Citrus Sinensis ID: 002108

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-----
MAGQTATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAVLPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTSAQTPATAPKPQAPDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVKSTPAAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAPHVSGTWGPVAGVQQPHASRPPTGKPPRPFPVPQADRSVQTTPQKSKVPELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDSKSEKDASEGKDATEEKGASKEKDASKGEEISENEPAHEQNEDGLARGRPNSSAGSGATENQSKEVQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKGFDEPSWGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
cccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHHHHHHHHHccccccccEcHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEcccccccccccccccccHHHHHccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccEEEEEcc
magqtatnsDLFEAYFRRadldgdgqisGAEAVAffqgsnlpkQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAAlygpasaripapqinlaampsshsrvgapasqvsgapspqnvsvrgpqglgnastnqqsppsqsnhfvrtpqavlpgttlhpqqvlsgqsmpsggtmtaprpptsnvstdwlggstvsplagsttqlpnrgsspslpqegfglpasslapsvqprppitsggragsplagttsqvsdrgisasstldrfglpassvapsvqprppgtsaqtpatapkpqapdskslvvsgngfssdslfgdvfsaspvqpkqdvaisgsvptstasvpaspapkpslkagpvepvqhafsqppvggqyqqgqsagkqnqqfavkstpaaastgfpigalnstssqshvpwpkmthseVQKYTKVFVQVDidrdgkitgEQAYNLFLSWRLPREVLKQVWdlsdqdndgmLSLKEFCTALYLMERyregrplptmlpstimpdealfsttsqpqaphvsgtwgpvagvqqphasrpptgkpprpfpvpqadrsvqttpqkskvpELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNRLNEitervsgdKREVELLAKKYEEKYKqsgdvaskltleeATFRDIQEKKMELYQAILKMegesgdgtlQQHADHIQNELEELVKILNDRCKqyglrakptllvelpfgwqpgiqegtadwdedwdklEDEGFTFVKELTLEVqnvvappkpksssvknetssnkhdatasssnidsksekdasegkdateekgaskekdaskgeeisenepaheqnedglargrpnssagsgatenqskevqdfqimkdigadgspqaketqsdevgpesvfsgnkgfdepswgtfdthydaesvwgfdtdnskVCEELLFYIAN
magqtatnsdLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTvaqskreltPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAVLPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTSAQTPATAPKPQAPDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVKSTPAAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLsdqdndgmLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAPHVSGTWGPVAGVQQPHASRPPTGKPPRPFPVpqadrsvqttpqkskvpelEKHLMDQLSKEEQESLNAKLkeateadkkvEELEKEiltsrekiqfCSTKMQELILYKSRCDNRLNeitervsgdkreVELLAKKYeekykqsgdvaskltleeatFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLevqnvvappkpksssvknetssnkhdatasssnidsksekdasegkdateekgaskekdaskgeeisenepaheqnedglarGRPNSSAGSGATENQSKEVQDFQIMKDIGADGSPQaketqsdevgpesvFSGNKGFDEPSWGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
MAGQTATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTnqqsppsqsnHFVRTPQAVLPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTSaqtpatapkpqapDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGsvptstasvpaspapkpslkaGPVEPVQHAFSQPPVggqyqqgqsagkqnqqFAVKSTPAAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAPHVSGTWGPVAGVQQPHASRpptgkpprpfpvpQADRSVQTTPQKSKVPELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNRLNEITERVSGDKREVELLAkkyeekykQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTAdwdedwdkledeGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDSKSEKDASEGKDATEEKGASKEKDASKGEEISENEPAHEQNEDGLARGRPNSSAGSGATENQSKEVQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKGFDEPSWGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
**********LFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPA****************************************************************************************************************************************************************************************************************************************************************************************************************************************************SEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREG*********************************************************************************************************************REKIQFCSTKMQELILYKSRCDNRLNEIT************************************TFRDI***KMELYQAILK***************HIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVV**************************************************************************************************************************************PSWGTFDTHYDAESVWGFDTDNSKVCEELLFYI**
****T**NSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPD********************************************************************************************************************LGGSTVSPL*******************GFGLPASSLA*********************************************************************QAPDS********************************************************************************************************************WPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLP**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************TFDTHYDAESVW***************Y***
********SDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAM************************VRGPQGL****************FVRTPQAVLPGTTLHPQQVLSGQ**************TSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSG********************ASSTLDRFGLPAS********************************VVSGNGFSSDSLFGDVFSASPVQPKQDVA**********************KAGPVEPVQHAFSQP*************************AAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFS**********SGTWGPVAGVQ*************RPFPVP**************VPELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVVA*******************************************************************************************KEVQDFQIMKDIGAD*****************VFSGNKGFDEPSWGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
********SDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAVLPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSG****************************************************************************LFGDVFSASPVQPKQDVAISGSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPP*********************************************PWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDE**********************G**QPHASRP*TGK********************SKVPELEKHL*DQLS**EQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVV**************************************************************************************************************************************P*WGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGQTATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAVLPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTSAQTPATAPKPQAPDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVKSTPAAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAPHVSGTWGPVAGVQQPHASRPPTGKPPRPFPVPQADRSVQTTPQKSKVPELEKHLMDQLSKEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIQFCSTKMQELILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDSKSEKDASEGKDATEEKGASKEKDASKGEEISENEPAHEQNEDGLARGRPNSSAGSGATENQSKEVQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKGFDEPSWGTFDTHYDAESVWGFDTDNSKVCEELLFYIAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query965 2.2.26 [Sep-21-2011]
Q9HGL2 1116 Uncharacterized calcium-b yes no 0.094 0.081 0.380 2e-16
Q96D71796 RalBP1-associated Eps dom yes no 0.116 0.140 0.379 6e-13
O54916795 RalBP1-associated Eps dom yes no 0.121 0.147 0.352 7e-13
Q75AA0 1248 Actin cytoskeleton-regula yes no 0.162 0.125 0.319 4e-12
A6S9N4 1444 Actin cytoskeleton-regula N/A no 0.098 0.065 0.364 4e-11
Q15811 1721 Intersectin-1 OS=Homo sap no no 0.174 0.097 0.287 4e-11
Q8NFH8660 RalBP1-associated Eps dom no no 0.106 0.156 0.365 5e-11
Q80XA6521 RalBP1-associated Eps dom no no 0.113 0.211 0.319 5e-11
A4R8N4 1462 Actin cytoskeleton-regula N/A no 0.096 0.063 0.372 8e-11
A2R180 1434 Actin cytoskeleton-regula no no 0.101 0.068 0.343 9e-11
>sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=4 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 62/92 (67%), Gaps = 1/92 (1%)

Query: 429 PWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDG 488
           PW  +   ++  + ++F  VD    G ++G +AY+ FL+ +LP +VL Q+WDLSD +++G
Sbjct: 252 PW-AIPSQDLTSFCQLFSNVDKAHKGYVSGSEAYSFFLASKLPEDVLAQIWDLSDTNSNG 310

Query: 489 MLSLKEFCTALYLMERYREGRPLPTMLPSTIM 520
            L++ EFC +LYL++    G+ LP +LPS+++
Sbjct: 311 KLNIGEFCISLYLIKLKLSGKELPKVLPSSML 342

