjct: 594 VVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGASRDPPEKQA 653
Query: 737 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNL 796
PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AGDAQARD L
Sbjct: 654 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTL 713
Query: 797 ERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRF 856
ER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAPFWSAPKRF
Sbjct: 714 ERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRF 773
Query: 857 PHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDA 916
P PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK AEAVD+V+VPDF P++DA
Sbjct: 774 PRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDA 833
Query: 917 KILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEK 965
KI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL FR+KPIQFEK
Sbjct: 834 KIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEK 882
|
|
| TAIR|locus:2164270 UBA 2 "ubiquitin activating enzyme 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KMV5 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22314 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GRY0 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWX8 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGH5 UBA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P920 UBA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1359327 Uba1 "ubiquitin-like modifier activating enzyme 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2009 uba1 "ubiquitin-like modifier activating enzyme 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P93028 | UBE11_ARATH | No assigned EC number | 0.7892 | 0.9043 | 0.8138 | yes | no |
| P31252 | UBE13_WHEAT | No assigned EC number | 0.7657 | 0.8343 | 0.7701 | N/A | no |
| P31251 | UBE12_WHEAT | No assigned EC number | 0.7918 | 0.8343 | 0.7716 | N/A | no |
| P20973 | UBE11_WHEAT | No assigned EC number | 0.7918 | 0.8343 | 0.7716 | N/A | no |
| P92974 | UBE12_ARATH | No assigned EC number | 0.7915 | 0.8919 | 0.8050 | no | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 972 | |||
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 0.0 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 1e-175 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 1e-131 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 1e-63 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 4e-44 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 6e-39 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 2e-35 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 7e-35 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 1e-34 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 6e-33 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 2e-31 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 2e-31 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 8e-29 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 7e-25 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 3e-22 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 7e-22 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 2e-21 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 2e-21 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 1e-19 | |
| pfam10585 | 44 | pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e | 4e-18 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 2e-17 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 5e-17 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 1e-16 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 2e-15 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 9e-15 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 1e-14 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 1e-14 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 2e-14 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 3e-14 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 3e-14 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 1e-13 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 2e-13 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 4e-13 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 8e-13 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 1e-12 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 3e-12 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 2e-11 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 3e-11 | |
| PTZ00245 | 287 | PTZ00245, PTZ00245, ubiquitin activating enzyme; P | 4e-11 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 2e-10 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 4e-10 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 5e-10 | |
| PRK08223 | 287 | PRK08223, PRK08223, hypothetical protein; Validate | 7e-10 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 2e-09 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 2e-08 | |
| PRK14852 | 989 | PRK14852, PRK14852, hypothetical protein; Provisio | 2e-08 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 1e-07 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 1e-07 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 1e-07 | |
| PRK14851 | 679 | PRK14851, PRK14851, hypothetical protein; Provisio | 1e-07 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 6e-07 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 2e-06 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 5e-06 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 5e-06 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 6e-06 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 2e-05 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 2e-05 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 5e-05 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 8e-05 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 1e-04 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 1e-04 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 1e-04 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-04 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 4e-04 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 5e-04 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 0.002 |
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
Score = 1296 bits (3354), Expect = 0.0
Identities = 426/812 (52%), Positives = 558/812 (68%), Gaps = 5/812 (0%)
Query: 155 DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVE 214
+IDE L+SRQL V G E M+++ SN+L+SGM GLG EIAKNL+LAGVKSVTLHD +
Sbjct: 1 EIDEALYSRQLYVLGDEAMQKMAKSNVLISGMGGLGLEIAKNLVLAGVKSVTLHDTEKCQ 60
Query: 215 LWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDIS 274
WDLSSNF S++D+G+NRA A V+KL ELN V +S+ + +E L FQ VV T++S
Sbjct: 61 AWDLSSNFFLSEDDVGRNRAEAVVKKLAELNPYVHVSSSSVPFNEEFLDKFQCVVLTEMS 120
Query: 275 LDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISN 334
L E +DFCH+ P I+FI A+VRGLFGS+FCDFG EF V+D DGE+P TG IASI+
Sbjct: 121 LPLQKEINDFCHSQCPPIAFISADVRGLFGSLFCDFGDEFEVLDTDGEEPKTGFIASITQ 180
Query: 335 DNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGT 394
NP +V+C+++ R + + GD V F EV+GMT LNDG PRKI PYSF++ + T G
Sbjct: 181 ANPGIVTCLENHRHKLETGDFVTFREVNGMTGLNDGSPRKITVISPYSFSIGDTTE-LGP 239
Query: 395 YVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELG 454
Y+ GGI TQVK PK + FK LRE L+DP L+ DFSK +RPP +H AFQALD+F +
Sbjct: 240 YLHGGIATQVKTPKTVFFKSLREQLKDP-KCLIVDFSKPERPPEIHTAFQALDQFQEKYS 298
Query: 455 RFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIV 514
R P G ++DA++L+ +AT+I+E+ + +V D++ KL+ ++ A+ L+PMAA GG+V
Sbjct: 299 RKPNVGCQQDAEELLKLATSISET-LEEKVPDVDAKLVHWLSWTAQGFLSPMAAAVGGVV 357
Query: 515 GQEVVKACSGKFHPLYQFFYFDSVESLPTE-PLDSTEFKPINSRYDAQISVFGAKLQKKL 573
QEV+KA +GKF PL Q+FYFDS ESLP+ + EF P RYDAQI+VFG Q+KL
Sbjct: 358 SQEVLKAVTGKFSPLCQWFYFDSAESLPSLGKPECEEFLPRGDRYDAQIAVFGDTFQQKL 417
Query: 574 EDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQ 633
++ +F+VG GA+GCE LKN ALMGV G +G +T+TD D+IEKSNL+RQFLFR +IG+
Sbjct: 418 QNLNIFLVGCGAIGCEMLKNFALMGVGTGKKGMITVTDPDLIEKSNLNRQFLFRPHHIGK 477
Query: 634 AKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQ 693
KS AA A INP++ I+A QNRVGPETE +F+D F+E + VINALDNV AR YVD
Sbjct: 478 PKSYTAADATLKINPQIKIDAHQNRVGPETETIFNDEFYEKLDVVINALDNVEARRYVDS 537
Query: 694 RCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLT 753
RCL F KPLLESGTLG K NTQ+V+PHLTE+YG+SRDPPEK+ P CT+ SFP I+H +
Sbjct: 538 RCLAFLKPLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKEIPFCTLKSFPAAIEHTIQ 597
Query: 754 WARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQD 813
WAR +FEGL P+ VN YLS+P + +R+ LE++++ L KEK F
Sbjct: 598 WARDKFEGLFSHKPSLVNKYLSSPSSAEEVLQKIQSGHSREGLEQIIKLLSKEKPRNFSQ 657
Query: 814 CITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFV 873
C+ WARLKFE YF+N+ QL+ FP D TSTG+PFWS+PKR P PL+F +P HL F+
Sbjct: 658 CVEWARLKFEKYFNNKALQLLHCFPLDIRTSTGSPFWSSPKRPPSPLKFDLNEPLHLSFI 717
Query: 874 MAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVD 933
AA+ L A +GIP + + L + +V +P+F P+ + KI TDE A TA D
Sbjct: 718 QAAAKLYATVYGIPFAEEDLSADALLNILSEVKIPEFKPRSNKKIQTDETARKPDTAPED 777
Query: 934 DAAVINDLIIKLEQCRKNLPSGFRLKPIQFEK 965
D I L + S FR+ P+ FEK
Sbjct: 778 DRNAIFQLEKAILSNEATK-SDFRMAPLSFEK 808
|
This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008 |
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 972 | |||
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 100.0 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 100.0 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 100.0 | |
| PRK08223 | 287 | hypothetical protein; Validated | 100.0 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 100.0 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 100.0 | |
| PRK07411 | 390 | hypothetical protein; Validated | 100.0 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.98 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 99.98 | |
| PRK08223 | 287 | hypothetical protein; Validated | 99.97 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 99.97 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 99.97 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.97 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 99.97 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.97 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.97 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.97 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.97 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 99.97 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 99.97 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.97 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 99.97 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.96 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.96 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.96 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.96 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.96 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 99.96 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 99.95 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.95 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.95 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.95 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.95 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.95 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.95 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.95 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 99.94 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.94 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 99.94 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.94 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.94 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.94 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.94 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.94 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 99.93 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.93 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.93 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.93 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.93 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.93 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.93 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.92 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.91 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.91 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.9 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.9 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.89 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.89 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 99.88 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.87 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.87 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.87 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 99.86 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.86 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.86 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.85 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.82 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.79 | |
