Citrus Sinensis ID: 002124
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 964 | 2.2.26 [Sep-21-2011] | |||||||
| Q6NPP4 | 1050 | Calmodulin-binding transc | yes | no | 0.938 | 0.861 | 0.504 | 0.0 | |
| Q9FY74 | 1007 | Calmodulin-binding transc | no | no | 0.890 | 0.852 | 0.483 | 0.0 | |
| Q8GSA7 | 1032 | Calmodulin-binding transc | no | no | 0.893 | 0.834 | 0.408 | 1e-174 | |
| Q9FYG2 | 1016 | Calmodulin-binding transc | no | no | 0.570 | 0.541 | 0.383 | 4e-93 | |
| O23463 | 923 | Calmodulin-binding transc | no | no | 0.581 | 0.607 | 0.352 | 4e-81 | |
| Q9LSP8 | 838 | Calmodulin-binding transc | no | no | 0.536 | 0.616 | 0.352 | 4e-79 | |
| Q9Y6Y1 | 1673 | Calmodulin-binding transc | yes | no | 0.087 | 0.050 | 0.311 | 4e-08 | |
| A2A891 | 1682 | Calmodulin-binding transc | yes | no | 0.087 | 0.049 | 0.322 | 5e-08 | |
| O94983 | 1202 | Calmodulin-binding transc | no | no | 0.070 | 0.056 | 0.384 | 2e-07 | |
| Q80Y50 | 1208 | Calmodulin-binding transc | no | no | 0.084 | 0.067 | 0.351 | 2e-07 |
| >sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 849 bits (2193), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 500/991 (50%), Positives = 639/991 (64%), Gaps = 86/991 (8%)
Query: 1 MLEQDLMHIVFVHYLEVQGNKSNVGDRESNEVTSNPGKHSSLTFSFPGNRTKAPSGITDS 60
MLEQDLMHIVFVHYLEV+GN+ + + N S G S + +
Sbjct: 119 MLEQDLMHIVFVHYLEVKGNRMSTSGTKENHSNSLSGTGSV--------------NVDST 164
Query: 61 TSPTSTLTLSCEDADSGYDAEDSHQASSRAHLYYELPQMGNGPRMEKMDSGLSYSYFLSP 120
+ +S L+ CEDADSG DS QASS E PQ M ++ SY
Sbjct: 165 ATRSSILSPLCEDADSG----DSRQASSSLQQNPE-PQTVVPQIMHHQNASTINSY---- 215
Query: 121 SSGCPEVRSSIPGDYVSHAGHIPNDNQDLMIECQKALGLASWEEVLEHCSGENDNVPPHA 180
V + G +H + N Q++ + +W+ E+ N+P +A
Sbjct: 216 --NTTSVLGNRDGWTSAHGNRVKGSN------SQRSGDVPAWDASFENSLARYQNLPYNA 267
Query: 181 KL-------------ESNVQKENIFDGELLSREASEENSGSSLPVQFNWQIPLADNSSHF 227
L E +K ++ E L + L Q NWQ P+ + S
Sbjct: 268 PLTQTQPSTFGLIPMEGKTEKGSLLTSEHLR---------NPLQSQVNWQTPVQE-SVPL 317
Query: 228 LKSIMDLSRDLEPAYDLGDGLFEQRTHD-----ACLLGAPEPFCAFLDQQNELPVQNNLQ 282
K MD + A DL LF Q H+ + LLG+ + P NN
Sbjct: 318 QKWPMDSHSGMTDATDLA--LFGQGAHENFGTFSSLLGS----QDQQSSSFQAPFTNN-- 369
Query: 283 MQQRDVESHSQTKSNSESEIHGEGTINFSFSVKQKLLNGEGNLEKVDSFSRWMSKELEEV 342
E+ K E I+ E + N + +++ LL E +L+KVDSFSRW+SKEL E+
Sbjct: 370 ------EAAYIPKLGPEDLIY-EASANQTLPLRKALLKKEDSLKKVDSFSRWVSKELGEM 422
Query: 343 DNLHVQSS--GIEWSTEECGNVVDDSSLSPSLSQDQLFSIIDFSPKWTYTDPEIEVVVTG 400
++L +QSS GI W++ EC N SSLSPSLS+DQ F++IDF PKWT TD E+EV+V G
Sbjct: 423 EDLQMQSSSGGIAWTSVECENAAAGSSLSPSLSEDQRFTMIDFWPKWTQTDSEVEVMVIG 482
Query: 401 MFLKSHQEVAKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPFYITCSNRLACSEV 460
FL S QEV WSCMF EVEVPA++L DGVLCC PPH VGRVPFYITCS+R +CSEV
Sbjct: 483 TFLLSPQEVTSYSWSCMFGEVEVPADILVDGVLCCHAPPHEVGRVPFYITCSDRFSCSEV 542
Query: 461 REFDYIVGSVKDADISDIYGSSTSESFLHLRLERILSMRSSPQ-NHLSEGLCEKQKLISK 519
REFD++ GS + + +DIYG++T E+ LHLR E +L++R S Q +H+ E + EK++ ISK
Sbjct: 543 REFDFLPGSTRKLNATDIYGANTIETSLHLRFENLLALRCSVQEHHIFENVGEKRRKISK 602
Query: 520 IIQLKEEEESYQMVEANPEKNLSQHVEKYQILQKIMKEKLYSWLLRKVCEDGKGPCILDD 579
I+ LK+E+E + EK+L++ K +++++ ++KLY WL+ KV E+GKGP ILD+
Sbjct: 603 IMLLKDEKEP--PLPGTIEKDLTELEAKERLIREEFEDKLYLWLIHKVTEEGKGPNILDE 660
Query: 580 EGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVLLSLGAA 639
+GQGVLHLAA+LGYDWAIKP + AGVSINFRD +GW+ALHWAA+ GRE TVAVL+SLGA
Sbjct: 661 DGQGVLHLAAALGYDWAIKPILAAGVSINFRDANGWSALHWAAFSGREDTVAVLVSLGAD 720
Query: 640 PGLLTDPSPEFPLSRTPSDLASSNGHKGISGFLAESSLTSLLLSLKMNDSADDGALEDSI 699
G L DPSPE PL +T +DLA NGH+GISGFLAESSLTS L L + D+ ++ + + S
Sbjct: 721 AGALADPSPEHPLGKTAADLAYGNGHRGISGFLAESSLTSYLEKLTV-DAKENSSADSSG 779
Query: 700 AKAVQTVSEKTATPANDNDESDVLSLKDSLTAICNATQAADRIHQIFRMQSFQRKQLTEF 759
AKAV TV+E+TATP + D + LS+KDSLTA+ NATQAADR+HQ+FRMQSFQRKQL+E
Sbjct: 780 AKAVLTVAERTATPMSYGDVPETLSMKDSLTAVLNATQAADRLHQVFRMQSFQRKQLSEL 839
Query: 760 --NNELGISYEHALSLVAAKSLRPVQGDGLAHSAAIQIQKKFRGWKKRKEFLLIRQRIVK 817
+N+ IS E A+S AAK+ + G H+AA+QIQKK+RGWKKRKEFLLIRQRIVK
Sbjct: 840 GGDNKFDISDELAVSFAAAKTKKSGHSSGAVHAAAVQIQKKYRGWKKRKEFLLIRQRIVK 899
Query: 818 IQAHVRGHQARKKYRPIIWSVGILEKVILRWRRKGSGLRGFRRDALGMNPNPQHMPLKED 877
IQAHVRGHQ RK+YR IIWSVG+LEK+ILRWRRKGSGLRGF+RD + P +ED
Sbjct: 900 IQAHVRGHQVRKQYRAIIWSVGLLEKIILRWRRKGSGLRGFKRDTISKPTEPVCPAPQED 959
Query: 878 DYDFLKDGRKQTEERLQKALGRVKSMVQYPEARAQYRRLLTVVEGSRETK--ESNMVPNG 935
DYDFLK+GRKQTEERLQKAL RVKSM QYPEARAQYRRLLTVVEG RE + S+ + N
Sbjct: 960 DYDFLKEGRKQTEERLQKALTRVKSMAQYPEARAQYRRLLTVVEGFRENEASSSSALKNN 1019
Query: 936 LEDIADGDLD--LIDIDSLLDDDTFMSVAFE 964
E+ A+ + + LIDIDSLLDDDTFMS+AFE
Sbjct: 1020 TEEAANYNEEDDLIDIDSLLDDDTFMSLAFE 1050
|
Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 964 | ||||||
| 356528046 | 1079 | PREDICTED: calmodulin-binding transcript | 0.982 | 0.877 | 0.561 | 0.0 | |
| 356557555 | 1088 | PREDICTED: calmodulin-binding transcript | 0.990 | 0.877 | 0.564 | 0.0 | |
| 449438552 | 1067 | PREDICTED: calmodulin-binding transcript | 0.963 | 0.870 | 0.548 | 0.0 | |
| 356510676 | 1046 | PREDICTED: calmodulin-binding transcript | 0.947 | 0.872 | 0.550 | 0.0 | |
| 357445841 | 1052 | Calmodulin-binding transcription activat | 0.939 | 0.861 | 0.533 | 0.0 | |
| 449532140 | 834 | PREDICTED: calmodulin-binding transcript | 0.842 | 0.973 | 0.562 | 0.0 | |
| 255556643 | 1019 | calmodulin-binding transcription activat | 0.928 | 0.878 | 0.555 | 0.0 | |
| 297794005 | 1062 | calmodulin-binding protein [Arabidopsis | 0.957 | 0.869 | 0.513 | 0.0 | |
| 30697970 | 1050 | calmodulin-binding transcription activat | 0.938 | 0.861 | 0.504 | 0.0 | |
| 9759398 | 1014 | ER66 protein-like [Arabidopsis thaliana] | 0.892 | 0.848 | 0.493 | 0.0 |