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q96D71|REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens GN=REPS1 PE=1 SV=3 Back     alignment and function description
>sp|O54916|REPS1_MOUSE RalBP1-associated Eps domain-containing protein 1 OS=Mus musculus GN=Reps1 PE=1 SV=2 Back     alignment and function description
>sp|Q75AA0|PAN1_ASHGO Actin cytoskeleton-regulatory complex protein PAN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN1 PE=3 SV=2 Back     alignment and function description
>sp|A6S9N4|PAN1_BOTFB Actin cytoskeleton-regulatory complex protein pan1 OS=Botryotinia fuckeliana (strain B05.10) GN=pan1 PE=3 SV=1 Back     alignment and function description
>sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 Back     alignment and function description
>sp|Q8NFH8|REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens GN=REPS2 PE=1 SV=2 Back     alignment and function description
>sp|Q80XA6|REPS2_MOUSE RalBP1-associated Eps domain-containing protein 2 OS=Mus musculus GN=Reps2 PE=1 SV=1 Back     alignment and function description
>sp|A4R8N4|PAN1_MAGO7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN1 PE=3 SV=2 Back     alignment and function description
>sp|A2R180|PAN1_ASPNC Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query965
224081495896 predicted protein [Populus trichocarpa] 0.898 0.967 0.578 0.0
359474793 1089 PREDICTED: uncharacterized protein LOC10 0.925 0.820 0.520 0.0
147810085 1120 hypothetical protein VITISV_043723 [Viti 0.930 0.801 0.514 0.0
3565534231037 PREDICTED: uncharacterized protein LOC10 0.887 0.825 0.513 0.0
449500203 1112 PREDICTED: uncharacterized protein LOC10 0.903 0.784 0.511 0.0
449454416 1110 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.903 0.785 0.508 0.0
356499525994 PREDICTED: uncharacterized protein LOC10 0.848 0.823 0.5 0.0
297845134 1222 calcium-binding EF hand family protein [ 0.897 0.708 0.517 0.0
42562225 1218 calcium-binding EF-hand-containing prote 0.900 0.713 0.508 0.0
334182746 1247 calcium-binding EF-hand-containing prote 0.900 0.696 0.492 0.0
>gi|224081495|ref|XP_002306434.1| predicted protein [Populus trichocarpa] gi|222855883|gb|EEE93430.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/978 (57%), Positives = 659/978 (67%), Gaps = 111/978 (11%)

Query: 6   ATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAE 65
           A N+DLF++YFRRADLDGDGQISGAEAV FFQGS+LPKQVLAQVW HADQR AG+L R E
Sbjct: 2   ANNTDLFDSYFRRADLDGDGQISGAEAVGFFQGSSLPKQVLAQVWMHADQRNAGYLGRQE 61

Query: 66  FFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSG 125
           F+NALKLVTVAQSKRELTP+IVKAALYGPASA+IPAPQINLAA P+   +  APA Q+SG
Sbjct: 62  FYNALKLVTVAQSKRELTPEIVKAALYGPASAKIPAPQINLAATPAP--KTVAPAPQLSG 119

Query: 126 ---APSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQ----AVLPGTTLHPQQVLSG 178
              A SP NV +R PQ  GNA TNQQ  PSQ   F R PQ    A+ P ++ HPQQ+L  
Sbjct: 120 TTPASSP-NVGIRPPQVPGNAVTNQQYFPSQQGQFTRQPQPQTQAMPPNSSSHPQQILVS 178

Query: 179 QSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSL 238
           Q MP                    GG+ V+P                             
Sbjct: 179 QGMPR-------------------GGTVVAP----------------------------- 190

Query: 239 APSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTS 298
               +P     S    G   AG TSQ   RGI   +T D FGL A    PSVQPRP  T+
Sbjct: 191 ----RPLNSNISTDWLGGSAAGLTSQGPSRGIGHPATQDGFGLSAPGFTPSVQPRPQVTA 246

Query: 299 AQTPATAPKPQAP----------DSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISG 348
            Q  A  PKPQ            DSKS+VVSGNGF+SDSLFGDVFSA+P QPKQ  + S 
Sbjct: 247 GQIAAPTPKPQEAAITSNQLATRDSKSVVVSGNGFASDSLFGDVFSATPAQPKQSSSSSA 306

Query: 349 S----VPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVK 404
                +P S+A V +S   +PS+K   ++ +Q  F Q  VGGQ     S  + NQQ   +
Sbjct: 307 HSTSSIPVSSAIVSSSVGSQPSVKPSSLDSLQSTFPQQHVGGQ-----STARPNQQVPSQ 361

Query: 405 STPAAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNL 464
           S  +A S GF +G  N+  SQS  PWP+MT S++QKYTKVFVQVD DRDGK+TGEQA NL
Sbjct: 362 SVTSAPSAGFSVGTSNAAPSQSQPPWPRMTQSDIQKYTKVFVQVDTDRDGKLTGEQARNL 421

Query: 465 FLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEA 524
           FLSWRLPREVLK+VWDLSDQDND MLSL+EFCTALYLMERYREGRPLP  LP+T+M DE 
Sbjct: 422 FLSWRLPREVLKKVWDLSDQDNDSMLSLREFCTALYLMERYREGRPLPATLPTTVMSDET 481

Query: 525 LFSTTSQPQAPHVSGTWGPVAGVQQPHA------SRPPTGKPPRPFPVPQADRSVQTTPQ 578
           L S TS P A +  G+WGP +G++Q               +PPRP   P AD   Q T Q
Sbjct: 482 LLSATSHPAASYGGGSWGPASGLRQQQVVSGARPPPAAAARPPRPPTAPHADEK-QPTQQ 540

Query: 579 KSKVPELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQE 638
           K KVP LEKHL+ QLS+EEQ++LN+K +EA++ADKKVEELEKEIL SR+KI+F   KMQE
Sbjct: 541 KHKVPVLEKHLVHQLSQEEQDTLNSKFQEASQADKKVEELEKEILDSRQKIEFYRVKMQE 600

Query: 639 LILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEK 698
           LILYKSRCDNRLNE+T RVS DK EVE L KKYEEKYKQSGDVASKLT+EEATFRDIQEK
Sbjct: 601 LILYKSRCDNRLNEVTTRVSADKHEVETLGKKYEEKYKQSGDVASKLTIEEATFRDIQEK 660

Query: 699 KMELYQAILKM-EGESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPF 757
           KM+LY+AI+KM EG + DG L++ A++IQ+ LEELVK +N+RCKQYGLR+KPT LVELPF
Sbjct: 661 KMDLYRAIVKMEEGGAADGVLKERAENIQSNLEELVKTVNERCKQYGLRSKPTSLVELPF 720

Query: 758 GWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDA 817
           GWQ GIQEG ADWDE WDKLEDEGF FVKELTL+VQNVVAPPK K +SV+  T+S + D 
Sbjct: 721 GWQHGIQEGAADWDEGWDKLEDEGFIFVKELTLDVQNVVAPPKEK-TSVQKATTSTEKDL 779

Query: 818 TASSSNIDSKSEKDASEGKDATEEKGASKEKDASKGEEISENEPAHEQNEDGLARGRPNS 877
            AS SN + K+EK  S  K       ++ EKD           P H Q+E+G  R  P+ 
Sbjct: 780 GASPSNAEVKAEKVPSPRK-------SNSEKDI----------PDH-QHENGSLRSPPD- 820

Query: 878 SAGSGATENQSKEVQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKGFDEPSWGTFD 937
           S G    ENQS E +D    K+ GAD SP AKETQSD  G ESV  G K   EP WGTFD
Sbjct: 821 SPGRTTKENQSNEFRD-SPFKESGADNSPHAKETQSDVGGTESVHFGEK-IVEPGWGTFD 878

Query: 938 THYDAESVWGFDTDNSKV 955
           T YD+ESVWGFD+ + KV
Sbjct: 879 TPYDSESVWGFDSVSGKV 896

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359474793|ref|XP_003631533.1| PREDICTED: uncharacterized protein LOC100854676 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147810085|emb|CAN64708.1| hypothetical protein VITISV_043723 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553423|ref|XP_003545056.1| PREDICTED: uncharacterized protein LOC100794495 [Glycine max] Back     alignment and taxonomy information
>gi|449500203|ref|XP_004161034.1| PREDICTED: uncharacterized protein LOC101230942 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454416|ref|XP_004144951.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101213771 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499525|ref|XP_003518590.1| PREDICTED: uncharacterized protein LOC100793159 [Glycine max] Back     alignment and taxonomy information
>gi|297845134|ref|XP_002890448.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297336290|gb|EFH66707.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42562225|ref|NP_173582.2| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] gi|332192007|gb|AEE30128.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182746|ref|NP_001185056.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] gi|332192008|gb|AEE30129.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query965
TAIR|locus:2030432 1019 AT1G20760 [Arabidopsis thalian 0.759 0.719 0.358 1.7e-98
POMBASE|SPBC800.10c 1116 SPBC800.10c "EPS15 repeat fami 0.147 0.127 0.306 2e-25
UNIPROTKB|F1S6G0 911 EPS15 "Uncharacterized protein 0.115 0.121 0.321 1.6e-23
RGD|1305550 792 Eps15 "epidermal growth factor 0.104 0.127 0.339 3.8e-23
UNIPROTKB|E9PSY8 792 Eps15 "Protein Eps15" [Rattus 0.104 0.127 0.339 4.8e-23
UNIPROTKB|F1NLF0 919 EPS15 "Uncharacterized protein 0.291 0.305 0.234 5e-18
UNIPROTKB|F1MA55 885 Eps15 "Protein Eps15" [Rattus 0.104 0.114 0.339 2.2e-22
UNIPROTKB|E1C8N9 921 EPS15 "Uncharacterized protein 0.291 0.305 0.234 1.3e-17
ASPGD|ASPL0000061296 1258 AN0317 [Emericella nidulans (t 0.115 0.088 0.350 9.3e-22
UNIPROTKB|G4MKQ3 1300 MGG_06649 "EF hand domain-cont 0.124 0.092 0.330 2.7e-21
TAIR|locus:2030432 AT1G20760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 978 (349.3 bits), Expect = 1.7e-98, P = 1.7e-98
 Identities = 281/783 (35%), Positives = 373/783 (47%)