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 99.79 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.75 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.72 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 99.55 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.53 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.42 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.35 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 99.09 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.04 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.03 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 97.88 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.52 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 97.49 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.45 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 97.09 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.07 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 97.01 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.98 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.95 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 96.89 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 96.87 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 96.85 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.81 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.66 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 96.54 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.17 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.16 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.11 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 95.89 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 95.89 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 95.65 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 95.45 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 95.12 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.1 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.03 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.94 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.92 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.9 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 94.87 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 94.86 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.76 | |
| PF05237 | 84 | MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T | 94.56 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.56 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.44 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.43 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.41 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 94.4 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.28 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 94.22 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.19 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.13 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.12 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 94.02 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.91 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.9 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.87 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 93.83 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.77 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 93.72 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 93.65 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 93.64 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.61 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.44 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 93.3 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.3 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 93.17 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 93.11 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 93.09 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 93.06 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 92.98 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 92.88 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.81 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 92.65 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 92.61 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 92.57 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.41 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 92.4 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 92.32 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 92.31 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 92.26 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 92.24 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 92.19 | |
| PLN02602 | 350 | lactate dehydrogenase | 92.14 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 92.12 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 92.08 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.98 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 91.96 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 91.94 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 91.89 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 91.86 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.54 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.48 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.34 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 91.25 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 91.2 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 91.12 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 91.0 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 90.93 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 90.84 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 90.8 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 90.76 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 90.72 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 90.69 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 90.66 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 90.41 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 90.39 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.38 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 90.34 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.34 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 90.32 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 90.26 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 90.21 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.05 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 89.99 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 89.96 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.94 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 89.9 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.9 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.78 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 89.75 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 89.7 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 89.68 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 89.66 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.6 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 89.48 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.42 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 89.31 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 89.29 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 89.25 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 89.23 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 89.23 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 89.1 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 89.07 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 89.06 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 89.06 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 89.05 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 89.05 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 88.95 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 88.9 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.78 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 88.67 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 88.65 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 88.53 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 88.46 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 88.44 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 88.44 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 88.42 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 88.28 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 88.26 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 88.15 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 88.15 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 88.15 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 88.14 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 88.13 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 88.01 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 88.0 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 87.97 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 87.96 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.72 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 87.72 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.7 | |
| PLN02602 | 350 | lactate dehydrogenase | 87.67 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 87.57 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 87.54 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 87.53 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 87.52 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 87.48 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 87.4 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 87.39 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 87.24 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 87.23 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 87.16 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 86.92 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 86.83 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 86.83 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.8 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 86.78 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 86.76 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 86.76 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 86.75 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 86.68 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.65 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 86.64 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 86.61 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 86.61 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.6 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 86.42 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 86.39 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 86.34 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 86.31 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 86.3 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 86.28 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 86.16 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 86.15 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 86.08 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 86.04 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 85.96 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 85.91 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 85.9 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 85.76 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 85.76 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 85.74 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 85.71 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 85.68 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 85.66 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 85.59 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 85.55 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 85.49 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 85.49 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 85.47 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 85.46 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.42 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 85.34 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 85.3 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 85.28 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 85.26 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 85.25 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 85.25 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 85.2 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 85.19 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 85.15 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 85.06 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 85.05 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.99 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 84.94 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 84.84 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 84.83 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 84.8 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 84.79 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 84.67 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 84.67 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 84.62 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 84.57 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 84.56 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 84.56 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 84.45 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 84.42 