| >gi|356528046|ref|XP_003532616.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 992 bits (2564), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 549/978 (56%), Positives = 675/978 (69%), Gaps = 31/978 (3%)
Query: 1 MLEQDLMHIVFVHYLEVQGNKSNVGDRE-SNEVTSNPGKHSSLTFSFPGNRTKAPSGITD 59
MLE D+MHIVFVHYL+V+ NK+N+G + S+EVTS+ K SSL+ FP N PSG TD
Sbjct: 119 MLELDMMHIVFVHYLDVKVNKTNIGGKTYSDEVTSDSQKSSSLSSGFPRNYGSMPSGSTD 178
Query: 60 STSPTSTLTLSCEDADSGYDAEDSHQASSRAHLYYELPQMGNGPRMEKMDSGLSYSYFLS 119
S SPTSTLT CEDADS ED HQASS H Y E +GN M+K+ + + SY +
Sbjct: 179 SMSPTSTLTSLCEDADS----EDIHQASSGLHSYRESQNLGNDRPMDKIHARSNSSYLMH 234
Query: 120 PSSGCPEVRSSIPGDYVSHA-GHIPNDNQDLMIECQKALGLASWEEVLEHCSGENDNVP- 177
P S +Y+ H G+ + IE Q+A G+ASW+ +E +G++ +
Sbjct: 235 PFSDNHGQLPVSGAEYIPHVQGNKSRASDTTYIEGQRAHGIASWDNAMEQSAGKHADPSL 294
Query: 178 ------PHAKLESNVQKENIFDGELLSRE-ASEENSGSSLPVQFNWQIPLADNSSHFLKS 230
P + + + + K + G LL + A E + PVQ NWQIP DN+
Sbjct: 295 VSSTSIPSSAMGNILDKNHTVPGNLLGHKIALTEVERGAQPVQSNWQIPFEDNTGELPNW 354
Query: 231 IMDLSRDLEPAYDLGDGLFEQRTHDACLLGAPEPFCAFLDQQNELPVQNNLQMQQRDVES 290
S LE D G L T++A PE F L+ Q +S
Sbjct: 355 GFTQSLGLEFGSDYGTSLLGDVTNNAGPEIDPELFT----------FNGELKEQYTHGQS 404
Query: 291 HSQTKSNSESEIHGEGTINFSFSVKQKLLNGEGNLEKVDSFSRWMSKELEEVDNLHVQSS 350
KSNS E+ GE +IN++ ++++ LL+GE +L+KVDSFSRWM+KEL VD+LH+QSS
Sbjct: 405 QPALKSNSAYEVPGEASINYALTMRRGLLDGEESLKKVDSFSRWMTKELAGVDDLHMQSS 464
Query: 351 -GIEWSTEECGNVVDDSSLSPSLSQDQLFSIIDFSPKWTYTDPEIEVVVTGMFLKSHQEV 409
GI WST+ECG+V+DD+SL SLSQDQLFSI DFSPKW Y + EIEV++ G FLKS V
Sbjct: 465 PGISWSTDECGDVIDDTSLHLSLSQDQLFSINDFSPKWAYAESEIEVLIVGTFLKSQPVV 524
Query: 410 AKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPFYITCSNRLACSEVREFDYIVGS 469
AKC WSCMF EVEVPAEVLADG+LCC+ PPH +GRVPFY+TCSNR ACSEVREF+Y G
Sbjct: 525 AKCNWSCMFGEVEVPAEVLADGILCCQAPPHKIGRVPFYVTCSNRFACSEVREFEYREGF 584
Query: 470 VKDADISDIYGSSTSESFLHLRLERILSMRS-SPQNHLSEGLCEKQKLISKIIQLKEEEE 528
++ + D + +S SE LHLRL +LS+ S N + EG +K+ LI K+I LKEEEE
Sbjct: 585 DRNINFPDFFNNS-SEMELHLRLVGLLSLNSMHTLNQVFEGDMDKRNLIFKLISLKEEEE 643
Query: 529 SYQMVEANPEKNLSQHVEKYQILQKIMKEKLYSWLLRKVCEDGKGPCILDDEGQGVLHLA 588
E E ++SQ K + K +KEKLYSWLL KV E GKGP +LD+EGQGVLHL
Sbjct: 644 YSSKEETTAEMDISQQKLKEHMFHKQVKEKLYSWLLHKVTETGKGPLVLDEEGQGVLHLI 703
Query: 589 ASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVLLSLGAAPGLLTDPSP 648
A+LGYDWAI P +TAGV+INFRD++GWTALHWAA+CGRE+TVAVL+S+ AA G LTDP P
Sbjct: 704 AALGYDWAINPIITAGVNINFRDVNGWTALHWAAFCGRERTVAVLVSMDAAAGALTDPCP 763
Query: 649 EFPLSRTPSDLASSNGHKGISGFLAESSLTSLLLSLKMNDSADDGALEDSIAKAVQTVSE 708
EFPL RTP+DLASS GHKGISGFLAES LTS L SL M D DG E S K VQTVSE
Sbjct: 764 EFPLGRTPADLASSKGHKGISGFLAESLLTSHLESLTM-DENKDGRKETSGMKVVQTVSE 822
Query: 709 KTATPANDNDESDVLSLKDSLTAICNATQAADRIHQIFRMQSFQRKQLTEF-NNELGISY 767
+TATP + D D + LKDSL A+ NATQAADRI+Q+FRMQSFQRKQL + ++E G+S
Sbjct: 823 RTATPVLNGDIPDDICLKDSLNAVRNATQAADRIYQVFRMQSFQRKQLALYEDDEFGLSD 882
Query: 768 EHALSLVAAKSLRPVQGDGLAHSAAIQIQKKFRGWKKRKEFLLIRQRIVKIQAHVRGHQA 827
+ ALSL+A+K+ R QG+GLA++AAIQIQKKFRGW KRKEFL+IRQRIVKIQAHVRGHQ
Sbjct: 883 QQALSLLASKACRSGQGEGLANAAAIQIQKKFRGWTKRKEFLIIRQRIVKIQAHVRGHQV 942
Query: 828 RKKYRPIIWSVGILEKVILRWRRKGSGLRGFRRDALGMNP-NPQHMPLKEDDYDFLKDGR 886
RK+Y+PIIWSVGILEKVILRWRRKGSGLRGFR + P P P KEDDYD+LK+GR
Sbjct: 943 RKQYKPIIWSVGILEKVILRWRRKGSGLRGFRPASQNKVPEQPSESP-KEDDYDYLKEGR 1001
Query: 887 KQTEERLQKALGRVKSMVQYPEARAQYRRLLTVVEGSRETKESNMVPNGLEDIADGDLDL 946
KQ+E + +KAL RVKSMVQYPEARAQYRR+L VVE R+TK N+ E+ DG DL
Sbjct: 1002 KQSEVKFKKALSRVKSMVQYPEARAQYRRVLNVVEDFRQTKGGNLNLINSEETVDGVEDL 1061
Query: 947 IDIDSLLDDDTFMSVAFE 964
IDID LLDD+ F+ +AF+
Sbjct: 1062 IDIDMLLDDENFLPIAFD 1079
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356557555|ref|XP_003547081.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449438552|ref|XP_004137052.1| PREDICTED: calmodulin-binding transcription activator 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356510676|ref|XP_003524062.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357445841|ref|XP_003593198.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355482246|gb|AES63449.1| Calmodulin-binding transcription activator [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449532140|ref|XP_004173041.1| PREDICTED: calmodulin-binding transcription activator 2-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255556643|ref|XP_002519355.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541422|gb|EEF42972.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297794005|ref|XP_002864887.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310722|gb|EFH41146.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30697970|ref|NP_201227.3| calmodulin-binding transcription activator 2 [Arabidopsis thaliana] gi|79332100|ref|NP_001032135.1| calmodulin-binding transcription activator 2 [Arabidopsis thaliana] gi|75324343|sp|Q6NPP4.1|CMTA2_ARATH RecName: Full=Calmodulin-binding transcription activator 2; AltName: Full=Ethylene-induced calmodulin-binding protein c; Short=AtER66; Short=EICBP.c; AltName: Full=Signal-responsive protein 4 gi|38603814|gb|AAR24652.1| At5g64220 [Arabidopsis thaliana] gi|110738680|dbj|BAF01265.1| Calmodulin-binding transcription activator 2 [Arabidopsis thaliana] gi|225879158|dbj|BAH30649.1| hypothetical protein [Arabidopsis thaliana] gi|332010473|gb|AED97856.1| calmodulin-binding transcription activator 2 [Arabidopsis thaliana] gi|332010474|gb|AED97857.1| calmodulin-binding transcription activator 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9759398|dbj|BAB09853.1| ER66 protein-like [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 964 | ||||||