Query:   189 APRP-PTSNV--STDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGF-GLPASSLAPSVQP 244
             APRP P +         GG        +    P + +    P +G  GL  +SL P+  P
Sbjct:   110 APRPNPAATTVGPVSGFGGPGAPNAIVNQNYFPPQQNQQMRPNQGISGL--TSLRPAAGP 167

Query:   245 --RPPITSGGRAGSPLAGTTS--QVSDRGISA--SSTLDRFGLPASSVAPSVQPRP--PG 296
               RP   SG     P+   T   Q     +S   SST +   L A +   S        G
Sbjct:   168 EYRPSALSGQFQPVPVGSVTHPPQPVPTSVSGPGSSTFNLNSLYAGAGNTSGYSSGFGGG 227

Query:   297 TSXXXXXXXXXXXXXDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGXXXXXXXX 356
             +              D K+LVVSGNG       GD+FS+   Q KQ+  +S         
Sbjct:   228 SLAAPSPGLKQESHIDPKALVVSGNG-------GDMFSS--FQQKQEPTLSNSSISSAIV 278

Query:   357 XXXXXXXXXXXXXGPVEPVQHAFSQPPVXXXXXXXXXXXXXXXXFAVKSTPAAASTGFPI 416
                            ++ +Q  FS  P                  + +   +    G  +
Sbjct:   279 PTSAGIQPPTKPNA-LDSLQSTFSMLPSGNQLQQPRPAASSQPAVSSQGPSSGLPPGSAV 337

Query:   417 GALNST-SSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVL 475
             G+ +ST +  +  PWPKM  S+VQKYTKVF++VD D+DGKITGEQA NLFLSWRLPREVL
Sbjct:   338 GSGHSTPAGNNQPPWPKMKPSDVQKYTKVFMEVDSDKDGKITGEQARNLFLSWRLPREVL 397

Query:   476 KQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAP 535
             K VW+LSDQDND MLSL+EFC +LYLMERYREGRPLPT LPS+IM DE L S +  P   
Sbjct:   398 KHVWELSDQDNDTMLSLREFCISLYLMERYREGRPLPTALPSSIMFDETLLSISGAPSHG 457

Query:   536 HVSGTWGPVAG-VQQPH-ASRXXXXXXXXX----XXXXQADRSVQTTPQKSKVPELEKHL 589
             + +  WG   G VQQP   +R                 Q    +     +++ P L+   
Sbjct:   458 YANAGWGSGQGFVQQPGMGARPITPTTGMRPPVPAPGPQPGSGIPPNQPRNQAPVLDAPF 517

Query:   590 MDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNR 649
              + L      S N  L EA   ++KV+E +   + SREK+ +  TKMQ+++LYKSRCDNR
Sbjct:   518 ANHLGNGYSASSN--LPEAAADEEKVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNR 575

Query:   650 LNEITERVSGDKREVELLAXXXXXXXXQSGDVASKLTLEEATFRDIQEKKMELYQAILKM 709
             LNEI+ER S DKRE E LA        Q  ++ SKLT+EEA FR+I+ +KMEL QAI+ M
Sbjct:   576 LNEISERASADKREAETLAKKYEEKYKQVAEIGSKLTIEEARFREIEGRKMELSQAIVNM 635

Query:   710 E-GESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTA 768
             E G S DG LQ  AD IQ++LEEL+K L +RCK++GL      LV+LP GWQPGIQEG A
Sbjct:   636 EQGGSADGLLQVRADRIQSDLEELMKALTERCKKHGLEVNSKALVDLPAGWQPGIQEGAA 695

Query:   769 XXXXXXXXXXXXGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDSKS 828
                         GF    E+T +          K +   ++ S      T    N    S
Sbjct:   696 LWDEEWDKFEDEGFG--NEITFDKSKEQNSSGEKENGTVDDGSGPPDSPTHVEDNYGPFS 753

Query:   829 EKDASEGKDATEEKGASKEKDAS-KGEEISENEPAHEQNEDGLARGRPNSSAGSGATENQ 887
             E   +  +    E G +  +D S +   +S N  A E      ++G+ NS     +    
Sbjct:   754 E---TSDRHHESEYGTTHSEDRSPRDSPVSRN--ATEVPSPDYSQGK-NSEFFDDSNWAS 807

Query:   888 SKEVQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKG-FDEPSWGTFDTHYDAESVW 946
             + +  D  +    G D S   K    D  G    F GN    D PS  +F      +S +
Sbjct:   808 AFDTND-DVDSVWGFDAS---KSQDGDYFGSGDDFGGNTARADSPSSRSFGAQ--RKSQF 861

Query:   947 GFD 949
              FD
Sbjct:   862 AFD 864
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0005829 "cytosol" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
GO:0051645 "Golgi localization" evidence=RCA
GO:0051646 "mitochondrion localization" evidence=RCA
GO:0060151 "peroxisome localization" evidence=RCA
POMBASE|SPBC800.10c SPBC800.10c "EPS15 repeat family actin cortical patch component (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6G0 EPS15 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1305550 Eps15 "epidermal growth factor receptor pathway substrate 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSY8 Eps15 "Protein Eps15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLF0 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MA55 Eps15 "Protein Eps15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8N9 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061296 AN0317 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKQ3 MGG_06649 "EF hand domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00050406
hypothetical protein (896 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 2e-23
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 9e-23
smart0002796 smart00027, EH, Eps15 homology domain 4e-22
smart0002796 smart00027, EH, Eps15 homology domain 8e-16
pfam12763104 pfam12763, efhand_3, Cytoskeletal-regulatory compl 2e-12
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 4e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 8e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-04
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 2e-04
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-04
COG5651490 COG5651, COG5651, PPE-repeat proteins [Cell motili 5e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 6e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 7e-04
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 7e-04
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 0.001
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.001
pfam1320225 pfam13202, EF_hand_3, EF hand 0.001
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.003
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.004
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.004
pfam03234172 pfam03234, CDC37_N, Cdc37 N terminal kinase bindin 0.004
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.004
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information 
 Score = 93.8 bits (234), Expect = 2e-23
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 441 YTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALY 500
           Y ++F  +D D DG I+G++A        LPR VL Q+WDL+D D DG L  +EF  A++
Sbjct: 1   YDQIFRSLDPDGDGLISGDEARPFLGKSGLPRSVLAQIWDLADTDKDGKLDKEEFAIAMH 60