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 84.36 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 84.31 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 84.31 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 84.24 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 84.23 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.14 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 84.04 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 83.97 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 83.88 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 83.84 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 83.83 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 83.76 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.74 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 83.71 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 83.68 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 83.66 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 83.64 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.64 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.63 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 83.61 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 83.6 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 83.59 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 83.59 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 83.56 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 83.47 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 83.4 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 83.35 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 83.23 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.2 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 83.18 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 83.16 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 83.16 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 83.14 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 83.13 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 83.11 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 82.89 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.88 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 82.85 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 82.84 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 82.83 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 82.82 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 82.63 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 82.59 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 82.59 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 82.54 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 82.5 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 82.4 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 82.4 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 82.38 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 82.35 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 82.35 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 82.31 | |
| COG1023 | 300 | Gnd Predicted 6-phosphogluconate dehydrogenase [Ca | 82.29 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 82.26 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 82.21 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 82.17 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 82.12 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.04 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 82.02 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 81.97 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 81.96 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.9 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 81.87 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 81.71 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 81.69 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 81.53 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 81.51 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 81.5 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 81.44 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 81.42 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 81.4 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 81.38 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 81.38 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 81.35 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 81.29 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 81.27 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 81.18 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 81.09 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 81.09 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 81.08 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 81.0 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 80.98 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 80.95 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 80.9 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 80.86 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 80.78 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 80.76 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 80.75 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 80.68 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 80.65 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 80.51 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 80.51 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 80.46 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 80.43 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 80.11 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 80.1 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 80.06 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 80.05 |
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-224 Score=1907.83 Aligned_cols=814 Identities=61% Similarity=1.007 Sum_probs=790.9
Q ss_pred ccccccCCCCCChhhHhhhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhcCCEEEEEeCCccCccCCcccc
Q 002073 143 VPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNF 222 (972)
Q Consensus 143 ~~~~~~~~~~~~~~d~~~YsRQi~l~G~e~q~kL~~s~VlIvG~gGlG~EiaKNLvLaGVg~itLvD~d~V~~~DL~~qf 222 (972)
+++|..++.+..+|||++||||||++|+++|+||+.|+|||+||+|||.||||||+|+||+++||+|+..+.++||++||
T Consensus 2 ~~n~~~~~~a~~~IDE~LYSRQLYVlG~eAM~~m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf 81 (1013)
T KOG2012|consen 2 SNNMMDGNSASQEIDESLYSRQLYVLGHEAMRRMQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQF 81 (1013)
T ss_pred CCcccccCcchhhhhhhhhhhhhhhccHHHHHHHhhCcEEEecCCcccHHHHhhHhhhccceEEeeCCCcccHHhhccce
Confidence 34555566667899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcCccCchHHHHHHHHHHHhcCCCEEEEeecCCChhhhcCCceEEEcCCCHHHHHHHHHHHHhcCCCceeEEeeecce
Q 002073 223 VFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGL 302 (972)
Q Consensus 223 fl~~~DIGk~RAea~~~~L~eLNp~V~V~~~~~~l~~e~l~~fdvVV~~~~~~~~~~~ln~~c~~~~~~IpfI~a~~~G~ 302 (972)
|++++|||+|||+++.++|+|||+||.|.++++.+++++|++|+|||+|+.+++.+.+||++||+++ |.||.++++|+
T Consensus 82 ~L~E~DigknRA~as~~~LaeLN~yV~V~v~t~~~~~e~L~~FqvVVlt~~~le~q~~i~~fch~~~--i~fi~ad~RGL 159 (1013)
T KOG2012|consen 82 YLSEEDIGKNRAEASVEKLAELNNYVPVVVLTGPLTEEFLSDFQVVVLTDASLEEQLKINDFCHSHG--IAFIAADTRGL 159 (1013)
T ss_pred eeeHHhcCCchHHHHHHHHHHhhcceeeEEecCcccHHHHhCCcEEEEecCchHHHHHHHHHHHhcC--eEEEEeccchh
Confidence 9999999999999999999999999999999999999999999999999999999999999999999 99999999999
Q ss_pred eEEEEEEcCCceEEecCCCCCCcceeecccccCCCceeecccccccccccCCeeEEEeeccccccCCCCCceecccCcce
Q 002073 303 FGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYS 382 (972)
Q Consensus 303 ~G~vf~dfg~~f~v~d~~ge~p~~~~I~~I~~~~~~lVt~~~~~rh~~~dgd~V~f~ev~gm~eln~~~~~~I~~~~~~~ 382 (972)
||++|||||++|+|.|++||+|.+++|++|++++||+|||+|+.||+|+|||+|+|+||+||++||+|+|++|++++||+
T Consensus 160 fg~lFCDFG~eF~v~D~tGeeP~t~mI~~Is~d~pGvvT~ld~~rH~lEdGd~V~FsEveGm~eLN~~~P~kI~v~~p~s 239 (1013)
T KOG2012|consen 160 FGQLFCDFGEEFTVLDPTGEEPLTGMIASISQDNPGVVTCLDGARHGFEDGDLVTFSEVEGMTELNDCKPRKITVLGPYS 239 (1013)
T ss_pred hhhhhccCCCceEEeCCCCCcchhhHHhhccCCCCceEEEecCccccCccCCEEEEEeeccccccCCCCceEEEEecCce
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeccccccccceeecceEEEeecCeeecccchhhhhcCCCccccccCccCCCCChHHHHHHHHHHHHHHhCCCCCCCCh
Q 002073 383 FTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSE 462 (972)
Q Consensus 383 f~i~~Dt~~f~~y~~gG~~~qvk~pk~i~fksL~e~l~~p~~~l~~d~~k~~r~~~lh~~~~aL~~F~~~~grlP~~~~~ 462 (972)
|+| +||+.|++|.+||+++|||+|++++||||+++|++| +++.+||+|++||++||++|+||++|+++|||+|+|+++
T Consensus 240 f~I-gdt~~f~~y~~GGi~tQVK~Pk~isfKsL~~~L~~P-~fl~~df~k~~rp~~lH~af~AL~~F~~~~Gr~P~p~~e 317 (1013)
T KOG2012|consen 240 FSI-GDTTEFGEYKKGGIFTQVKVPKTISFKSLREALKEP-EFLISDFAKFDRPPQLHLAFQALHQFQEAHGRLPRPGNE 317 (1013)
T ss_pred EEe-ccccchhhhhcCceeEEeecCceEecccHHHhhcCC-CeeeeccccccccHHHHHHHHHHHHHHHHhCCCCCCCCh
Confidence 999 589999999999999999999999999999999999 899999999999999999999999999999999999999
Q ss_pred hhHHHHHHHHHHHHhhcCCCCCCCCCHHHHHHHHhhcccccCchhhHhhhhhhhhHhhhhcCCccccceeeEeeeccCCC
Q 002073 463 EDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLP 542 (972)
Q Consensus 463 ~Da~~l~~la~~i~~~~~~~~~~~ide~lv~~~a~~~~~el~PvaA~iGGiaAQEVIKaiTgKf~PI~q~~yfD~~e~Lp 542 (972)
+|+++|++++..+.+..+ ..+++|+++|++|+++++|.|.||+|++||+|||||+|+|||||+||.||||||++||||
T Consensus 318 ~DA~~l~~l~~~i~~~~~--~~~~vde~Lir~~s~~a~g~L~pm~A~~GG~vaQEvlKa~sgKF~PL~Q~lYfDale~LP 395 (1013)
T KOG2012|consen 318 EDAEELVELARDISEGLG--LEEDVDEKLIRHFSFSARGDLNPMVAFFGGIVAQEVLKACSGKFTPLKQWLYFDALESLP 395 (1013)
T ss_pred hhHHHHHHHHHHhhhhcc--ccccchHHHHHHHHHhhccCcchHHHHHhhhhHHHHHHhhccCccchhHheehhhHhhCC
Confidence 999999999999988765 356899999999999999999999999999999999999999999999999999999999
Q ss_pred CC--CCCCCccCCccCchhhhhhhcCHHHHHHHhcCcEEEEcCCcchHHHHHHHHHccccCCCCceEEEEcCCcccccCC
Q 002073 543 TE--PLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNL 620 (972)
Q Consensus 543 ~~--~~~~~~~~~~~~RYdrqi~l~G~~~q~kL~~~kVlIVGaGgiG~e~lknLa~~Gv~~~~~g~i~iiD~D~Ie~SNL 620 (972)
++ ++++++++|.++|||.||++||.++|+||.++++|+|||||||||+||||||||++||..|+|+|+|||.||+|||
T Consensus 396 ~d~~~~~e~d~~prgsRYD~qiavfG~~fqeKL~~~~~FlVGaGAIGCE~LKN~am~Gvg~g~~g~ItVTDmD~IEkSNL 475 (1013)
T KOG2012|consen 396 SDNLPPSEEDCQPRGSRYDGQIAVFGAKFQEKLADQKVFLVGAGAIGCELLKNFALMGVGCGNSGKITVTDMDHIEKSNL 475 (1013)
T ss_pred CcCCCCCHHHcccccCccccchhhhchHHHHHHhhCcEEEEccchhhHHHHHhhhheeeccCCCCceEEeccchhhhccc
Confidence 75 7889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcccccccCcccccHHHHHHHHHHhhCCCcEEEEeecccCCCcccccchhccCCCcEEEEccCChHHHHHHhhhhhcccc
Q 002073 621 SRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQK 700 (972)
Q Consensus 621 nRQfLf~~~dVGk~Ks~vaa~~l~~inP~~~I~~~~~~v~~~~e~i~~~~f~~~~DvVi~alDn~~aR~~v~~~c~~~~k 700 (972)
|||||||++||||+||++||+++..|||+++|++++.+++++||+||+|+||++.|+|+||+||++||+|||++|+.+.|
T Consensus 476 nRQFLFR~~dVgk~KSe~AA~A~~~mNp~l~I~a~~~rvgpeTE~If~D~Ff~~ld~VanALDNVdAR~YvD~RCv~~~k 555 (1013)
T KOG2012|consen 476 NRQFLFRPWDVGKPKSEVAAAAARGMNPDLNIIALQNRVGPETEHIFNDEFFENLDGVANALDNVDARRYVDRRCVYYRK 555 (1013)
T ss_pred cceeeccccccCchHHHHHHHHHHhcCCCceeeehhhccCcccccccchhHHhhhHHHHHhhcchhhhhhhhhhhhhhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceEecccCCccceeEEEeCcccCccCCCCCCCCCCCCCccccCCCCChhhHHHHHHHHhhhcccCChhhHhhhcCCchhh
Q 002073 701 PLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEY 780 (972)
Q Consensus 701 Pli~sgt~G~~G~~~viip~~t~~y~~~~dp~~~~~p~Ctl~~fP~~~~h~i~wAr~~F~~lF~~~~~~~~~~l~~p~~~ 780 (972)
||+++||+|+||++||++||+||+|++++|||||++|+||+||||+.|||||+|||++||++|.++++++|+||++|..+
T Consensus 556 PLLESGTlGTKGntQVvvPhlTEsY~SS~DPPEksiP~CTlknFPn~IeHTiqWAR~eFEg~F~~~~e~vN~yls~p~f~ 635 (1013)
T KOG2012|consen 556 PLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKSIPVCTLKSFPNAIEHTIQWARDEFEGLFKQSAENVNKYLSDPVFY 635 (1013)
T ss_pred chhhccCcCCccceeEEeccccccccccCCCcccCCceeeeccCchHHHHHHHHHHHHHHHHhhCCHHHHHHHhcCchHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999977
Q ss_pred hhhhhccCchhHHHHHHHHHHHhhhccccchHHHHHHHHHhhHHHHhHhHHhhhccCCccccccCCCccccccCCCCCCc
Q 002073 781 TTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPL 860 (972)
Q Consensus 781 ~~~~~~~~~~~~~~~l~~v~~~l~~~~~~~~~~ci~~a~~~f~~~f~~~i~~Ll~~fp~d~~~~~g~~fws~~kr~p~pl 860 (972)
...++..++.+.++.+++|.++|. .+|.+|+|||+|||++|+++|+++|+|||++||+|+.|++|+||||||||||+||
T Consensus 636 e~sl~~~~~~~~~~~l~~v~~~l~-~rp~~~~dCv~warl~f~~~f~~~ikqLl~~FP~d~~t~~G~pFWs~pKr~P~pl 714 (1013)
T KOG2012|consen 636 ETSLKLIGEPQSLETLERVVDCLS-ERPQNWQDCVEWARLHFEKYFHNRIKQLLHNFPPDAKTSDGAPFWSGPKRCPRPL 714 (1013)
T ss_pred HHHHhhccCcchhHHHHHHHHHhh-cCCccHHHHHHHHHHHHHHHhhHHHHHhhcCCCcccccCCCCcCCCCCCCCCCce
Confidence 777888888888999999999998 9999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCcchHHHHHHHHHHHHHHcCCCCCCCCCCHHHHHHHhhccCCCCccCCCCCeeecCccccccccCCCCcHHHHHH
Q 002073 861 QFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVIND 940 (972)
Q Consensus 861 ~fd~~~~~h~~fv~aaanL~a~~fgi~~~~~~~~~~~~~~~~~~~~~p~f~p~~~~~i~~~~~~~~~~~~~~~~~~~~~~ 940 (972)
+||.+|++|+.||+|||||||.+|||++. .++++++.++..+++|+|+|+++++|.+++.+....+++.|+.+++.+
T Consensus 715 ~Fd~n~~~hl~fv~Aaa~l~a~~~gi~~~---~d~~~~~~~~~~v~~p~f~P~~~~~i~~~~~~~~~~~~s~d~~~~i~~ 791 (1013)
T KOG2012|consen 715 EFDVNDPLHLNFVQAAANLRAEVYGIPGS---QDREALAELLERVIVPEFEPKQKVKIVVEEAELAASSASVDDSAAIDQ 791 (1013)
T ss_pred eecCCCchhHHHHHHHHHHHHHhcCCCcc---cCHHHhhhhHhhcCCCccccccCCeecccccccccccccCCchHHHHH
Confidence 99999999999999999999999999985 778899999999999999999999999999877666667788889999
Q ss_pred HHHHhhhhccCCCCCCCcceeeeccccc
Q 002073 941 LIIKLEQCRKNLPSGFRLKPIQFEKVCI 968 (972)
Q Consensus 941 l~~~l~~~~~~~~~~~~~~p~~FeK~~~ 968 (972)
|..+|+.++. ..+++|.|++||||-.