| TAIR|locus:2173368 | 1050 | AT5G64220 [Arabidopsis thalian | 0.826 | 0.759 | 0.496 | 6.9e-206 | |
| TAIR|locus:2060405 | 1032 | SR1 "signal responsive 1" [Ara | 0.400 | 0.374 | 0.428 | 6e-158 | |
| TAIR|locus:2019534 | 1016 | AT1G67310 [Arabidopsis thalian | 0.535 | 0.507 | 0.375 | 5.4e-93 | |
| TAIR|locus:2130125 | 923 | AT4G16150 [Arabidopsis thalian | 0.591 | 0.617 | 0.327 | 1.6e-75 | |
| UNIPROTKB|F1P8J0 | 1204 | CAMTA2 "Uncharacterized protei | 0.067 | 0.053 | 0.357 | 6.1e-08 | |
| UNIPROTKB|J9NZ90 | 1214 | CAMTA2 "Uncharacterized protei | 0.067 | 0.053 | 0.357 | 6.2e-08 | |
| UNIPROTKB|Q9Y6Y1 | 1673 | CAMTA1 "Calmodulin-binding tra | 0.082 | 0.047 | 0.325 | 9.1e-08 | |
| MGI|MGI:2135957 | 1208 | Camta2 "calmodulin binding tra | 0.067 | 0.053 | 0.357 | 1.9e-07 | |
| UNIPROTKB|F1RFY4 | 1201 | CAMTA2 "Uncharacterized protei | 0.067 | 0.054 | 0.357 | 2.4e-07 | |
| UNIPROTKB|O94983 | 1202 | CAMTA2 "Calmodulin-binding tra | 0.067 | 0.054 | 0.357 | 3e-07 |
| TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1893 (671.4 bits), Expect = 6.9e-206, Sum P(2) = 6.9e-206
Identities = 409/824 (49%), Positives = 529/824 (64%)
Query: 154 QKALGLASWEEVLEHCSGENDNVPPHAKL-ESNVQKENIFDGELLSREAS---EENSGSS 209
Q++ + +W+ E+ N+P +A L ++ + E + + S E+ +
Sbjct: 241 QRSGDVPAWDASFENSLARYQNLPYNAPLTQTQPSTFGLIPMEGKTEKGSLLTSEHLRNP 300
Query: 210 LPVQFNWQIPLADNSSHFLKSIMDLSRDLEPAYDLGDGLFEQRTHDACLLGAPEPFCAFL 269
L Q NWQ P+ + S K MD + A DL LF Q H+ G F + L
Sbjct: 301 LQSQVNWQTPVQE-SVPLQKWPMDSHSGMTDATDLA--LFGQGAHEN--FGT---FSSLL 352
Query: 270 DQQNELPVQNNLQMQQRDVESHSQTKSNSESEIHGEGTINFSFSVKQKLLNGEGNLEKVD 329
Q++ ++ Q + E+ K E I+ E + N + +++ LL E +L+KVD
Sbjct: 353 GSQDQQ--SSSFQAPFTNNEAAYIPKLGPEDLIY-EASANQTLPLRKALLKKEDSLKKVD 409
Query: 330 SFSRWMSKELEEVDNLHVQSS--GIEWSTEECGNVVXXXXXXXXXXXXXXXXIIDFSPKW 387
SFSRW+SKEL E+++L +QSS GI W++ EC N +IDF PKW
Sbjct: 410 SFSRWVSKELGEMEDLQMQSSSGGIAWTSVECENAAAGSSLSPSLSEDQRFTMIDFWPKW 469
Query: 388 TYTDPEIEVVVTGMFLKSHQEVAKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPF 447
T TD E+EV+V G FL S QEV WSCMF EVEVPA++L DGVLCC PPH VGRVPF
Sbjct: 470 TQTDSEVEVMVIGTFLLSPQEVTSYSWSCMFGEVEVPADILVDGVLCCHAPPHEVGRVPF 529
Query: 448 YITCSNRLACSEVREFDYIVGSVKDADISDIYGSSTSESFLHLRLERILSMRSSPQ-NHL 506
YITCS+R +CSEVREFD++ GS + + +DIYG++T E+ LHLR E +L++R S Q +H+
Sbjct: 530 YITCSDRFSCSEVREFDFLPGSTRKLNATDIYGANTIETSLHLRFENLLALRCSVQEHHI 589
Query: 507 SEGLCXXXXXXXXXXXXXXXXXXYQMVEANPEKNLSQHVEKYQILQKIMKEKLYSWLLRK 566
E + + EK+L++ K +++++ ++KLY WL+ K
Sbjct: 590 FENV--GEKRRKISKIMLLKDEKEPPLPGTIEKDLTELEAKERLIREEFEDKLYLWLIHK 647
Query: 567 VCEDGKGPCILDDEGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGR 626
V E+GKGP ILD++GQGVLHLAA+LGYDWAIKP + AGVSINFRD +GW+ALHWAA+ GR
Sbjct: 648 VTEEGKGPNILDEDGQGVLHLAAALGYDWAIKPILAAGVSINFRDANGWSALHWAAFSGR 707
Query: 627 EKTVAVLLSLGAAPGLLTDPSPEFPLSRTPSDLASSNGHKGISGFLAEXXXXXXXXXXKM 686
E TVAVL+SLGA G L DPSPE PL +T +DLA NGH+GISGFLAE +
Sbjct: 708 EDTVAVLVSLGADAGALADPSPEHPLGKTAADLAYGNGHRGISGFLAESSLTSYLEKLTV 767
Query: 687 NDSADDGALEDSIAKAVQTVSEKTATPANDNDESDVLSLKDSLTAICNATQAADRIHQIF 746
D+ ++ + + S AKAV TV+E+TATP + D + LS+KDSLTA+ NATQAADR+HQ+F
Sbjct: 768 -DAKENSSADSSGAKAVLTVAERTATPMSYGDVPETLSMKDSLTAVLNATQAADRLHQVF 826
Query: 747 RMQSFQRKQLTEF--NNELGISYEHALSLVAAKSLRPVQGDGLAHSAAIQIQKKFRGWKK 804
RMQSFQRKQL+E +N+ IS E A+S AAK+ + G H+AA+QIQKK+RGWKK
Sbjct: 827 RMQSFQRKQLSELGGDNKFDISDELAVSFAAAKTKKSGHSSGAVHAAAVQIQKKYRGWKK 886
Query: 805 RKEFLLIRQRIVKIQAHVRGHQARKKYRPIIWSVGILEKVILRWRRKGSGLRGFRRDALG 864
RKEFLLIRQRIVKIQAHVRGHQ RK+YR IIWSVG+LEK+ILRWRRKGSGLRGF+RD +
Sbjct: 887 RKEFLLIRQRIVKIQAHVRGHQVRKQYRAIIWSVGLLEKIILRWRRKGSGLRGFKRDTIS 946
Query: 865 MNPNPQHMPLKEDDYDFLKDGRKQTEERLQKALGRVKSMVQYPEARAQYRRLLTVVEGSR 924
P +EDDYDFLK+GRKQTEERLQKAL RVKSM QYPEARAQYRRLLTVVEG R
Sbjct: 947 KPTEPVCPAPQEDDYDFLKEGRKQTEERLQKALTRVKSMAQYPEARAQYRRLLTVVEGFR 1006
Query: 925 ETK--ESNMVPNGXXXXXXXXXXXXXXXXXXXXX--TFMSVAFE 964
E + S+ + N TFMS+AFE
Sbjct: 1007 ENEASSSSALKNNTEEAANYNEEDDLIDIDSLLDDDTFMSLAFE 1050
|
|
| TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P8J0 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2135957 Camta2 "calmodulin binding transcription activator 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q6NPP4 | CMTA2_ARATH | No assigned EC number | 0.5045 | 0.9387 | 0.8619 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | scaffold_803130.1 | annotation not avaliable (1062 aa) | ||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 964 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-12 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 7e-12 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 5e-10 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 5e-07 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 7e-07 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-06 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-05 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-05 | |
| smart00015 | 23 | smart00015, IQ, Calmodulin-binding motif | 3e-05 | |
| pfam00612 | 21 | pfam00612, IQ, IQ calmodulin-binding motif | 3e-05 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 6e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 7e-05 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 6e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 0.002 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.003 | |
| pfam01833 | 84 | pfam01833, TIG, IPT/TIG domain | 0.003 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 64.3 bits (157), Expect = 3e-12
Identities = 36/104 (34%), Positives = 47/104 (45%), Gaps = 6/104 (5%)
Query: 569 EDGKGPCILDDEGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREK 628