Query: 501 LMERYRE 507
           L+     
Sbjct: 61  LIALALN 67

The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs. Length = 67
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|193239 pfam12763, efhand_3, Cytoskeletal-regulatory complex EF hand Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217443 pfam03234, CDC37_N, Cdc37 N terminal kinase binding Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 965
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 100.0
KOG0998847 consensus Synaptic vesicle protein EHS-1 and relat 100.0
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 99.83
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 99.83
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 99.83
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 99.65
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.64
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.35
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 99.34
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 99.29
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 99.16
cd0005267 EH Eps15 homology domain; found in proteins implic 99.05
cd0005267 EH Eps15 homology domain; found in proteins implic 99.03
KOG0998 847 consensus Synaptic vesicle protein EHS-1 and relat 99.02
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.82
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.67
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.66
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.52
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.49
PF00038312 Filament: Intermediate filament protein; InterPro: 98.48
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.47
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.46
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.45
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.44
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.44
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.43
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.42
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.36
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.36
PTZ00183158 centrin; Provisional 98.32
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.29
PTZ00184149 calmodulin; Provisional 98.27
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.26
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.21
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.18
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.14
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.13
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.11
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.11
PTZ00184149 calmodulin; Provisional 98.1
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.09
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.06
PTZ00183158 centrin; Provisional 98.03
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.98
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.96
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.95
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.9
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.85
PRK11637428 AmiB activator; Provisional 97.85
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.8
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 97.8
PF1465866 EF-hand_9: EF-hand domain 97.78
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.78
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.73
PRK09039343 hypothetical protein; Validated 97.71
PRK11637428 AmiB activator; Provisional 97.64
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.54
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.53
PRK09039343 hypothetical protein; Validated 97.5
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.46
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.45
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 97.44
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.43
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 97.42
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.4
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.4
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 97.38
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.35
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.35
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 97.33
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.32
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.31
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.3
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.27
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.23
PF10186302 Atg14: UV radiation resistance protein and autopha 97.22
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.15
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 97.14
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.11
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.09
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.08
COG4942420 Membrane-bound metallopeptidase [Cell division and 97.06
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.06
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 97.03
PLN02964644 phosphatidylserine decarboxylase 97.01
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.01
PF1465866 EF-hand_9: EF-hand domain 97.0
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.98
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.98
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.97
KOG0377631 consensus Protein serine/threonine phosphatase RDG 96.97
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.96
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.96
PRK03918 880 chromosome segregation protein; Provisional 96.93
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 96.93
PRK02224880 chromosome segregation protein; Provisional 96.92
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.9
PLN02964644 phosphatidylserine decarboxylase 96.88
PRK03918880 chromosome segregation protein; Provisional 96.88
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.88
KOG09331174 consensus Structural maintenance of chromosome pro 96.83
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.82
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.81
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.8
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.78
PRK04863 1486 mukB cell division protein MukB; Provisional 96.77
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.76
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.76
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.75
PRK04863 1486 mukB cell division protein MukB; Provisional 96.74
PRK02224880 chromosome segregation protein; Provisional 96.71
KOG0036463 consensus Predicted mitochondrial carrier protein 96.7
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 96.7
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.69
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 96.68
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 96.67
PF00038312 Filament: Intermediate filament protein; InterPro: 96.67
COG11961163 Smc Chromosome segregation ATPases [Cell division 96.66
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.65
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 96.65
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.6
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.58
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.58
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.54
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.54
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.48
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.47
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 96.46
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.46
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.45
PHA02562562 46 endonuclease subunit; Provisional 96.45
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.44
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.41
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.41
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 96.39
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.39
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 96.34
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.34
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.34
KOG0977546 consensus Nuclear envelope protein lamin, intermed 96.33
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.32
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 96.27
PF13851201 GAS: Growth-arrest specific micro-tubule binding 96.23
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 96.22
PF10186302 Atg14: UV radiation resistance protein and autopha 96.21
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.2
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.2
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.17
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.16
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 96.16
KOG0036463 consensus Predicted mitochondrial carrier protein 96.14
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 96.14
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.13
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.13
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.12
PRK04778569 septation ring formation regulator EzrA; Provision 96.1
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 96.09
PRK04778569 septation ring formation regulator EzrA; Provision 96.08
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.08
TIGR006061311 rad50 rad50. This family is based on the phylogeno 96.07
COG4372499 Uncharacterized protein conserved in bacteria with 96.05
KOG0964 1200 consensus Structural maintenance of chromosome pro 96.05
PF13851201 GAS: Growth-arrest specific micro-tubule binding 96.03
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 96.02
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 95.96
KOG0038189 consensus Ca2+-binding kinase interacting protein 95.96
PRK11519719 tyrosine kinase; Provisional 95.95
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 95.93
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.91
PF05701522 WEMBL: Weak chloroplast movement under blue light; 95.9
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.89
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 95.89
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 95.88
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 95.87
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 95.85
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 95.85
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.82
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.82
COG4942420 Membrane-bound metallopeptidase [Cell division and 95.81
KOG0971 1243 consensus Microtubule-associated protein dynactin 95.81
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.77
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 95.75
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.73
KOG09331174 consensus Structural maintenance of chromosome pro 95.71
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 95.69
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 95.68
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.66
KOG0964 1200 consensus Structural maintenance of chromosome pro 95.64
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.63
PRK10698222 phage shock protein PspA; Provisional 95.63
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.62
TIGR006061311 rad50 rad50. This family is based on the phylogeno 95.57
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.56
PF04949159 Transcrip_act: Transcriptional activator; InterPro 95.53
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.52
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.51
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 95.5
KOG4302 660 consensus Microtubule-associated protein essential 95.48
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.47
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.47
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 95.46
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 95.45
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.43
PRK11281 1113 hypothetical protein; Provisional 95.43
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 95.43
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 95.42
PRK10884206 SH3 domain-containing protein; Provisional 95.41
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.4
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 95.35
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 95.31
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 95.31
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 95.31
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 95.23
KOG0979 1072 consensus Structural maintenance of chromosome pro 95.16
KOG4302 660 consensus Microtubule-associated protein essential 95.15
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 95.14
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.13
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 95.12
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 95.09
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 95.04
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 95.03
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.03
COG2433652 Uncharacterized conserved protein [Function unknow 95.0
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 94.96
KOG4673 961 consensus Transcription factor TMF, TATA element m 94.93
KOG0018 1141 consensus Structural maintenance of chromosome pro 94.87
PF05911769 DUF869: Plant protein of unknown function (DUF869) 94.87
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.85
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 94.82
COG4372499 Uncharacterized protein conserved in bacteria with 94.81
PRK01156 895 chromosome segregation protein; Provisional 94.79
COG2433652 Uncharacterized conserved protein [Function unknow 94.78
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 94.76
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.66
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 94.65
PRK12704520 phosphodiesterase; Provisional 94.65
PRK11281 1113 hypothetical protein; Provisional 94.63
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.62
PRK10929 1109 putative mechanosensitive channel protein; Provisi 94.58
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 94.58
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 94.58
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 94.57
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.56
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 94.55
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.55
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 94.53
PF15397258 DUF4618: Domain of unknown function (DUF4618) 94.52
PRK10869553 recombination and repair protein; Provisional 94.51
KOG0288459 consensus WD40 repeat protein TipD [General functi 94.44
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.42
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 94.41
PRK10361475 DNA recombination protein RmuC; Provisional 94.38
PF15066527 CAGE1: Cancer-associated gene protein 1 family 94.37
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.36
PF05911769 DUF869: Plant protein of unknown function (DUF869) 94.33
KOG4677554 consensus Golgi integral membrane protein [Intrace 94.29
PF122521439 SidE: Dot/Icm substrate protein; InterPro: IPR0210 94.29
KOG0288459 consensus WD40 repeat protein TipD [General functi 94.27
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.26
PRK00106535 hypothetical protein; Provisional 94.23
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 94.18
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 94.17
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 94.16
PRK15178434 Vi polysaccharide export inner membrane protein Ve 94.16
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 94.15
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 94.15
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 94.14
PF135141111 AAA_27: AAA domain 94.1
TIGR00634563 recN DNA repair protein RecN. All proteins in this 94.07
KOG1003205 consensus Actin filament-coating protein tropomyos 94.03
TIGR00634563 recN DNA repair protein RecN. All proteins in this 94.03
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 93.97
PRK11519 719 tyrosine kinase; Provisional 93.96
KOG4809654 consensus Rab6 GTPase-interacting protein involved 93.94
PF13514 1111 AAA_27: AAA domain 93.94
PF15254861 CCDC14: Coiled-coil domain-containing protein 14 93.92
PRK10476346 multidrug resistance protein MdtN; Provisional 93.9
KOG0018 1141 consensus Structural maintenance of chromosome pro 93.89
PRK10884206 SH3 domain-containing protein; Provisional 93.87
PRK09343121 prefoldin subunit beta; Provisional 93.87
PRK03947140 prefoldin subunit alpha; Reviewed 93.85
PF15294278 Leu_zip: Leucine zipper 93.73
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 93.72
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 93.69
COG5185622 HEC1 Protein involved in chromosome segregation, i 93.63
PF09602165 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion prot 93.56
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 93.55
PF14988206 DUF4515: Domain of unknown function (DUF4515) 93.53
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 93.52
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 93.48
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 93.48
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 93.45
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 93.41
PF05010207 TACC: Transforming acidic coiled-coil-containing p 93.4
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.4
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 93.36
KOG4251362 consensus Calcium binding protein [General functio 93.35
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.33
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 93.33
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 93.31
COG5185622 HEC1 Protein involved in chromosome segregation, i 93.23
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 93.22
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.21
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 93.18
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 93.14
TIGR02977219 phageshock_pspA phage shock protein A. Members of 93.11
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.08
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 93.04
KOG4251362 consensus Calcium binding protein [General functio 93.04
PRK10869553 recombination and repair protein; Provisional 93.01
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 93.0
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 92.96
KOG2129552 consensus Uncharacterized conserved protein H4 [Fu 92.96
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 92.94
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 92.94
PF07851330 TMPIT: TMPIT-like protein; InterPro: IPR012926 A n 92.92
KOG0979 1072 consensus Structural maintenance of chromosome pro 92.9
COG3206458 GumC Uncharacterized protein involved in exopolysa 92.87
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 92.84
KOG0963629 consensus Transcription factor/CCAAT displacement 92.84
KOG4673 961 consensus Transcription factor TMF, TATA element m 92.82
PF13870177 DUF4201: Domain of unknown function (DUF4201) 92.79
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 92.78
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 92.78
PRK12705508 hypothetical protein; Provisional 92.74
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 92.74
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 92.65
PRK10698222 phage shock protein PspA; Provisional 92.63
KOG0038189 consensus Ca2+-binding kinase interacting protein 92.6
TIGR03545555 conserved hypothetical protein TIGR03545. This mod 92.57
PF15066527 CAGE1: Cancer-associated gene protein 1 family 92.56
PF12126324 DUF3583: Protein of unknown function (DUF3583); In 92.54
KOG0963629 consensus Transcription factor/CCAAT displacement 92.49
cd00176213 SPEC Spectrin repeats, found in several proteins i 92.48
PRK102461047 exonuclease subunit SbcC; Provisional 92.44
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 92.42
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 92.4
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 92.36
PRK09343121 prefoldin subunit beta; Provisional 92.3
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 92.27
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 92.27
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.21
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 92.19
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 92.15
KOG2129552 consensus Uncharacterized conserved protein H4 [Fu 92.15
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 92.13
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 92.11
KOG4065144 consensus Uncharacterized conserved protein [Funct 92.11
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 92.09
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 92.07
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 92.04
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 92.01
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 91.98
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.97
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 91.93
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 91.89
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 91.8
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 91.7
PF08702146 Fib_alpha: Fibrinogen alpha/beta chain family; Int 91.69
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 91.68
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 91.67
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.66
KOG2991330 consensus Splicing regulator [RNA processing and m 91.66
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 91.64
PRK03947140 prefoldin subunit alpha; Reviewed 91.63
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 91.59
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 91.58
PF13166712 AAA_13: AAA domain 91.56
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 91.53
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 91.47
PF15397258 DUF4618: Domain of unknown function (DUF4618) 91.46
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 91.46
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.43
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 91.42
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 91.4
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 91.4
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.38
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.37
TIGR02231 525 conserved hypothetical protein. This family consis 91.29
COG3206458 GumC Uncharacterized protein involved in exopolysa 91.21
PRK03598331 putative efflux pump membrane fusion protein; Prov 91.17
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 91.13
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 91.07
KOG4603201 consensus TBP-1 interacting protein [Signal transd 91.03
KOG1003205 consensus Actin filament-coating protein tropomyos 91.0
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 90.98
TIGR00293126 prefoldin, archaeal alpha subunit/eukaryotic subun 90.98
PRK00286438 xseA exodeoxyribonuclease VII large subunit; Revie 90.82
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 90.78
PF02994370 Transposase_22: L1 transposable element; InterPro: 90.67
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 90.65
KOG4065144 consensus Uncharacterized conserved protein [Funct 90.62
COG5283 1213 Phage-related tail protein [Function unknown] 90.61
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 90.58
PRK102461047 exonuclease subunit SbcC; Provisional 90.55
COG4026290 Uncharacterized protein containing TOPRIM domain, 90.53
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 90.53
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 90.48
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 90.43
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 90.42
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 90.31
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 90.31
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 90.3
PRK00409782 recombination and DNA strand exchange inhibitor pr 90.23
PF09731582 Mitofilin: Mitochondrial inner membrane protein; I 90.18
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 90.16
PF15456124 Uds1: Up-regulated During Septation 90.15
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 90.15
PF13949296 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI 90.11
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 90.06
KOG4657246 consensus Uncharacterized conserved protein [Funct 90.05
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 90.05
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 90.03
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 90.03
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 90.03
PF06705247 SF-assemblin: SF-assemblin/beta giardin 90.01
KOG3091508 consensus Nuclear pore complex, p54 component (sc 90.0
PRK12704 520 phosphodiesterase; Provisional 89.95
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 89.84
PRK10361475 DNA recombination protein RmuC; Provisional 89.78
COG3096 1480 MukB Uncharacterized protein involved in chromosom 89.7
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 89.7
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 89.66
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 89.63
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 89.63
PRK06569155 F0F1 ATP synthase subunit B'; Validated 89.62
PRK00106 535 hypothetical protein; Provisional 89.61
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 89.51
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 89.43
KOG1850391 consensus Myosin-like coiled-coil protein [Cytoske 89.35
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 89.33
PRK10929 1109 putative mechanosensitive channel protein; Provisi 89.33
COG4913 1104 Uncharacterized protein conserved in bacteria [Fun 89.32
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 89.28
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 89.09
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.07
KOG2891445 consensus Surface glycoprotein [General function p 89.04
KOG3478120 consensus Prefoldin subunit 6, KE2 family [Posttra 89.03
PRK00286438 xseA exodeoxyribonuclease VII large subunit; Revie 89.01
COG4717984 Uncharacterized conserved protein [Function unknow 88.99
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 88.96
PRK07720146 fliJ flagellar biosynthesis chaperone; Validated 88.96
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.95
TIGR02231525 conserved hypothetical protein. This family consis 88.88
KOG2751447 consensus Beclin-like protein [Signal transduction 88.71
PF14282106 FlxA: FlxA-like protein 88.66
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 88.65
COG3524372 KpsE Capsule polysaccharide export protein [Cell e 88.62
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 88.61
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 88.59
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 88.58
PF09766355 FimP: Fms-interacting protein; InterPro: IPR019163 88.54
cd08915342 V_Alix_like Protein-interacting V-domain of mammal 88.5
PRK12705 508 hypothetical protein; Provisional 88.48
KOG4603201 consensus TBP-1 interacting protein [Signal transd 88.34
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 88.25
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 88.25
PF04949159 Transcrip_act: Transcriptional activator; InterPro 88.24
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 88.21
PF15450 531 DUF4631: Domain of unknown function (DUF4631) 88.19
KOG2685421 consensus Cystoskeletal protein Tektin [Cytoskelet 88.18
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 88.16
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 88.15
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 87.92
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 87.86
KOG2010405 consensus Double stranded RNA binding protein [Gen 87.85
PRK10476346 multidrug resistance protein MdtN; Provisional 87.83
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 87.75
PF11172201 DUF2959: Protein of unknown function (DUF2959); In 87.74
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 87.74
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 87.64
PF15456124 Uds1: Up-regulated During Septation 87.59
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 87.59
PF05010207 TACC: Transforming acidic coiled-coil-containing p 87.5
PF04375372 HemX: HemX; InterPro: IPR007470 The majority of pr 87.49
PF09731582 Mitofilin: Mitochondrial inner membrane protein; I 87.42
KOG4403575 consensus Cell surface glycoprotein STIM, contains 87.4
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 87.38
KOG3091508 consensus Nuclear pore complex, p54 component (sc 87.32
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 87.28
PF13863126 DUF4200: Domain of unknown function (DUF4200) 87.25
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 87.23
COG4477570 EzrA Negative regulator of septation ring formatio 87.19
PRK03598331 putative efflux pump membrane fusion protein; Prov 87.13
PF14362301 DUF4407: Domain of unknown function (DUF4407) 87.12
KOG0247809 consensus Kinesin-like protein [Cytoskeleton] 87.05
PF02994370 Transposase_22: L1 transposable element; InterPro: 86.93
KOG1962216 consensus B-cell receptor-associated protein and r 86.92
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 86.83
TIGR00237432 xseA exodeoxyribonuclease VII, large subunit. This 86.8
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 86.8
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 86.74
PRK13923170 putative spore coat protein regulator protein YlbO 86.72
PF06248 593 Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 86.72
PF04871136 Uso1_p115_C: Uso1 / p115 like vesicle tethering pr 86.67
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 86.65
PF11802268 CENP-K: Centromere-associated protein K; InterPro: 86.6
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 86.56
PLN031881320 kinesin-12 family protein; Provisional 86.45
cd07623224 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of 86.45
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-39  Score=366.34  Aligned_cols=98  Identities=35%  Similarity=0.638  Sum_probs=94.3