T Consensus 792 l~~~l~~~~~--~~~~~~~p~~FEKDDD 817 (1013)
T KOG2012|consen 792 LNKALPSPSV--LPSFKMKPLDFEKDDD 817 (1013)
T ss_pred Hhhccccccc--CCCCceeeeeeccccc
Confidence 9999999988 6689999999999743
|
|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 972 | ||||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 0.0 | ||
| 4ii2_A | 1001 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 0.0 | ||
| 1z7l_A | 276 | Crystal Structure Of Fragment Of Mouse Ubiquitin-Ac | 4e-41 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 5e-30 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 1e-07 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 3e-25 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 4e-25 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 4e-24 | ||
| 2v31_A | 112 | Structure Of First Catalytic Cysteine Half-Domain O | 1e-23 | ||
| 1yov_B | 444 | Insights Into The Ubiquitin Transfer Cascade From T | 4e-22 | ||
| 2nvu_B | 805 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 4e-22 | ||
| 3gzn_B | 463 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 4e-22 | ||
| 1tt5_B | 434 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 4e-22 | ||
| 3dbr_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 2e-21 | ||
| 1r4m_B | 431 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 6e-21 | ||
| 3dbl_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 6e-21 | ||
| 3dbh_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 1e-20 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 3e-10 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 3e-10 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 7e-10 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 2e-04 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 7e-10 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 3e-04 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 7e-10 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 3e-04 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 7e-10 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 3e-04 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 8e-10 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 3e-04 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 2e-09 | ||
| 3h5n_A | 353 | Crystal Structure Of E. Coli Mccb + Atp Length = 35 | 1e-06 | ||
| 3h5a_A | 358 | Crystal Structure Of E. Coli Mccb Length = 358 | 2e-06 |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
|
| >pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 | Back alignment and structure |
| >pdb|1Z7L|A Chain A, Crystal Structure Of Fragment Of Mouse Ubiquitin-Activating Enzyme Length = 276 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|2V31|A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme Length = 112 | Back alignment and structure |
| >pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 | Back alignment and structure |
| >pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 | Back alignment and structure |
| >pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 | Back alignment and structure |
| >pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 | Back alignment and structure |
| >pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 | Back alignment and structure |
| >pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 | Back alignment and structure |
| >pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
| >pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 | Back alignment and structure |
| >pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
Score = 787 bits (2034), Expect = 0.0
Identities = 376/822 (45%), Positives = 536/822 (65%), Gaps = 22/822 (2%)
Query: 154 TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTV 213
+IDE L+SRQL V G+E M ++ SN+L+ G++GLG EIAKN++LAGVKS+T+ D V
Sbjct: 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPV 62
Query: 214 ELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTD- 272
+L DLS+ F ++ DIG+ R + KL ELN V ++ L S QLS FQ VV TD
Sbjct: 63 QLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDT 122
Query: 273 ISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASI 332
+SL+ ++ ++FCH+ I FI +E RGLFG+ F D G EFTV+D GE+P TG+++ I
Sbjct: 123 VSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDI 180
Query: 333 SNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY 392
D V+ +DD R +DG+ V FSEV G+ +LNDG K++ P++F + Y
Sbjct: 181 EPDGT--VTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237
Query: 393 GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSE 452
G Y KGGI T+VK P+ ++FK L++ L +P +F+ SDF+KFDR LHL FQAL +F
Sbjct: 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVR 296
Query: 453 -LGRFPVAGSEEDAQKLISVATNINESLGD--GRVEDINTKLLRHFAFGARAVLNPMAAM 509
G P ++EDA +LI + T+++ + G D+N L++ ++ AR + + A
Sbjct: 297 HNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAF 356
Query: 510 FGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE---PLDSTEFKPINSRYDAQISVFG 566
FGG+V QEV+KACSGKF PL QF YFDS+ESLP P + +P+NSRYD QI+VFG
Sbjct: 357 FGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFG 416
Query: 567 AKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 626
QKK+ ++KVF+VGSGA+GCE LKN AL+G+ G+ G + +TD+D IEKSNL+RQFLF
Sbjct: 417 LDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476
Query: 627 RDWNIGQAKSTVAASAATSINPRLNIE--ALQNRVGPETENVFDDTFWENITCVINALDN 684
R ++G+ KS VAA A ++NP L + A ++VGPETE +F+D+FWE++ V NALDN
Sbjct: 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDN 536
Query: 685 VNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSF 744
V+AR YVD+RC++++KPLLESGTLG K NTQ++IP LTE+Y +SRDPPEK P+CT+ SF
Sbjct: 537 VDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSF 596
Query: 745 PHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLD 804
P+ IDH + WA+S F+G + VN YL+ P ++ +GD + LE + + L
Sbjct: 597 PNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGD--VKGVLESISDSLS 654
Query: 805 KEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS 864
K F+DCI WARL+FE F++ +KQL+F FP+DA TS G PFWS KR P PL+F
Sbjct: 655 -SKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713
Query: 865 ADPSHLHFVMAASILRAETFGIPIPDWTNNPKM--LAEAVDKVMVPDFLPKKDAKILTDE 922
+ H HFV+A + LRA +GI D + P + +D +++P+F P + KI ++
Sbjct: 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVND 773
Query: 923 KATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFE 964
+ + + + I+ L+ L +GF+L+P+ FE
Sbjct: 774 DDPDPNANAANGSDEIDQLVSSLPDPSTL--AGFKLEPVDFE 813
|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 972 | |||
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.98 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 99.97 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.97 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.97 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.96 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 99.96 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.96 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 99.96 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.95 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 99.95 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.95 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.95 | |
| 2v31_A | 112 | Ubiquitin-activating enzyme E1 X; ligase, phosphor | 99.95 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.94 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.92 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.91 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.9 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 99.0 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.25 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.95 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.81 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.77 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 96.67 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.58 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.58 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.46 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.24 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.14 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.12 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.81 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 95.78 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.68 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.64 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.63 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.59 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.55 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 95.43 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.39 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 95.27 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.16 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 95.09 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 95.04 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.03 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.03 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.98 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.97 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 94.88 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 94.78 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 94.61 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 94.57 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.49 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 94.43 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.43 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 94.39 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.39 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.38 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.26 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.2 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.0 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.99 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.93 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 93.81 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 93.77 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 93.76 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 93.74 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 93.73 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 93.72 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 93.58 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 93.51 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 93.5 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 93.48 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 93.47 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 93.33 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 93.31 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.24 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 93.17 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 93.13 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 93.03 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 93.02 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 92.98 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 92.83 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 92.76 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 92.71 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 92.7 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.65 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 92.64 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 92.63 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 92.6 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 92.57 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 92.56 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 92.54 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 92.51 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 92.48 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.43 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 92.43 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 92.4 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 92.37 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 92.3 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 92.28 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 92.26 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 92.23 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 92.23 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 92.21 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 92.08 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 92.02 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 92.0 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 91.98 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 91.96 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 91.9 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 91.89 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 91.86 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 91.83 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.81 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 91.73 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 91.64 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 91.61 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 91.6 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 91.55 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 91.46 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 91.44 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 91.42 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 91.41 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 91.33 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 91.33 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 91.26 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 91.17 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 91.12 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 91.1 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 91.1 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 91.04 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 90.96 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 90.94 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 90.92 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 90.91 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 90.91 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 