E+G D++G+ LHLAA G+ +K + G +N RD G T LH AA G
Sbjct: 28 ENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDKDGNTPLHLAARNGNLD 87
Query: 629 TVAVLLSLGAAPGLLTDPSPEFPLSRTPSDLASSNGHKGISGFL 672
V +LL GA RTP LA+ NGH + L
Sbjct: 88 VVKLLLKHGADVNARDK------DGRTPLHLAAKNGHLEVVKLL 125
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 964 | |||
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.97 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.96 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.96 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.95 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.95 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.94 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.94 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.93 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.93 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.93 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.93 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.92 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.92 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.92 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.92 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.92 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.89 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.88 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.86 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.86 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.83 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.83 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.82 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.81 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.81 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.8 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.8 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.79 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.77 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.77 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.77 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.76 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.74 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.74 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.73 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.73 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.72 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.71 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.71 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.7 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.7 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.7 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.68 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.67 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.67 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.66 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.63 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.62 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.61 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.61 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.57 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.53 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.52 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.49 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.43 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.42 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.41 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 99.37 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.36 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.33 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.29 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.27 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.24 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.23 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.23 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.22 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.21 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.19 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.17 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.13 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.13 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.03 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.65 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.55 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.48 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.39 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.38 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.35 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 98.31 | |
| cd01175 | 85 | IPT_COE IPT domain of the COE family (Col/Olf-1/EB | 98.26 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.23 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.2 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.18 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.17 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.16 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.15 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.13 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.07 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.03 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 97.92 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.86 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.85 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.83 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.74 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.61 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.59 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 97.58 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 97.47 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.34 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.02 | |