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHHHHH
Q 002108          425 QSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMER  504 (965)
Q Consensus       425 ~~~~~Wp~IS~eEk~ry~~~F~~lDkD~dG~ISg~Elr~~f~ks~Lp~eeL~~IW~LaD~D~DGkLs~dEFvvAM~LI~~  504 (965)
                      +....| .|....+.+|+++|+.+|+.+.||+|+.++|.+|..++|++..|++||.|.|+|+||+|+.+||++|||||+.
T Consensus       182 ~q~~eW-AVp~~~klKY~QlFNa~DktrsG~Lsg~qaR~aL~qS~Lpq~~LA~IW~LsDvd~DGkL~~dEfilam~liem  260 (1118)
T KOG1029|consen  182 NQLEEW-AVPQHNKLKYRQLFNALDKTRSGYLSGQQARSALGQSGLPQNQLAHIWTLSDVDGDGKLSADEFILAMHLIEM  260 (1118)
T ss_pred             hhhhhc-cccchhhhHHHHHhhhcccccccccccHHHHHHHHhcCCchhhHhhheeeeccCCCCcccHHHHHHHHHHHHH
Confidence            335679 6999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCCCCCCCCCc
Q 002108          505 YREGRPLPTMLPSTIMPDE  523 (965)
Q Consensus       505 ~~~G~~LP~~LPp~L~pp~  523 (965)
                      ++.|.+||.+||+.|+||+
T Consensus       261 a~sGq~lP~tlP~E~Vpp~  279 (1118)
T KOG1029|consen  261 AKSGQPLPKTLPPELVPPS  279 (1118)
T ss_pred             HhcCCCCCCCCChhhcCcc
Confidence            9999999999999999996

>KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09602 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg); InterPro: IPR011728 This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03545 conserved hypothetical protein TIGR03545 Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF12126 DUF3583: Protein of unknown function (DUF3583); InterPro: IPR021978 This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5283 Phage-related tail protein [Function unknown] Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF15456 Uds1: Up-regulated During Septation Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4657 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>PF06705 SF-assemblin: SF-assemblin/beta giardin Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PRK07720 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09766 FimP: Fms-interacting protein; InterPro: IPR019163 This entry represents Thoc5 which is one of the subunits of the THO complex, which additionally contains: HPR1, Thoc2, Thoc6 and Thoc7 Back     alignment and domain information
>cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF15450 DUF4631: Domain of unknown function (DUF4631) Back     alignment and domain information
>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>KOG2010 consensus Double stranded RNA binding protein [General function prediction only] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF11172 DUF2959: Protein of unknown function (DUF2959); InterPro: IPR021342 This family of proteins with unknown function appears to be restricted to Gammaproteobacteria Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PF15456 Uds1: Up-regulated During Septation Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF04375 HemX: HemX; InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2 Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information
>KOG0247 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells Back     alignment and domain information
>PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>PF11802 CENP-K: Centromere-associated protein K; InterPro: IPR020993 Cenp-K is one of seven new Cenp-A-nucleosome distal (CAD) centromere components (the others being Cenp-L, Cenp-O, Cenp-P, Cenp-Q, Cenp-R and Cenp-S) that are identified as assembling on the Cenp-A nucleosome associated complex, NAC [] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
1iq3_A110 Solution Structure Of The Eps15 Homology Domain Of 2e-12
1fi6_A92 Solution Structure Of The Reps1 Eh Domain Length = 3e-11
2qpt_A550 Crystal Structure Of An Ehd Atpase Involved In Memb 2e-10
2kgr_A111 Solution Structure Of Protein Itsn1 From Homo Sapie 4e-10
1qjt_A99 Solution Structure Of The Apo Eh1 Domain Of Mouse E 6e-09
1qjt_A99 Solution Structure Of The Apo Eh1 Domain Of Mouse E 5e-04
2khn_A121 Nmr Solution Structure Of The Eh 1 Domain From Huma 1e-08
1eh2_A106 Structure Of The Second Eps15 Homology Domain Of Hu 3e-08
1ff1_A95 Structure Of The Second Eps15 Homology Domain Of Hu 5e-08
1f8h_A95 Structure Of The Second Eps15 Homology Domain Of Hu 5e-08
3fia_A121 Crystal Structure Of The Eh 1 Domain From Human Int 6e-08
2jxc_A100 Structure Of The Eps15-Eh2 Stonin2 Complex Length = 7e-08
2kff_A105 Structure Of The C-Terminal Domain Of Ehd1 With Fny 3e-07
2jq6_A139 Structure Of Eh-Domain Of Ehd1 Length = 139 4e-07
1c07_A95 Structure Of The Third Eps15 Homology Domain Of Hum 3e-06
>pdb|1IQ3|A Chain A, Solution Structure Of The Eps15 Homology Domain Of A Human Pob1 Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)
Query: 417 GALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLK 476
           G+L   SS    PW ++T  + + Y   F  +  D    I+G  A N F   +L    L 
Sbjct: 1   GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59
Query: 477 QVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPD 522
            +W+LSD D DG L+L EFC A +L+   + G PLP  LP T+ P+
Sbjct: 60  YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPE 105
>pdb|1FI6|A Chain A, Solution Structure Of The Reps1 Eh Domain Length = 92 Back     alignment and structure
>pdb|2QPT|A Chain A, Crystal Structure Of An Ehd Atpase Involved In Membrane Remodelling Length = 550 Back     alignment and structure
>pdb|2KGR|A Chain A, Solution Structure Of Protein Itsn1 From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr5524a Length = 111 Back     alignment and structure
>pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 Back     alignment and structure
>pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 Back     alignment and structure
>pdb|2KHN|A Chain A, Nmr Solution Structure Of The Eh 1 Domain From Human Intersectin-1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|1EH2|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1FF1|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15 In Complex With Ptgssstnpfl Length = 95 Back     alignment and structure
>pdb|1F8H|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15 In Complex With Ptgssstnpfr Length = 95 Back     alignment and structure
>pdb|3FIA|A Chain A, Crystal Structure Of The Eh 1 Domain From Human Intersectin- 1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|2JXC|A Chain A, Structure Of The Eps15-Eh2 Stonin2 Complex Length = 100 Back     alignment and structure
>pdb|2KFF|A Chain A, Structure Of The C-Terminal Domain Of Ehd1 With Fnyestnpftak Length = 105 Back     alignment and structure
>pdb|2JQ6|A Chain A, Structure Of Eh-Domain Of Ehd1 Length = 139 Back     alignment and structure
>pdb|1C07|A Chain A, Structure Of The Third Eps15 Homology Domain Of Human Eps15 Length = 95 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-35
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 5e-18
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 2e-33
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 3e-20
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 7e-33
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 2e-19
1c07_A95 Protein (epidermal growth factor receptor pathway 9e-31
1c07_A95 Protein (epidermal growth factor receptor pathway 8e-19
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 3e-30
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 6e-17
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 5e-30
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 9e-15
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 8e-30
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 2e-16
2jq6_A139 EH domain-containing protein 1; metal binding prot 3e-28
2jq6_A139 EH domain-containing protein 1; metal binding prot 6e-15
1qjt_A99 EH1, epidermal growth factor receptor substrate su 5e-25
1qjt_A99 EH1, epidermal growth factor receptor substrate su 9e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 3e-08
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-07
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 6e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-07
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 8e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-04
3li6_A66 Calcium-binding protein; calcium signaling protein 5e-07
3li6_A66 Calcium-binding protein; calcium signaling protein 1e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 8e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-05
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-06
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 4e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 5e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 4e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 7e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 9e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 9e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 9e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 3e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 4e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-05
2hps_A186 Coelenterazine-binding protein with bound coelent; 4e-05
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 7e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 6e-05
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 2e-04
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 7e-05
1y1x_A191 Leishmania major homolog of programmed cell death 9e-05
1y1x_A191 Leishmania major homolog of programmed cell death 4e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-04
2xs1_A704 Programmed cell death 6-interacting protein; prote 1e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-04
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 5e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-04
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-04
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 6e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 4e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 5e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 7e-04
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
 Score =  128 bits (324), Expect = 3e-35
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 417 GALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLK 476
           G+L   SS    PW ++T  + + Y   F  +  D    I+G  A N F   +L    L 
Sbjct: 1   GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59