90.9 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 90.88 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 90.87 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 90.86 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 90.85 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 90.85 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 90.74 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 90.64 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 90.57 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 90.55 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 90.47 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 90.44 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 90.38 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 90.35 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 90.3 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 90.23 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 90.22 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 90.13 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 90.11 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 89.92 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 89.87 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 89.82 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 89.79 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 89.78 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 89.77 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 89.74 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 89.72 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 89.72 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 89.7 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 89.68 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 89.61 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 89.6 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 89.58 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 89.57 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 89.49 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 89.44 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 89.32 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 89.23 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 89.2 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 89.15 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 89.14 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 89.07 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 89.07 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 89.07 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 89.06 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 89.04 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 89.03 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 89.03 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 89.01 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 89.0 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 88.98 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 88.95 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 88.94 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 88.91 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 88.9 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 88.87 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 88.8 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 88.75 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 88.72 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 88.65 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 88.59 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 88.58 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 88.57 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 88.57 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 88.46 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 88.41 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 88.38 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 88.37 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 88.32 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 88.31 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 88.3 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 88.29 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 88.28 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 88.24 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 88.21 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 88.19 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 88.19 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 88.16 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 88.13 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 88.12 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 88.1 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 88.09 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 88.07 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 88.05 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 88.0 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 88.0 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 87.99 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 87.95 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 87.93 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 87.9 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 87.88 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 87.81 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 87.77 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.73 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 87.7 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 87.7 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 87.68 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 87.67 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 87.63 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 87.63 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 87.56 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 87.55 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 87.53 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 87.51 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 87.48 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 87.47 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 87.44 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 87.38 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 87.37 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 87.36 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 87.34 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 87.31 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 87.3 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 87.26 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 87.23 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 87.22 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.18 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 87.11 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 87.09 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 87.08 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 87.06 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 87.04 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 87.02 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 87.02 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 87.01 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 87.0 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 86.93 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 86.92 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 86.91 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 86.91 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 86.85 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 86.84 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 86.8 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 86.76 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 86.74 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 86.71 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 86.67 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 86.67 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 86.65 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 86.63 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 86.61 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 86.61 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 86.56 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 86.52 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 86.51 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 86.49 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 86.49 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 86.47 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 86.46 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 86.44 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 86.44 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 86.41 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 86.41 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 86.35 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 86.3 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 86.25 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 86.2 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 86.16 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 86.13 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 86.12 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 86.08 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 86.06 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 86.06 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 85.97 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 85.95 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 85.93 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 85.9 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 85.88 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 85.83 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 85.8 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 85.79 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 85.76 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 85.75 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 85.75 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 85.72 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 85.7 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 85.67 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 85.65 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 85.65 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 85.62 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 85.58 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 85.58 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 85.56 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 85.46 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 85.46 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 85.45 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 85.43 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 85.42 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 85.39 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 85.38 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 85.3 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 85.27 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 85.26 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 85.25 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 85.24 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 85.22 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 85.19 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 85.17 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 85.12 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 85.04 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 85.03 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 85.03 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 85.02 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 84.99 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 84.97 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 84.97 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 84.92 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 84.89 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 84.81 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 84.81 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 84.8 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 84.79 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 84.77 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 84.77 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 84.77 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 84.71 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 84.69 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 84.67 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 84.65 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 84.65 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 84.59 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 84.57 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 84.54 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 84.36 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 84.32 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 84.25 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 84.15 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 84.13 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 84.13 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 84.09 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 84.07 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 84.06 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 84.04 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 84.03 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 84.01 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 83.98 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 83.96 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 83.95 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 83.94 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 83.86 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 83.85 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 83.85 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 83.85 