| PF01833 | 85 | TIG: IPT/TIG domain; InterPro: IPR002909 This fami | 96.95 | |
| cd01179 | 85 | IPT_plexin_repeat2 Second repeat of the IPT domain | 96.75 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.74 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.69 | |
| cd00102 | 89 | IPT Immunoglobulin-like fold, Plexins, Transcripti | 96.6 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 96.53 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 96.26 | |
| PTZ00014 | 821 | myosin-A; Provisional | 96.16 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 96.03 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.83 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 95.8 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.77 | |
| cd00603 | 90 | IPT_PCSR IPT domain of Plexins and Cell Surface Re | 95.71 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 95.26 | |
| cd01180 | 94 | IPT_plexin_repeat1 First repeat of the IPT domain | 95.23 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.13 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.12 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.01 | |
| smart00429 | 90 | IPT ig-like, plexins, transcription factors. | 94.17 | |
| cd01181 | 99 | IPT_plexin_repeat3 Third repeat of the IPT domain | 93.61 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 89.42 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 80.65 |
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.7e-82 Score=748.34 Aligned_cols=613 Identities=45% Similarity=0.694 Sum_probs=510.8
Q ss_pred CCCCcccccchhhhhhhhcccccccccCC-CCCccccccCCCCCCCCCCCCccccCceEeEeeCCCCCCCCCCeEEEEec
Q 002124 322 EGNLEKVDSFSRWMSKELEEVDNLHVQSS-GIEWSTEECGNVVDDSSLSPSLSQDQLFSIIDFSPKWTYTDPEIEVVVTG 400 (964)
Q Consensus 322 ~~~~~~~dsf~~w~~~~~~~~~~~~~~s~-~~~~~~~~~~~~~~~~~~~~s~~~~~l~~I~dfSP~wa~~~ggtKVlI~G 400 (964)
.+++++.|||+|||+ .|++..|+.-.++ +.+|....+.-...++.++||. ++|+|+|+||||+|+|++||+||+|+|
T Consensus 350 ~~~l~sgdsf~~~~~-t~~e~~d~~q~~s~~~~~~p~~~~~~~~~s~~~~S~-p~qlf~I~DfSP~Wsy~~ggvKVlV~G 427 (975)
T KOG0520|consen 350 ELGLKSGDSFSRWAS-TFGEISDLGQDPSGEAVWTPENDPMGPPGSFLSPSS-PEQLFTITDFSPEWSYLDGGVKVLVTG 427 (975)
T ss_pred cccccccccccchhh-hhcccccCCCCCccccccccCCCcCCCcccccCCCC-CcceeeeeccCcccccCCCCcEEEEec
Confidence 789999999999994 8999887773335 4588887555555566688885 499999999999999999999999999
Q ss_pred ccccccccccccchhhhcCChHHHHHHHHcCCCCCCCCCCCCCCcceeeccc-CCcccchhhhhhhhccCCCCCcccCCC
Q 002124 401 MFLKSHQEVAKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPFYITCS-NRLACSEVREFDYIVGSVKDADISDIY 479 (964)
Q Consensus 401 ~~~~~~~~~~~~~~Ac~fG~veVv~~LL~~GvlrC~~p~~~~G~TPLhvA~~-ng~~~seVv~feyl~~~~a~vn~~d~~ 479 (964)
.+- +.+..+|.||||+.+||++||+.||+||++|||++|.|+|+|||. ++.+|+++.+|.|+......+|..+.+
T Consensus 428 ~~~----~~~~~~ysc~Fg~~~VPAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s~~ 503 (975)
T KOG0520|consen 428 FPQ----DETRSNYSCMFGEQRVPAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLSWE 503 (975)
T ss_pred Ccc----ccCCCceEEEeCCccccHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccccc
Confidence 622 235779999999999999999999999999999999999999998 899999999999999988888988855
Q ss_pred CCCccHHHHHHHHHHHHhhCC----CCCCCCccccccHHHHHHHHhhhhhhhHHH-HhhhcCCCCCCccccccchHHHHH
Q 002124 480 GSSTSESFLHLRLERILSMRS----SPQNHLSEGLCEKQKLISKIIQLKEEEESY-QMVEANPEKNLSQHVEKYQILQKI 554 (964)
Q Consensus 480 g~~~t~Lhla~rlvkLLl~~~----~~~~~~~~~g~~~l~la~~i~~ll~~~~~~-Ll~~~~~~~~is~~~~~~~~ll~~ 554 (964)
. ....+.+..|+.+++.... ......+........++.++..+ .+.|.+ ++ .............++.+++|+
T Consensus 504 d-~~~~~sl~~rl~~~~~r~~~~~~s~~~~~n~~~~~~~~l~skv~~l-~~~~~~r~~-~~~~~~~~~~~~~r~~lllhL 580 (975)
T KOG0520|consen 504 D-FLFQMSLLHRLETMLNRKQSILSSKPSTENTSDAESGNLASKVVHL-LNEWAYRLL-KSISENLSSSVNFRDMLLLHL 580 (975)
T ss_pred c-chhhhHHHHHHHHHHHHhHhHhhccCCccccccccchhHHHHHHHH-HHHHHHHHH-hhHhhhccccCCCcchHHHHH
Confidence 4 6888888889988887332 33333333333443388888888 788888 66 666677777888999999999
Q ss_pred HHHhCHHHHHHHHHHC-CCCCCccCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCChHHHHHHHcCCHHHHHHH
Q 002124 555 MKEKLYSWLLRKVCED-GKGPCILDDEGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVL 633 (964)
Q Consensus 555 a~~~~~~~lvk~Ll~~-gad~n~~D~~G~TpLHlAa~~G~~~iVk~LL~~Gadvn~~D~~G~TPLH~Aa~~G~~eiV~~L 633 (964)
+++.++.|+++.+++- |......|..|...+|++|..|+.+.+.+.+..|..++++|..||||||||+.+||..++..|
T Consensus 581 ~a~~lyawLie~~~e~~~~~~~eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l 660 (975)
T KOG0520|consen 581 LAELLYAWLIEKVIEWAGSGDLELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASL 660 (975)
T ss_pred HHHHhHHHHHHHHhcccccCchhhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHH
Confidence 9999999999999986 888888999999999999999999999888889999999999999999999999999999999
Q ss_pred HHcCCCCCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCcccCCccCCC-C-CCcHHHHhhHhHHHHHHHccC
Q 002124 634 LSLGAAPGLLTDPSPEFPLSRTPSDLASSNGHKGISGFLAESSLTSLLLSLKMNDS-A-DDGALEDSIAKAVQTVSEKTA 711 (964)
Q Consensus 634 L~~GAdvn~~~d~~~~D~~G~TPLhlAa~~G~~eiv~~LLe~G~~~~ladvn~~d~-~-G~tpl~~a~~~iv~~Lle~ga 711 (964)
++.|++.+++++|++.+..|.|+..+|..+||.++..+|.++.+..++.++...+. . +.+|..-+ .+...