Query: 477 QVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPD 522
            +W+LSD D DG L+L EFC A +L+   + G PLP  LP T+ P+
Sbjct: 60  YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPE 105
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query965
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.87
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.83
1c07_A95 Protein (epidermal growth factor receptor pathway 99.82
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.81
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.81
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.8
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.79
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.75
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.75
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.74
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.72
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.72
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.72
1c07_A95 Protein (epidermal growth factor receptor pathway 99.69
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.67
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.66
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.62
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.59
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.27
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.27
1y1x_A191 Leishmania major homolog of programmed cell death 99.19
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 99.18
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 99.16
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.14
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.13
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.06
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.01
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.0
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.99
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.98
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.97
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.94
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.9
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.86
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.84
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.84
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.82
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.8
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.8
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.8
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.79
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.79
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.78
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.76
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.76
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.76
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.76
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.75
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.74
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.74
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.73
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.72
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.72
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.71
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.71
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.71
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.71
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.7
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.7
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.69
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.68
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.68
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.68
3li6_A66 Calcium-binding protein; calcium signaling protein 98.68
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.67
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.66
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.66
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.66
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.66
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.66
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.66
3fwb_A161 Cell division control protein 31; gene gating, com 98.65
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.65
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.65
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.65
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.65
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.65
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.65
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.65
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.64
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.64
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.64
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.64
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.64
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.64
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.64
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.64
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.64
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.63
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.63
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.63
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.63
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.62
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.61
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.61
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.61
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.6
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.6
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.6
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.59
3li6_A66 Calcium-binding protein; calcium signaling protein 98.58
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.58
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.57
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.57
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.57
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.57
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.57
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.56
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.56
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.56
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.56
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.56
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.55
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.55
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.55
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.55
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.55
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.55
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.55
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.54
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.54
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.54
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.53
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.53
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.53
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.53
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.52
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.51
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.51
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.51
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.51
3fwb_A161 Cell division control protein 31; gene gating, com 98.5
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.5
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.5
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.49
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.49
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.49
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.49
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.48
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.48
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.48
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.47
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.47
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.47
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.46
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.46
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.45
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.45
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.45
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.45
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.45
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.45
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.45
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.44
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.44
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.44
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.44
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.44
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.44
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.44
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.43
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.43
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.43
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.43
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.42
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.42
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.42
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.42
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.42
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.42
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.41
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.41
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.41
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.41
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.41
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.41
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.4
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.4
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.4
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.4
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.4
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.4
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.4
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.39
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.39
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.39
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.38
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.38
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.38
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.38
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.38
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.37
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.37
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.36
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.36
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.36
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.36
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.35
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.34
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.34
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.34
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.34
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.33
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.32
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.32
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.31
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.31
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.31
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.3
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.3
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.29
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.29
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.29
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.28
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.28
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.28
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.27
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.27
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.27
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.26
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.25
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.23
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.23
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.22
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.22
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.22
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.22
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.21
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.21
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.21
1y1x_A191 Leishmania major homolog of programmed cell death 98.21
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.21
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.2
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.2
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.19
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.19
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.19
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.18
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.17
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.17
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.17
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.17
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.16
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.16
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.15
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.15
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.15
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.15
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.15
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.14
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.14
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.13
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.13
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.13
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.13
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.13
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.11
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.1
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.1
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.09
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.08
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.08
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.07
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.07
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.07
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.06
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.06
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.05
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.04
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.03
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.02
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.02
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.01
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.0
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.0
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.99
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.99
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.99
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.99
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.99
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 97.98
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 97.98
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.97
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.97
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.96
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.96
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.96
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.96
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.94
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 97.94
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.93
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.92
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.87
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.84
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.83
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.78
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.78
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.67
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.62
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.52
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.48
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.47
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.44
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.4
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.38
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.34
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.32
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.29
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.22
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.21
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 97.21
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 97.11
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.08
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.04
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 97.01
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 96.95
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.94
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.94
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.88
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.88
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.87
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.72
1x8y_A86 Lamin A/C; structural protein, intermediate filame 96.71
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.68
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 96.68
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.63
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.5
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 96.21
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.16
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 96.14
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.14
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 96.09
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 96.04
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.92
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 95.88
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.86
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.76
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.66
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.53
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.45
3mov_A95 Lamin-B1; LMNB1, B-type lamins, intermediate filam 95.44
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.31
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 95.29
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 95.07
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.82
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.76
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.69
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rin 94.64
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 94.61
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 94.47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 94.41
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.34
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.33
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 94.29
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 94.27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 94.13
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.04
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 93.85
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 93.82
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 93.78
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 93.71
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 93.67
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 93.62
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rin 93.61
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 93.35
3uun_A119 Dystrophin; triple helical, cell structure and sta 93.29
3tul_A158 Cell invasion protein SIPB; translocator, type thr 93.21
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 93.2
1m1j_A491 Fibrinogen alpha subunit; coiled coils, disulfide 93.15
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 93.13
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 92.98
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 92.94
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 92.73
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 92.7
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.7
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 92.65
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 92.61
2efl_A305 Formin-binding protein 1; EFC domain, structural g 92.61
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 92.6
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 92.54
3plt_A234 Sphingolipid long chain base-responsive protein L; 92.54
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 92.51
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 92.4
2v4h_A110 NF-kappa-B essential modulator; transcription, met 92.22
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 92.21
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 92.2
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 92.08
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 92.02
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 92.0
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 91.92
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.7
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 91.39
3bas_A89 Myosin heavy chain, striated muscle/general contro 91.22
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 91.06
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 91.02
3l4q_C170 Phosphatidylinositol 3-kinase regulatory subunit b 90.96
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 90.91
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 90.72
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 90.68
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 90.53
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 90.41
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 90.41
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 90.28
1d7m_A101 Cortexillin I; coiled-coil, coiled-coil trigger si 90.26
3ghg_B461 Fibrinogen beta chain; triple-stranded coiled coil 90.26
3bas_A89 Myosin heavy chain, striated muscle/general contro 89.89
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 89.67
3etw_A119 Adhesin A; antiparallel helix-loop-helix, leucine 89.47
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 89.24
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 89.19
3ajw_A150 Flagellar FLIJ protein; flagellum, type III secret 89.19
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 89.16
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 89.02
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 89.02
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 88.87
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 88.52
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 88.41
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 88.4
3ni0_A99 Bone marrow stromal antigen 2; coiled-coil, antivi 88.13
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 88.0
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 87.97
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 87.66
3abh_A312 Pacsin2, protein kinase C and casein kinase substr 87.65
2avr_X119 Adhesion A; antiparallel helix-loop-helix, leucine 87.59
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 87.54
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 87.19
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 87.03
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 86.95
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 86.91
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 86.89
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 86.74
2x3v_A337 Syndapin I, protein kinase C and casein kinase sub 86.22
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 86.07
2jrf_A184 Tubulin polymerization-promoting protein family me 86.07
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 85.77
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.58
3lay_A175 Zinc resistance-associated protein; salmonella typ 85.45
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 85.3
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 85.22
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 85.19
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 85.17
3lay_A175 Zinc resistance-associated protein; salmonella typ 85.15
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 84.96
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 84.85
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 84.37
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 84.37
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 84.33
2qyw_A102 Vesicle transport through interaction with T-SNAR 84.31
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 84.13
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 83.92
3uux_B242 Mitochondrial division protein 1; tetratricopeptid 83.84
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 83.77
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 83.61
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 83.58
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 83.57
2efl_A305 Formin-binding protein 1; EFC domain, structural g 83.52
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 83.2
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 83.12
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 82.71
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 82.53
3ghg_C411 Fibrinogen gamma chain; triple-stranded coiled coi 82.3
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 82.25
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 82.16
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 82.02
3qwe_A279 GMIP, GEM-interacting protein; structural genomics 81.61
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 81.0
2v4h_A110 NF-kappa-B essential modulator; transcription, met 80.99
3c9i_A242 Tail needle protein GP26; xenon, coiled-coil, prot 80.82
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 80.77
3ni0_A99 Bone marrow stromal antigen 2; coiled-coil, antivi 80.59
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 80.44
1fio_A196 SSO1 protein; four helix bundle, alpha helix, memb 80.3
3rrk_A357 V-type ATPase 116 kDa subunit; alpha beta fold, pr 80.28
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
Probab=99.87  E-value=2.5e-22  Score=192.16  Aligned_cols=96  Identities=35%  Similarity=0.567  Sum_probs=90.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHHHHHH
Q 002108          426 SHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERY  505 (965)
Q Consensus       426 ~~~~Wp~IS~eEk~ry~~~F~~lDkD~dG~ISg~Elr~~f~ks~Lp~eeL~~IW~LaD~D~DGkLs~dEFvvAM~LI~~~  505 (965)
                      ...+| .|+++|+++|+++|+.+|+ ++|+|++++++.+|++++|+.++|++||+++|.|+||+|+|+||++|||||+++
T Consensus        21 ~~~~W-~it~ee~~~y~~iF~~lD~-~dG~Isg~elr~~~~~sgLp~~~L~~Iw~laD~d~dG~Ld~~EF~~aM~Li~~~   98 (121)
T 3fia_A           21 SLDTW-AITVEERAKHDQQFHSLKP-ISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLK   98 (121)
T ss_dssp             CTTTS-CCCHHHHHHHHHHHHHTCC-BTTBEEHHHHHHHHGGGCCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHHHH
T ss_pred             CCCCC-CCCHHHHHHHHHHHHHhCC-CCCeECHHHHHHHHHHcCCCHHHHHHHHHHHcCCCCCcCCHHHHHHHHHHHHHH
Confidence            34689 6999999999999999998 899999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCCCCCCCCCCCc
Q 002108          506 REGRPLPTMLPSTIMPDE  523 (965)
Q Consensus       506 ~~G~~LP~~LPp~L~pp~  523 (965)
                      ++|++||.+||+.|+.+.
T Consensus        99 ~~G~~lP~~LP~~l~~~~  116 (121)
T 3fia_A           99 LQGYQLPSALPPVMKQQP  116 (121)
T ss_dssp             HTTCCCCSSCCGGGC---
T ss_pred             HcCCCCCCCCCHHHHcCC
Confidence            999999999999998773
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3tul_A Cell invasion protein SIPB; translocator, type three secretion system, coiled-coil, VIRU cell invasion; 2.79A {Salmonella enterica subsp} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Back     alignment and structure
>3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Back     alignment and structure
>2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>3uux_B Mitochondrial division protein 1; tetratricopeptide repeat, mitochondrial fission, mitochondri cytoplasm, apoptosis; 3.90A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure
>1fio_A SSO1 protein; four helix bundle, alpha helix, membrane protein; 2.10A {Saccharomyces cerevisiae} SCOP: a.47.2.1 Back     alignment and structure
>3rrk_A V-type ATPase 116 kDa subunit; alpha beta fold, proton pump, subunit I/A, V-ATPase, proton; HET: NHE; 2.64A {Meiothermus ruber} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 965
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 5e-24
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 1e-09
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-22
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 5e-12
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 6e-22
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 6e-13
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9e-21
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 2e-12
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 2e-18
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 4e-16
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-05
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-08
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 9e-08
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 6e-06
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-07
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 3e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 1e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 8e-07
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.002
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 1e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 1e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-06
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.004
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-06
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 6e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 9e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 2e-05
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-05
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-05
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 8e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 4e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 5e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.004
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 8e-05
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 9e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 0.001
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 1e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 1e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 0.001
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 4e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.001
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.001
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 0.002
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.002
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.002
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.003
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.004
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Eps15 homology domain (EH domain)
domain: Pob1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 95.5 bits (237), Expect = 5e-24
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 417 GALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLK 476
           G+L   SS    PW ++T  + + Y   F  +  D    I+G  A N F   +L    L 
Sbjct: 1   GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59