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 83.84 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 83.84 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 83.82 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 83.79 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 83.72 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 83.71 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 83.65 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 83.65 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 83.58 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 83.57 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 83.56 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 83.51 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 83.44 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 83.43 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 83.43 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 83.38 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 83.34 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 83.33 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 83.32 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 83.28 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 83.26 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 83.25 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 83.25 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 83.19 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 83.18 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 83.15 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 83.15 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 83.14 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 83.12 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 83.11 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 83.07 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 83.06 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 83.04 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 83.03 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 83.0 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 83.0 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 82.99 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 82.97 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 82.96 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 82.94 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 82.93 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 82.91 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 82.8 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 82.73 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 82.68 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 82.67 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 82.61 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 82.59 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 82.58 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 82.51 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 82.45 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 82.43 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 82.42 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 82.42 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 82.38 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 82.36 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 82.35 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 82.09 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 82.08 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 81.99 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 81.98 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 81.95 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 81.91 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 81.88 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 81.84 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 81.81 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 81.81 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 81.76 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 81.76 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 81.67 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 81.61 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 81.5 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 81.5 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 81.49 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 81.36 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 81.34 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 81.32 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 81.28 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 81.22 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 81.17 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 81.16 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 81.16 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 81.1 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 81.02 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 80.92 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 80.89 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 80.88 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 80.71 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 80.71 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 80.7 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 80.61 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 80.6 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 80.53 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 80.5 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 80.37 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 80.36 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 80.34 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 80.29 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 80.26 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 80.25 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 80.23 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 80.19 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 80.19 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 80.16 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 80.13 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 80.09 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 80.09 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 80.05 |
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-169 Score=1568.88 Aligned_cols=803 Identities=46% Similarity=0.829 Sum_probs=756.4
Q ss_pred ChhhHhhhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhcCCEEEEEeCCccCccCCccccccCcCccCchH
Q 002073 154 TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNR 233 (972)
Q Consensus 154 ~~~d~~~YsRQi~l~G~e~q~kL~~s~VlIvG~gGlG~EiaKNLvLaGVg~itLvD~d~V~~~DL~~qffl~~~DIGk~R 233 (972)
.++|++|||||+++||.++|+||++++|||+|+||+|+|+||||+++|||+|||+|+|.|+++||+|||+++++|||++|
T Consensus 3 ~~id~~rY~Rqi~l~G~~~q~rL~~s~VlIvG~GGlGseiak~La~aGVg~itlvD~D~V~~sNL~RQ~l~~~~dvG~~K 82 (1015)
T 3cmm_A 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKR 82 (1015)
T ss_dssp CCCCHHHHHHHHHHSCHHHHHHHTTCEEEEECCSHHHHHHHHHHHHHCCSEEEEECCSBCCGGGGGTCTTCCGGGTTSBH
T ss_pred hhhhhHhccchHhhcCHHHHHHHhcCEEEEECCChHHHHHHHHHHHcCCCeEEEecCCEechhhhccccccChhhcChHH
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcCCCEEEEeecCCChhhhcCCceEEEcCC-CHHHHHHHHHHHHhcCCCceeEEeeecceeEEEEEEcCC
Q 002073 234 ALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDI-SLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGP 312 (972)
Q Consensus 234 Aea~~~~L~eLNp~V~V~~~~~~l~~e~l~~fdvVV~~~~-~~~~~~~ln~~c~~~~~~IpfI~a~~~G~~G~vf~dfg~ 312 (972)
|++++++|+++||+|+|+++...++++++++||+||+|.+ +.+.+..||++|++++ +|||++++.|++|++|+|+|+
T Consensus 83 a~a~~~~L~~lNP~v~v~~~~~~l~~~~l~~~DvVv~~~d~~~~~r~~ln~~c~~~~--iplI~~~~~G~~G~v~~d~~~ 160 (1015)
T 3cmm_A 83 GDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGD 160 (1015)
T ss_dssp HHHHHHHHTTSCTTSCEEECCCCCCSTTGGGCSEEEECTTSCHHHHHHHHHHHHHHT--CEEEEEEEETTEEEEEEECCS
T ss_pred HHHHHHHHHHHCCCCeEEEecCCCCHHHHhcCCEEEEcCCCCHHHHHHHHHHHHHcC--CCEEEEEecccEEEEEecCCC
Confidence 9999999999999999999999999999999999999999 9999999999999999 999999999999999999999
Q ss_pred ceEEecCCCCCCcceeecccccCCCceeecccccccccccCCeeEEEeeccccccCCCCCceecccCcceeeeccccccc
Q 002073 313 EFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY 392 (972)
Q Consensus 313 ~f~v~d~~ge~p~~~~I~~I~~~~~~lVt~~~~~rh~~~dgd~V~f~ev~gm~eln~~~~~~I~~~~~~~f~i~~Dt~~f 392 (972)
+|.|.+++|+.|.+++|.+| +.|++++|+++++|++++||+|.|++++||+++|++++++|++.+||+|.| +||+.|
T Consensus 161 ~~~c~~~~~~~p~~~~i~~i--~~p~~v~~l~~~~h~~~~gd~v~F~ev~gm~elN~~e~~~i~~~~p~~f~I-~Dts~~ 237 (1015)
T 3cmm_A 161 EFTVLDPTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237 (1015)
T ss_dssp CEEESBSSCCCCCEEEEEEE--CTTCEEEESTTCCCCCCTTCEEEEECCBTSGGGGSSCCEECEEEETTEEEC-SCCTTT
T ss_pred ceEEeeCCCCCCccccccCC--CCCceeEeeecccccCCCCCeEEEEeeccchhhcCccceeeEEcCCceeEe-cccchh
Confidence 99999999999999999999 667899999999999999999999999999999999999999999999999 699999
Q ss_pred cceeecceEEEeecCeeecccchhhhhcCCCccccccCccCCCCChHHHHHHHHHHHHHHh-CCCCCCCChhhHHHHHHH
Q 002073 393 GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSEL-GRFPVAGSEEDAQKLISV 471 (972)
Q Consensus 393 ~~y~~gG~~~qvk~pk~i~fksL~e~l~~p~~~l~~d~~k~~r~~~lh~~~~aL~~F~~~~-grlP~~~~~~Da~~l~~l 471 (972)
+.|++||+++|||+|++++|++|++++++| .++.+|+.|++++.++|++||||++|.++| ||+|++++++|+++|+++
T Consensus 238 ~~yv~~g~~~qvk~p~~i~f~~l~~~l~~p-~~l~~d~~k~~~~~~l~~~~~Al~~F~~~~~gr~P~~~~~~D~~~l~~~ 316 (1015)
T 3cmm_A 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKL 316 (1015)
T ss_dssp CCCCBCCEEEECCCCEEECCCCHHHHHHSC-CBCCSCGGGTHHHHHHHHHHHHHHHHHHHTTTCCCCTTCHHHHHHHHHH
T ss_pred hhhhcCceeEEecCCcccCHHHHHHHHcCh-HHHHHHHhccCcchHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHH
Confidence 999999999999999999999999999999 578889999999999999999999999999 999999999999999999
Q ss_pred HHHHHhhcCCC--CCCCCCHHHHHHHHhhcccccCchhhHhhhhhhhhHhhhhcCCccccceeeEeeeccCCCC---CCC
Q 002073 472 ATNINESLGDG--RVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPT---EPL 546 (972)
Q Consensus 472 a~~i~~~~~~~--~~~~ide~lv~~~a~~~~~el~PvaA~iGGiaAQEVIKaiTgKf~PI~q~~yfD~~e~Lp~---~~~ 546 (972)
+++++.+.+.. ...+++++++++|+++++++|||||||+||+|||||||+|||||+||+||||||+++++|+ .++
T Consensus 317 a~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~el~pvaA~iGGivAQEVIKaiT~kf~Pi~~~~~~d~~~~~~~~~~~~~ 396 (1015)
T 3cmm_A 317 VTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPR 396 (1015)
T ss_dssp HHHHHHHCHHHHCTTCCCCHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHCBSCCCCSEEEEECGGGSCCTTTSCC
T ss_pred HHHHHHhcCCCccccccCcHHHHHHHHHhcCcccCcHHHHhcchHHHHHHHHhccCCCcccceEEecchhhccccccCCC
Confidence 99998764311 0036899999999999999999999999999999999999999999999999999999994 567
Q ss_pred CCCccCCccCchhhhhhhcCHHHHHHHhcCcEEEEcCCcchHHHHHHHHHccccCCCCceEEEEcCCcccccCCCccccc
Q 002073 547 DSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 626 (972)
Q Consensus 547 ~~~~~~~~~~RYdrqi~l~G~~~q~kL~~~kVlIVGaGgiG~e~lknLa~~Gv~~~~~g~i~iiD~D~Ie~SNLnRQfLf 626 (972)
++++++|.++||+||+++||.++|++|+++||+||||||+||++|++||++||+||++|+|+|+|+|+|+.|||||||||
T Consensus 397 ~~~~~~~~~~Ry~rq~~l~G~~~q~kL~~~~VlvVGaGGlGsevlk~La~~Gv~~g~~G~i~lvD~D~Ve~SNLnRQ~lf 476 (1015)
T 3cmm_A 397 NEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476 (1015)
T ss_dssp STTTTSCCSSTTHHHHHHHCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTTTCSTTCEEEEECCCBCCGGGTTTCTTC
T ss_pred ChhhccchhhhhhhHHHhcCHHHHHHHhcCeEEEEecCHHHHHHHHHHHHcCcCcCCCCeEEEEeCCEeccccccccccC
Confidence 88889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcccccHHHHHHHHHHhhCCCc--EEEEeecccCCCcccccchhccCCCcEEEEccCChHHHHHHhhhhhccccceEe
Q 002073 627 RDWNIGQAKSTVAASAATSINPRL--NIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLE 704 (972)
Q Consensus 627 ~~~dVGk~Ks~vaa~~l~~inP~~--~I~~~~~~v~~~~e~i~~~~f~~~~DvVi~alDn~~aR~~v~~~c~~~~kPli~ 704 (972)
+.+|||++||++|+++++++||++ +|+++..+++++++++|+++||+++|+||+|+||+++|++++++|+.+++|+|+
T Consensus 477 ~~~dvG~~Ka~~aa~~l~~iNP~v~~~v~~~~~~i~~~~~~~~~~~~~~~~D~Vi~a~Dn~~aR~~ln~~c~~~~~Pli~ 556 (1015)
T 3cmm_A 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLE 556 (1015)
T ss_dssp CGGGTTSBHHHHHHHHHHHHCGGGTTTEEEECCCCSGGGTTTSCHHHHHHCSEEEECCSSHHHHHHHHHHHHHHTCCEEE
T ss_pred ChhhCCCHHHHHHHHHHHHHCCCCcceEEEEecccCchhhhhccHhhhccCCEEEECCCCHHHHHHHHHHHHHcCCcEEE
Confidence 999999999999999999999999 999999999988888888899999999999999999999999999999999999
Q ss_pred cccCCccceeEEEeCcccCccCCCCCCCCCCCCCccccCCCCChhhHHHHHHHHhhhcccCChhhHhhhcCCchhhhhhh
Q 002073 705 SGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSM 784 (972)
Q Consensus 705 sgt~G~~G~~~viip~~t~~y~~~~dp~~~~~p~Ctl~~fP~~~~h~i~wAr~~F~~lF~~~~~~~~~~l~~p~~~~~~~ 784 (972)
+|+.|++|++++++|+.|+||.|..+|+++++|+||+++||+.++|||+|||++|+++|.+.++++|+|++|| .|.+++
T Consensus 557 ~g~~G~~G~v~v~~p~~t~cy~c~~dp~~~~~P~Ctl~~~P~~~~h~i~wa~~~f~~lf~~~~~~~~~~l~~~-~~~~~~ 635 (1015)
T 3cmm_A 557 SGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQP-NFVEQT 635 (1015)
T ss_dssp EEEETTEEEEEEECTTTBCCGGGSCCCCCCCCCHHHHHTCCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHCT-THHHHH
T ss_pred eCCCccccceEEEeCCCCCccCCCCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHHHHhhhhhhhhhhccCc-hhHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 687777
Q ss_pred hccCchhHHHHHHHHHHHhhhccccchHHHHHHHHHhhHHHHhHhHHhhhccCCccccccCCCccccccCCCCCCcccCC
Q 002073 785 ANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS 864 (972)
Q Consensus 785 ~~~~~~~~~~~l~~v~~~l~~~~~~~~~~ci~~a~~~f~~~f~~~i~~Ll~~fp~d~~~~~g~~fws~~kr~p~pl~fd~ 864 (972)
.+....+. +.|+.+.+.| ..+|.+|++|++|||.+|+++|+++|+|||++||+|++|++|+||||+|||+|+||+||+
T Consensus 636 ~~~~~~~~-~~l~~~~~~l-~~~~~~~~~c~~~a~~~f~~~F~~~I~~Ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~ 713 (1015)
T 3cmm_A 636 LKQSGDVK-GVLESISDSL-SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713 (1015)
T ss_dssp HC---CCH-HHHHHHHHHH-HSCCSSHHHHHHHHHHHHHHHHTHHHHHHHHHSCTTCBCSTTCBSSCTTCCCCCCCCCCT
T ss_pred HhccchhH-HHHHHHHHHh-hcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccCcccccCCCCCCCCcccCC
Confidence 66554443 7889999888 789999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcchHHHHHHHHHHHHHHcCCCCC--CCCCCHHHHHHHhhccCCCCccCCCCCeeecCccccccccCCCCcHHHHHHHH
Q 002073 865 ADPSHLHFVMAASILRAETFGIPIP--DWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLI 942 (972)
Q Consensus 865 ~~~~h~~fv~aaanL~a~~fgi~~~--~~~~~~~~~~~~~~~~~~p~f~p~~~~~i~~~~~~~~~~~~~~~~~~~~~~l~ 942 (972)
+|++|++||.+||||||.+|||+.+ .|..+++.++++++++.||+|+|++|+||.++|++.++++.+.++.+.+++|.
T Consensus 714 ~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~ki~~~~~~~~~~~~~~~~~~~~~~l~ 793 (1015)
T 3cmm_A 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLV 793 (1015)
T ss_dssp TSHHHHHHHHHHHHHHHHHHTCCCSSTTSSCCHHHHHHHHTTCCCCCCCCCSSCCCCSSTTSSCC---------CCHHHH
T ss_pred CCHHHHHHHHHHHHhHHHhcCCCCccccccCCHHHHHHHHhhCcCCCcCCccCceeccchhhhcccccccccHHHHHHHH
Confidence 9999999999999999999999984 47789999999999999999999999999999876544322333566789999
Q ss_pred HHhhhhccCCCCCCCcceeeecccc
Q 002073 943 IKLEQCRKNLPSGFRLKPIQFEKVC 967 (972)
Q Consensus 943 ~~l~~~~~~~~~~~~~~p~~FeK~~ 967 (972)
++|+++.. ++++++.|++||||-
T Consensus 794 ~~l~~~~~--~~~~~~~~~~FeKDD 816 (1015)
T 3cmm_A 794 SSLPDPST--LAGFKLEPVDFEKDD 816 (1015)
T ss_dssp TTSCCGGG--GTTCCCCCCCCCTTC
T ss_pred HHhccchh--cccCCCCceeeecCC
Confidence 99999876 578999999999974
|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 972 | ||||
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 3e-57 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 1e-43 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 2e-33 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 2e-44 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 1e-19 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 6e-21 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 3e-14 |
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: Amyloid beta precursor protein-binding protein 1, APPBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 204 bits (520), Expect = 3e-57
Identities = 60/315 (19%), Positives = 105/315 (33%), Gaps = 23/315 (7%)
Query: 555 NSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDV 614
+YD Q+ ++G Q+ LE A V ++ + A G E LKN+ L G+ G TI D +
Sbjct: 5 EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGI-----GSFTIIDGNQ 59
Query: 615 IEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWEN 674
+ + F + +IG+ ++ A +N ++ ++ +N D +F+
Sbjct: 60 VSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDN--DPSFFCR 117
Query: 675 ITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEK 734
T V+ + L + Q PLL T G +++I E+ P
Sbjct: 118 FTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIK---EHPVIESHPDNA 174
Query: 735 QAPMCTVHSFPHNIDHCLTWARSEFEG-LLEKTPAEVNAYLSNPVEYTTSMANAGDA--- 790
+ FP +H ++ E TP V Y+ +
Sbjct: 175 LEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKE 234
Query: 791 -----QARDNLERVLECLDKEKCEIFQDCITWARLKFEDY-FSNRVKQLIFTFPEDAATS 844
E E E F++ I + ++ + T
Sbjct: 235 KEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITK 294
Query: 845 TGAPFW---SAPKRF 856
FW A K F
Sbjct: 295 QTPSFWILARALKEF 309
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 972 | |||
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 99.97 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.7 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.0 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.42 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.39 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.3 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.22 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.18 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.13 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.12 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 96.06 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.01 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 95.99 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.99 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 95.89 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.86 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.79 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 95.76 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.64 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.54 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.51 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.46 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.33 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.17 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 95.13 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.12 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 95.05 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 95.05 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 95.04 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 95.0 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 94.85 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 94.83 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 94.82 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.78 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.77 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.74 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.72 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 94.5 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 94.49 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.48 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.45 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 94.45 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.4 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.4 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.39 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 94.33 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 94.3 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.26 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 94.14 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 94.09 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 93.99 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 93.98 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 93.91 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.89 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 93.89 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.87 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 93.84 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.83 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 93.82 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 93.77 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.75 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.7 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 93.68 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 93.62 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 93.46 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 93.44 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 93.37 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.36 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 93.32 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.32 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 93.31 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 93.26 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 93.23 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 93.14 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 93.13 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 93.06 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 93.03 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 92.97 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 92.93 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.91 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 92.91 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 92.89 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 92.88 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 92.88 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 92.88 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 92.87 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 92.86 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 92.85 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 92.83 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 92.79 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 92.77 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 92.76 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 92.74 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 92.73 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 92.72 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 92.7 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 92.68 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.57 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 92.57 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 92.55 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 92.54 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 92.53 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 92.34 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 92.26 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 92.23 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.18 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 92.11 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 92.06 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 92.04 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 91.95 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 91.92 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 91.8 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 91.75 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 91.72 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 91.68 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 91.65 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 91.59 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 91.57 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 91.42 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 91.17 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 91.07 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 90.97 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 90.89 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 90.88 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 90.87 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 90.87 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 90.77 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 90.76 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 90.67 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 90.64 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 90.48 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 90.42 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 90.41 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 90.28 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 90.25 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 90.25 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 90.22 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 90.13 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 90.03 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 90.0 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 89.96 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 89.92 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 89.84 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 89.77 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 89.76 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 89.73 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 89.72 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 89.66 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 89.64 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 89.63 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 89.61 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.46 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 89.44 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 89.44 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 89.36 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 89.35 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 89.31 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 89.31 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 89.15 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 89.15 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 89.13 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 89.1 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 89.1 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 89.04 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 89.01 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 88.94 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 88.93 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 88.92 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 88.85 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 88.83 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 88.77 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 88.75 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 88.65 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 88.57 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 88.35 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 88.34 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 88.3 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 88.26 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 88.23 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 88.23 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 88.1 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 88.09 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 88.08 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 88.02 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 87.89 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 87.86 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 87.54 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 87.46 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 87.46 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 87.28 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 87.18 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 87.12 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 87.1 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 87.03 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 86.98 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 86.91 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 86.88 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 86.87 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 86.86 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 86.85 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 86.84 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 86.84 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 86.66 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 86.63 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 86.55 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 86.53 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 86.47 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 86.47 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 86.46 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 86.2 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 86.17 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 86.11 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 86.09 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 85.91 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 85.89 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 85.88 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 85.81 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 85.7 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 85.44 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 85.32 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 85.31 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 85.28 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 85.06 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 85.01 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 84.98 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 84.89 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 84.78 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 84.74 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 84.61 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 84.38 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 84.16 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 84.08 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 84.04 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 83.99 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 83.96 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 83.9 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 83.8 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 83.7 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 83.57 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 83.46 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 83.41 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 83.38 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 83.33 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 83.32 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 83.31 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 83.17 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 83.17 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 83.13 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 83.1 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 83.04 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 82.96 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 82.88 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 82.79 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 82.56 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 82.53 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 82.49 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 82.45 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 82.43 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 82.43 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 82.27 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 82.2 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 82.12 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 82.05 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 81.88 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 81.87 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 81.69 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 81.67 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 81.58 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 81.52 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 81.39 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 81.36 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 81.35 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 81.34 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 81.15 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 81.15 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 80.97 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 80.96 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 80.95 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 80.93 | |
| d1rq2a1 | 198 | Cell-division protein FtsZ {Mycobacterium tubercul | 80.79 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 80.62 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 80.61 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 80.43 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 80.41 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 80.29 |
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: Amyloid beta precursor protein-binding protein 1, APPBP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.1e-63 Score=580.88 Aligned_cols=380 Identities=24% Similarity=0.328 Sum_probs=288.5
Q ss_pred hhhHhhhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhcCCEEEEEeCCccCccCCccccccCcCccCchHH
Q 002073 155 DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRA 234 (972)
Q Consensus 155 ~~d~~~YsRQi~l~G~e~q~kL~~s~VlIvG~gGlG~EiaKNLvLaGVg~itLvD~d~V~~~DL~~qffl~~~DIGk~RA 234 (972)
-++++|||||||+||.+||++|++++|+|+|+||+|+|+||||+|+|||+|||+|++.|+.+||+||||++++|||++||
T Consensus 2 ~~ke~rYdRQlrlwG~~gQ~~L~~s~VlvvG~gglG~Ei~knLvl~GVg~itivD~d~v~~sdL~rqf~~~~~diGk~ka 81 (529)
T d1yova1 2 LLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRA 81 (529)
T ss_dssp HHHHHHTHHHHHHHHHHHHHHHHHCEEEECCCSHHHHHHHHHHHTTTCSEEEEECCSBCCHHHHHHCTTCCGGGTTSBHH
T ss_pred chhhhhhhHHHHhhhHHHHHHHhCCCEEEECCCHHHHHHHHHHHHhcCCEEEEEcCCcCChhhcCchhcCChhhCCCHHH
Confidence 36889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhcCCCEEEEeecCC------ChhhhcCCceEEEcCCCHHHHHHHHHHHHhcCCCceeEEeeecceeEEEEE
Q 002073 235 LASVQKLQELNNAVVLSTLTSKL------TKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFC 308 (972)
Q Consensus 235 ea~~~~L~eLNp~V~V~~~~~~l------~~e~l~~fdvVV~~~~~~~~~~~ln~~c~~~~~~IpfI~a~~~G~~G~vf~ 308 (972)
++++++|++|||+|+++.+...+ +++++.+||+||+|.++.+.+..++++||+++ ||||.+++.|++|++|+
T Consensus 82 ~~~~~~L~~lNp~v~i~~~~~~~~~~~~~~~~~~~~~dvVv~~~~~~~~~~~l~~~c~~~~--ip~i~~~~~G~~G~v~~ 159 (529)
T d1yova1 82 EAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQ--IPLLICRTYGLVGYMRI 159 (529)
T ss_dssp HHHHHHHHTTCTTSBCCEESSCHHHHHHSCGGGGGGCSEEEEESCCHHHHHHHHHHHHHHT--CCEEEEEEETTEEEEEE
T ss_pred HHHHHHHHHhCCCCcEEEEcCCchhhhhhHHHHhcCCCEEEECCCCHHHHHHHHHHHHHcC--CCEEEEeccCCEEEEEE
Confidence 99999999999999999887654 34789999999999999999999999999999 99999999999999999
Q ss_pred EcCCceEEecCCCCCCcceeecccccCCCceeeccccccccc-------------------------ccCC-------ee
Q 002073 309 DFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEF-------------------------QDGD-------LV 356 (972)
Q Consensus 309 dfg~~f~v~d~~ge~p~~~~I~~I~~~~~~lVt~~~~~rh~~-------------------------~dgd-------~V 356 (972)
|+|+ |.+++++++.+... .++.+++|++....+..+..- .+|. ..
T Consensus 160 ~~~~-~~~~e~~p~~~~~d--lrl~~p~p~l~~~~~~~d~~~~~~~~~~~vP~~vil~~~l~~~~~~~~g~~p~~~~ek~ 236 (529)
T d1yova1 160 IIKE-HPVIESHPDNALED--LRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKE 236 (529)
T ss_dssp ECSC-EEESCCCCSSCCCC--CCSSSCCHHHHHHHHTCCSSSSCHHHHTTSCHHHHHHHHHHHHHHHTCCCCCCTTTHHH
T ss_pred EeCC-ceEEecCCCCCCCc--cccCCCcHHHHHHHhhcCcccCCccccCcCchHHHHHHHHHHHHHhcCCCCCCcHHHHH
Confidence 9996 77888888776544 345566666654433211100 0010 00
Q ss_pred EEEee--ccccccCC-------------------------------------------CC-Ccee-------------cc
Q 002073 357 VFSEV--HGMTELND-------------------------------------------GK-PRKI-------------KS 377 (972)
Q Consensus 357 ~f~ev--~gm~eln~-------------------------------------------~~-~~~I-------------~~ 377 (972)
.|.++ .||...++ .. ++.+ ..
T Consensus 237 ~~k~~i~~~~~~~~~~~~~~eeNf~EA~~~~~~~~~~~~ip~~i~~ll~~~~~~~~~~~s~~Fw~l~~alk~F~~~~~~g 316 (529)
T d1yova1 237 DFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQG 316 (529)
T ss_dssp HHHHHHHTSSCBCTTSSBCCCHHHHHHHHHHHHHSSCCSCCHHHHHHHTSHHHHSCCSSCCHHHHHHHHHHHHHHTTTSS
T ss_pred HHHHHHHhhhhcccccCCCccccHHHHHHHHHHhhCCCCCCHHHHHHhcCcccccCCCCCccHHHHHHHHHHHHHhcCCC
Confidence 11111 11111000 00 0000 00
Q ss_pred cCcceeee---------------------ccccccccceeecceE------------------EEeecCeeecccchhhh
Q 002073 378 ARPYSFTL---------------------EEDTTNYGTYVKGGIV------------------TQVKQPKVLNFKPLREA 418 (972)
Q Consensus 378 ~~~~~f~i---------------------~~Dt~~f~~y~~gG~~------------------~qvk~pk~i~fksL~e~ 418 (972)
.-|.+..+ ..|...|..|+...+. ......+.++|+++.+.
T Consensus 317 ~lPl~g~lPDm~s~t~~Yi~Lq~iY~~Ka~~D~~~~~~~v~~~l~~~~~~~~~i~~~~i~~F~kn~~~l~~~~~~~l~~e 396 (529)
T d1yova1 317 NLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEE 396 (529)
T ss_dssp SCCCCCCCCCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSSSCHHHHHHHHHTTTSCEEECCCCHHHH
T ss_pred CCCCCCCCCCcccChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCcCCHHHHHHHHhhhhhcceeccCchHhh
Confidence 11222222 1122222222221100 00111245677888877
Q ss_pred hcCCC---ccccccCccCCCCChHHHHHHHHHHHHHHhCCCCCCCC---hhhHHHHHHHHHHHHhhcCCCCCCCCCHHHH
Q 002073 419 LEDPG---DFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGS---EEDAQKLISVATNINESLGDGRVEDINTKLL 492 (972)
Q Consensus 419 l~~p~---~~l~~d~~k~~r~~~lh~~~~aL~~F~~~~grlP~~~~---~~Da~~l~~la~~i~~~~~~~~~~~ide~lv 492 (972)
...+. ..+..++.+.+++..+|++|+|+++|.++|||+|++++ .+|..++..++.++....+. ...++++++
T Consensus 397 ~~~~~~~~~~l~~~~~~~~~~~~l~~~~~a~~~f~~~~~r~P~~~~~~~~~d~~~l~~~~~~~~~~~~~--~~~~~~~~i 474 (529)
T d1yova1 397 YGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGL--SVMVKDDYV 474 (529)
T ss_dssp HCTTTSCHHHHHHHTTSTTSTHHHHHHHHHHHHHHHHSSSCTTSSTTTHHHHHHHHHHHHHHHHHHHTC--CCCCCHHHH
T ss_pred hcccccchhHHhhhhhcccchHHHHHHHHHHHHHHHHhCCCCCCccchhHhHHHHHHHHHHHHhhhccc--cccchHHHH
Confidence 66441 12445566667788899999999999999999999887 56777888888887777653 346889999
Q ss_pred HHHHhhcccccCchhhHhhhhhhhhHhhhhcCCccccceeeEeeeccCC
Q 002073 493 RHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESL 541 (972)
Q Consensus 493 ~~~a~~~~~el~PvaA~iGGiaAQEVIKaiTgKf~PI~q~~yfD~~e~L 541 (972)
+++||+++++|||||||+||+|||||||+|||||+||+|||||||+++-
T Consensus 475 ~e~~r~~~~el~~vaA~~GGiaaQEviK~iT~qy~Pi~n~~i~dgi~~~ 523 (529)
T d1yova1 475 HEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQT 523 (529)
T ss_dssp HHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHTCSBCCSSEEEEETTTTE
T ss_pred HHHHHHcCCcccHHHHHHHHHHHHHHHHHHhcCeeccCCcEEEecCCCe
Confidence 9999999999999999999999999999999999999999999999874
|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|