T Consensus 661 ~~lga~~~~~tdps~~~p~g~ta~~la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~----~~t~~---- 732 (975)
T KOG0520|consen 661 IELGADPGAVTDPSPETPGGKTAADLARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKA----EKTSS---- 732 (975)
T ss_pred HHhccccccccCCCCCCCCCCchhhhhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhhhh----hhccC----
Confidence 99999999999999999999999999999999999999999988888877776662 2 23333221 11111
Q ss_pred CCCCCCCccccccccccchhhhhhhhHHHHHHHHHhhhHHHHHHHHHhhh--hhcchhhHHHHHHHhhhcCCcchhHHHH
Q 002124 712 TPANDNDESDVLSLKDSLTAICNATQAADRIHQIFRMQSFQRKQLTEFNN--ELGISYEHALSLVAAKSLRPVQGDGLAH 789 (964)
Q Consensus 712 ~~~~~~d~~~~l~Lkd~ltA~~~AaqaA~~Iq~afR~~s~~rkq~~~~~d--e~~~s~e~a~~l~A~k~~k~~~~~~~l~ 789 (964)
+.+.+-.....+|+|.++|+++|+++|++||++||+++|++++..+..+ ...++++.+.++.+.+...... .+...
T Consensus 733 -e~s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~~~~~~~~a~~i~~~~~~~i~~~~~~~m~~~~a~~~~~-~r~~~ 810 (975)
T KOG0520|consen 733 -EGSPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRAQSFQKKQAREIMDATKEQISEELAVSMKASSAFSMCD-DRSDP 810 (975)
T ss_pred -CCCCCCCccccccccccccccchHHHHHhhhhhhhhhhhhhhhHHHHHhhcchhhhhhhhhhhhcccchhcCc-cccch
Confidence 1121111333459999999999999999999999999999999988775 6667777777777554443223 55678
Q ss_pred HHHHHhHHHHhchHHHHHHHhhceeeEeechhhhhHHHHHHHhHHHHHHHHHHHHHHHHHHhhcchhhhHHhhhcCCCCC
Q 002124 790 SAAIQIQKKFRGWKKRKEFLLIRQRIVKIQAHVRGHQARKKYRPIIWSVGILEKVILRWRRKGSGLRGFRRDALGMNPNP 869 (964)
Q Consensus 790 ~aAv~IQk~~Rg~~~Rk~f~~lr~Aai~IQa~~Rg~~aRk~y~~~r~aa~~IQ~~iR~~~~rr~~lr~~r~~~~~~~i~i 869 (964)
.++..||++||+|+.|+.|+.+|+.+++||+++||++.|+.|+++.|++.++.+.+.+|+++++++|+|+.+........
T Consensus 811 ~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e~~~~ 890 (975)
T KOG0520|consen 811 AAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQVRKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFEEQET 890 (975)
T ss_pred hHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhHhhhhheechhhhHHHHHHHHHHHhhhhhcccccccchhcccc
Confidence 89999999999999999999999999999999999999999999999999999999999999999999988765430000
Q ss_pred CCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHHhcccccCCCCCCccccCCCcccccc
Q 002124 870 QHMPLKEDDYDFLKDGRKQTEERLQKALGRVKSMVQYPEARAQYRRLLTVVEGSRETKESNMVPNGLEDIADGDLDLIDI 949 (964)
Q Consensus 870 Qa~~~~~~~~R~~k~~Rkq~~~~~~~Aa~~iQs~~R~~~AR~qy~rl~~~~~~iQe~~~~~~~~~~~~~~~~~~~~~~~~ 949 (964)
+....++.||+||..||++++++.+|+++||+|+|.+++|.+|||++..+...|+..... ..-....+.+||+
T Consensus 891 -a~t~~e~~yd~yKq~~~~~~~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~~~~~~~~~~------~~~~~~~~~~~~i 963 (975)
T KOG0520|consen 891 -AATVIEDCYDFYKQLRKQTEERLTRAVVRVQSMFRSPKAQQQYRRLLLVYEQYQESYKEE------ALVGLLDDSLFDI 963 (975)
T ss_pred -ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhhhhhh------ccccccccchhhh
Confidence 011226699999999999999999999999999999999999999999999888877211 1222456789999
Q ss_pred ccccCCCCccc
Q 002124 950 DSLLDDDTFMS 960 (964)
Q Consensus 950 ~~~~~~~~~~~ 960 (964)
+.|+.||++|.
T Consensus 964 ~~~~~~~~~~~ 974 (975)
T KOG0520|consen 964 EQLQADRKIMM 974 (975)
T ss_pred Hhhhhhhhhhc
Confidence 99998888763
|
|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold | Back alignment and domain information |
|---|
| >cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >smart00429 IPT ig-like, plexins, transcription factors | Back alignment and domain information |
|---|
| >cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 964 | ||||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-10 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-09 | ||
| 2cxk_A | 95 | Crystal Structure Of The Tig Domain Of Human Calmod | 5e-08 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-07 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 6e-07 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 7e-07 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 9e-07 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-06 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 4e-06 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-06 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 5e-06 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 5e-06 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 6e-06 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 7e-06 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 9e-06 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 2e-05 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 2e-05 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 4e-05 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 5e-05 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 5e-05 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 5e-05 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 6e-05 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 7e-05 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-05 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 9e-05 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 1e-04 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 1e-04 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 1e-04 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 1e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 2e-04 | ||
| 2ix7_C | 58 | Structure Of Apo-Calmodulin Bound To Unconventional | 2e-04 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 2e-04 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 4e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 7e-04 |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
|
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|2IX7|C Chain C, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 58 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 | Back alignment and structure |
|---|
Score = 117 bits (295), Expect = 2e-31
Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 6/93 (6%)
Query: 373 SQDQLFSIIDFSPKWTYTDPEIEVVVTGMFLKSHQEVAKCKWSCMFAEVEVPAEVLADGV 432
S + D+SP+W+Y + ++V++TG + ++ +SC+F ++ VPA ++ GV
Sbjct: 2 SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGV 56
Query: 433 LCCRIPPHAVGRVPFYITCSNRLACSEVREFDY 465
L C P H G V + +N++ + V F+Y
Sbjct: 57 LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEY 88
|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 964 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.98 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.97 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.97 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.97 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.97 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.97 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.96 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.96 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.96 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.96 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.96 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.96 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.96 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.96 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.96 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.96 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.96 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.96 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.95 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.95 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.95 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.95 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.95 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.95 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.95 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.94 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.94 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.94 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.94 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.94 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.94 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.93 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.93 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.93 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.93 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.92 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.92 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.92 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.92 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.92 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.92 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.92 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.92 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.92 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.91 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.91 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.91 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.91 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.91 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.91 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.91 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.91 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.9 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.9 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.9 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.9 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.9 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.89 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.89 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.89 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.89 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.88 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.88 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.88 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.88 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.87 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.87 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.87 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.87 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.87 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.87 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.87 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.86 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.86 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.86 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.86 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.86 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.86 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.84 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.84 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.83 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.83 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.83 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.83 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.83 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.82 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.8 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.8 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.8 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.8 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.79 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.78 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.77 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.77 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.77 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.77 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.76 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.76 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.76 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.75 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.73 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.69 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.69 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.68 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.68 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.68 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.67 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.65 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.62 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.59 | |
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 99.56 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.54 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.49 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.99 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.63 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.49 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.37 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 97.18 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.12 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 97.0 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.96 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.88 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 96.85 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.72 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.62 | |
| 3muj_A | 138 | Transcription factor COE3; immunoglobulin like fol | 95.15 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 94.43 | |
| 3mlp_A | 402 | Transcription factor COE1; transcription factor, p | 92.61 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 86.97 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 86.64 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 86.52 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 86.46 | |
| 2uzx_B | 727 | Hepatocyte growth factor receptor; signaling prote | 85.38 | |
| 1uad_C | 99 | RSEC5, exocyst complex component SEC5; small GTP-b | 84.48 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 83.46 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 82.87 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.1e-34 Score=327.82 Aligned_cols=297 Identities=15% Similarity=0.126 Sum_probs=255.8
Q ss_pred ccccchhhhcCChHHHHHHHHcCCCCCCCCCCCCCCcceeecccCCcccchhhhhhhhccCCCCCcccCCCCCCccHHHH
Q 002124 409 VAKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPFYITCSNRLACSEVREFDYIVGSVKDADISDIYGSSTSESFL 488 (964)
Q Consensus 409 ~~~~~~Ac~fG~veVv~~LL~~GvlrC~~p~~~~G~TPLhvA~~ng~~~seVv~feyl~~~~a~vn~~d~~g~~~t~Lhl 488 (964)
.+.+++||..|+.++++.|++.|+. .+..+..|.||||+||.+|+ .+++. ++...+++++..+..| .||||+
T Consensus 81 ~t~L~~A~~~g~~~~v~~Ll~~ga~--~~~~~~~g~t~L~~A~~~g~--~~~v~--~Ll~~~~~~~~~~~~g--~t~L~~ 152 (437)
T 1n11_A 81 QTPLHCAARIGHTNMVKLLLENNAN--PNLATTAGHTPLHIAAREGH--VETVL--ALLEKEASQACMTKKG--FTPLHV 152 (437)
T ss_dssp CCHHHHHHHHTCHHHHHHHHHHTCC--TTCCCTTCCCHHHHHHHHTC--HHHHH--HHHHTTCCSCCCCTTS--CCHHHH
T ss_pred CCHHHHHHHCCCHHHHHHHHhCCCC--CCCCCCCCCcHHHHHHHcCC--HHHHH--HHHhCCCCCcCCCCCC--CCHHHH
Confidence 3567899999999999999999988 66678889999999999988 78777 5556667777766665 899999
Q ss_pred H-----HHHHHHHhhCCCCCCCCccccccHHHHHHHHhhhhhhhHHHHhhhcCCCCCCccccccchHHHHHHHHhCHHHH
Q 002124 489 H-----LRLERILSMRSSPQNHLSEGLCEKQKLISKIIQLKEEEESYQMVEANPEKNLSQHVEKYQILQKIMKEKLYSWL 563 (964)
Q Consensus 489 a-----~rlvkLLl~~~~~~~~~~~~g~~~l~la~~i~~ll~~~~~~Ll~~~~~~~~is~~~~~~~~ll~~a~~~~~~~l 563 (964)
| .+++++|+..+++.+..+..|.++++++...++. +.+..|+ .. +.+++..+..+.++++.+...+...+
T Consensus 153 A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~--~~v~~Ll-~~--g~~~~~~~~~g~t~L~~A~~~~~~~~ 227 (437)
T 1n11_A 153 AAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNL--DIVKLLL-PR--GGSPHSPAWNGYTPLHIAAKQNQVEV 227 (437)
T ss_dssp HHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCH--HHHHHHG-GG--TCCSCCCCTTCCCHHHHHHHTTCHHH
T ss_pred HHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCH--HHHHHHH-hC--CCCCCCcCCCCCCHHHHHHHcCCHHH
Confidence 8 5788999999988888899999999998776665 7777777 32 23334444567788889999999999
Q ss_pred HHHHHHCCCCCCccCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCChHHHHHHHcCCHHHHHHHHHcCCCCCCC
Q 002124 564 LRKVCEDGKGPCILDDEGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVLLSLGAAPGLL 643 (964)
Q Consensus 564 vk~Ll~~gad~n~~D~~G~TpLHlAa~~G~~~iVk~LL~~Gadvn~~D~~G~TPLH~Aa~~G~~eiV~~LL~~GAdvn~~ 643 (964)
++.|++.|++++..+..|.||||+|+..|+.+++++|++.|++++.+|..|+||||+|+..|+.+++++|+++|++++.
T Consensus 228 ~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~- 306 (437)
T 1n11_A 228 ARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA- 306 (437)
T ss_dssp HHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTC-
T ss_pred HHHHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCC-
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999999887
Q ss_pred CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCcccCCccCCCCCCcHHHHhh----HhHHHHHHHccCCCCCCCCc
Q 002124 644 TDPSPEFPLSRTPSDLASSNGHKGISGFLAESSLTSLLLSLKMNDSADDGALEDSI----AKAVQTVSEKTATPANDNDE 719 (964)
Q Consensus 644 ~d~~~~D~~G~TPLhlAa~~G~~eiv~~LLe~G~~~~ladvn~~d~~G~tpl~~a~----~~iv~~Lle~ga~~~~~~d~ 719 (964)
+|..|+||||+|+..|+.+++++|+++| ++++.+|..|.||+++|. .++|++|++.|++++..
T Consensus 307 -----~~~~g~t~L~~A~~~g~~~~v~~Ll~~g-----ad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~--- 373 (437)
T 1n11_A 307 -----TTRMGYTPLHVASHYGNIKLVKFLLQHQ-----ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEV--- 373 (437)
T ss_dssp -----CCSSCCCHHHHHHHSSCSHHHHHHHHTT-----CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCC---
T ss_pred -----CCCCCCCHHHHHHHcCcHHHHHHHHhcC-----CCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCC---
Confidence 4579999999999999999999999999 899999999999999985 79999999999977652
Q ss_pred cccccccccchhhhhhhh
Q 002124 720 SDVLSLKDSLTAICNATQ 737 (964)
Q Consensus 720 ~~~l~Lkd~ltA~~~Aaq 737 (964)
.+++.++++.|.+
T Consensus 374 -----~~~g~t~l~~A~~ 386 (437)
T 1n11_A 374 -----SSDGTTPLAIAKR 386 (437)
T ss_dssp -----CSSSCCHHHHHHH
T ss_pred -----CCCCCCHHHHHHH
Confidence 3466777776654
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A | Back alignment and structure |
|---|
| >1uad_C RSEC5, exocyst complex component SEC5; small GTP-binding protein, immunogloblin-like fold, beta- sandwich, endocytosis/exocytosis complex; HET: GNP; 2.10A {Rattus norvegicus} SCOP: b.1.18.18 PDB: 1hk6_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 964 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-12 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-04 | |
| d2cxka1 | 82 | b.1.18.1 (A:872-953) Calmodulin binding transcript | 2e-10 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-10 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 1e-04 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.002 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 5e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-07 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 9e-05 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 7e-09 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 1e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 4e-08 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.001 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 5e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.004 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 8e-06 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.002 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 1e-05 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-05 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-04 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 2e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.002 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.001 | |
| d1qhoa1 | 81 | b.1.18.2 (A:496-576) Five domain "maltogenic" alph | 0.003 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 0.004 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.8 bits (159), Expect = 9e-12
Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 6/90 (6%)
Query: 585 LHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVLLSLGAAPGLLT 644
LH+A+ +G+ +K + G S N ++ T LH AA G + LL A
Sbjct: 4 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA------ 57
Query: 645 DPSPEFPLSRTPSDLASSNGHKGISGFLAE 674
+ + +TP A+ GH + L E
Sbjct: 58 KVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 81 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 964 | |||
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.95 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.95 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.94 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.93 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.92 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.92 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.92 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.91 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.91 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.91 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.9 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.88 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.88 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.87 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.86 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.85 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.85 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.83 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.82 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.8 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.8 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.79 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.79 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.79 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.78 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.78 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.75 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.75 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.71 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.68 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.67 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.65 | |
| d2cxka1 | 82 | Calmodulin binding transcription activator 1 {Huma | 98.81 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.5 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.48 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.04 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.02 | |
| d1uadc_ | 92 | Exocyst complex component Sec5, Ral-binding domain | 94.88 | |
| d1qhoa1 | 81 | Five domain "maltogenic" alpha-amylase (glucan 1,4 | 94.73 | |
| d1p7hl1 | 103 | T-cell transcription factor NFAT1 (NFATC2) {Human | 93.48 | |
| d1cxla1 | 87 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 92.11 | |
| d3bmva1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Th | 87.55 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 85.69 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 85.05 | |
| d1cyga1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 84.04 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=7.1e-29 Score=276.52 Aligned_cols=297 Identities=15% Similarity=0.164 Sum_probs=204.8
Q ss_pred ccccchhhhcCChHHHHHHHHcCCCCCCCCCCCCCCcceeecccCCcccchhhhhhhhccCCCCCcccCCCCCCccHHHH
Q 002124 409 VAKCKWSCMFAEVEVPAEVLADGVLCCRIPPHAVGRVPFYITCSNRLACSEVREFDYIVGSVKDADISDIYGSSTSESFL 488 (964)
Q Consensus 409 ~~~~~~Ac~fG~veVv~~LL~~GvlrC~~p~~~~G~TPLhvA~~ng~~~seVv~feyl~~~~a~vn~~d~~g~~~t~Lhl 488 (964)
+|++|+||..|+.++++.|++.|++ ++..+..|+||||+||..|+ .++++ |++..|++++..+.+| .||||+
T Consensus 1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~--in~~d~~g~TpL~~A~~~g~--~~iv~--~Ll~~gadi~~~~~~g--~t~L~~ 72 (408)
T d1n11a_ 1 LTPLHVASFMGHLPIVKNLLQRGAS--PNVSNVKVETPLHMAARAGH--TEVAK--YLLQNKAKVNAKAKDD--QTPLHC 72 (408)
T ss_dssp CCHHHHHHHHTCHHHHHHHHHTTCC--SCCSSSCCCCHHHHHHHHTC--HHHHH--HHHHHTCCSSCCCTTS--CCHHHH
T ss_pred CChHHHHHHCcCHHHHHHHHHCCCC--CCCCCCCCCCHHHHHHHcCC--HHHHH--HHHHCcCCCCCCCCCC--CCHHHH
Confidence 4678999999999999999999988 66678899999999999998 88888 5666789999988876 899998
Q ss_pred HH-----HHHHHHhhCCCC---------------------------------CCCCccccccHHHHHHHHhhhhhhhHHH
Q 002124 489 HL-----RLERILSMRSSP---------------------------------QNHLSEGLCEKQKLISKIIQLKEEEESY 530 (964)
Q Consensus 489 a~-----rlvkLLl~~~~~---------------------------------~~~~~~~g~~~l~la~~i~~ll~~~~~~ 530 (964)
|+ .++++|+..... ....+..+...++.+...... +.++.
T Consensus 73 A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~--~~v~~ 150 (408)
T d1n11a_ 73 AARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKV--RVAEL 150 (408)
T ss_dssp HHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCH--HHHHH
T ss_pred HHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCH--HHHHH
Confidence 73 444544432211 112223344444444333222 34444
Q ss_pred HhhhcCCCCCCccccccchHHHHHHHHhCHHHHHHHHHHCCCCCCcc---------------------------------
Q 002124 531 QMVEANPEKNLSQHVEKYQILQKIMKEKLYSWLLRKVCEDGKGPCIL--------------------------------- 577 (964)
Q Consensus 531 Ll~~~~~~~~is~~~~~~~~ll~~a~~~~~~~lvk~Ll~~gad~n~~--------------------------------- 577 (964)
++ .. +.+++..+..+.++++.+...+...++++|+.+|++++..
T Consensus 151 ll-~~--~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~ 227 (408)
T d1n11a_ 151 LL-ER--DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAE 227 (408)
T ss_dssp HH-HT--TCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCC
T ss_pred HH-Hc--CCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhcccccccc
Confidence 44 21 1222222233344445555555555566666665555543
Q ss_pred CCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCChHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHH
Q 002124 578 DDEGQGVLHLAASLGYDWAIKPTVTAGVSINFRDLSGWTALHWAAYCGREKTVAVLLSLGAAPGLLTDPSPEFPLSRTPS 657 (964)
Q Consensus 578 D~~G~TpLHlAa~~G~~~iVk~LL~~Gadvn~~D~~G~TPLH~Aa~~G~~eiV~~LL~~GAdvn~~~d~~~~D~~G~TPL 657 (964)
+..|.||||+|+..+..++++.++..+..++..|..|.||||+|+..++.+++++|+++|++++... ..+.|||
T Consensus 228 ~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~------~~~~t~L 301 (408)
T d1n11a_ 228 SVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATT------RMGYTPL 301 (408)
T ss_dssp CTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCC------SSCCCHH
T ss_pred CCCCCCHHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCcccccc------ccccccc
Confidence 3445566666666677777777777777777778888888888888888888888888888877643 5778888
Q ss_pred HHHHHcCCHHHHHHHHHcCCCCcccCCccCCCCCCcHHHHhh----HhHHHHHHHccCCCCCCCCccccccccccchhhh
Q 002124 658 DLASSNGHKGISGFLAESSLTSLLLSLKMNDSADDGALEDSI----AKAVQTVSEKTATPANDNDESDVLSLKDSLTAIC 733 (964)
Q Consensus 658 hlAa~~G~~eiv~~LLe~G~~~~ladvn~~d~~G~tpl~~a~----~~iv~~Lle~ga~~~~~~d~~~~l~Lkd~ltA~~ 733 (964)
|.|+..++..++++|++.| ++++.+|..|.||||.|. .++|++|+++|++++.. .+++.++++
T Consensus 302 ~~~~~~~~~~~~~~ll~~g-----~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~--------d~~G~t~L~ 368 (408)
T d1n11a_ 302 HVASHYGNIKLVKFLLQHQ-----ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEV--------SSDGTTPLA 368 (408)
T ss_dssp HHHHHSSCSHHHHHHHHTT-----CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCC--------CSSSCCHHH
T ss_pred hhhcccCcceeeeeecccc-----ccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCC--------CCCCCCHHH
Confidence 8888888888888888887 778888888888888873 67888888888876642 345666777
Q ss_pred hhhh
Q 002124 734 NATQ 737 (964)
Q Consensus 734 ~Aaq 737 (964)
.|+.
T Consensus 369 ~A~~ 372 (408)
T d1n11a_ 369 IAKR 372 (408)
T ss_dssp HHHH
T ss_pred HHHH
Confidence 6654
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|