Query: 477 QVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPD 522
            +W+LSD D DG L+L EFC A +L+   + G PLP  LP T+ P+
Sbjct: 60  YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPE 105
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query965
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.2
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.16
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.16
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.14
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.06
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.04
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.98
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.98
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.94
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.94
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.91
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.88
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.87
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.84
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.83
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.81
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.79
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.77
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.77
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.73
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.73
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.72
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.68
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.68
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.67
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.64
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.64
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.64
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.64
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.63
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.62
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.59
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.59
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.58
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.58
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.57
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.56
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.55
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.55
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.55
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.54
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.54
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.53
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.53
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.52
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.52
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.51
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.5
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.48
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.48
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.47
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.47
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.47
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.47
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.46
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.46
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.46
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.46
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.44
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.44
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.41
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.39
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.39
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.38
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.37
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.36
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.36
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.34
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.34
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.33
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.33
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.32
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.31
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.31
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.31
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.3
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.28
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.26
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.26
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.25
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.23
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.22
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.21
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.2
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.2
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.2
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.2
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.19
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.17
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.17
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.16
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.15
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.14
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.11
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.1
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.1
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.09
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.09
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.08
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.07
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.06
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.05
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.05
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.04
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.03
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.01
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.95
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.93
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.92
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.91
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.91
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.91
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.89
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.87
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.86
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.85
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.85
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.85
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.82
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.82
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.79
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.78
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.76
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.57
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.51
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.49
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.47
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.46
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.45
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.35
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.24
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.18
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.03
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.03
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.84
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 96.62
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.51
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.33
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.27
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.23
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.93
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 95.85
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.74
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 94.92
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.82
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 94.62
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.25
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 93.89
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 92.88
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 92.73
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 92.67
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 91.58
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 91.16
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 90.52
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 89.88
d1ez3a_124 Syntaxin 1A N-terminal domain {Rat (Rattus norvegi 89.82
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 88.73
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 88.71
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.45
d1quua1124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 87.54
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 87.43
d1ez3a_124 Syntaxin 1A N-terminal domain {Rat (Rattus norvegi 86.53
d1u5pa2101 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 85.98
d1fioa_196 Sso1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 85.95
d1s35a1106 Spectrin beta chain {Human (Homo sapiens) [TaxId: 85.84
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 84.26
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 83.24
d1s35a2105 Spectrin beta chain {Human (Homo sapiens) [TaxId: 82.67
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 81.46
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Eps15 homology domain (EH domain)
domain: Pob1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=4.5e-23  Score=191.23  Aligned_cols=102  Identities=36%  Similarity=0.658  Sum_probs=97.2

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhcCCCCCccCHHHHHHHH
Q 002108          420 NSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTAL  499 (965)
Q Consensus       420 ~~~~~~~~~~Wp~IS~eEk~ry~~~F~~lDkD~dG~ISg~Elr~~f~ks~Lp~eeL~~IW~LaD~D~DGkLs~dEFvvAM  499 (965)
                      .+++..+..+| .|+++|+++|+++|+.+|+|++|+|++++++.+|++++|+.++|.+||+++|.|++|.|+++||++||
T Consensus         4 ~~~~~~~~~~~-~lt~ee~~~y~~lF~~~D~d~~G~Is~~e~~~~l~~s~L~~~~L~~Iw~l~D~d~dG~l~~~EF~~am   82 (110)
T d1iq3a_           4 QDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAF   82 (110)
T ss_dssp             CCCCCCCCSSC-CCSSSSHHHHHHHHHHHCCSSSSEEEHHHHHHHCCSSSCSSCCHHHHHHHHCSSSCSEEEHHHHHHHH
T ss_pred             CCCCCCCCCCC-ccCHHHHHHHHHHHHHhCCCcccchhHHHHHHHHHhhccchHHHHHHHHHhccCCCCeECHHHHHHHH
Confidence            34456778899 79999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCCCCCCCCCC
Q 002108          500 YLMERYREGRPLPTMLPSTIMPD  522 (965)
Q Consensus       500 ~LI~~~~~G~~LP~~LPp~L~pp  522 (965)
                      |||.++++|++||..||+.|+|.
T Consensus        83 ~Li~~~~~G~~lP~~LP~~l~p~  105 (110)
T d1iq3a_          83 HLIVARKNGYPLPEGLPPTLQPE  105 (110)
T ss_dssp             HHHHHHHHTCCCCCCSSCCSCSS
T ss_pred             HHHHHHHcCCCCCcccCcccCcc
Confidence            99999999999999999999987
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure