Citrus Sinensis ID: 002130

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-
MSVLVKILRCIFCCYDEDYHDTERDYRARLLGTYNHNSSVGNSSYHNSSVRNSSFTNHDLLRQHDSNKIYYYEYYPNVSISEPTTKQPNAMSQQTEYGNKSSLKGNNEVSQSLKSSRPSPPSSSCYTCSSSPNKSQSLTQLSSFPNPASASSKPFLSPKGPAPSSSSNSSSSFPKPAIPSSKASSSLSSPASSALSQSLSSLKPHSFNSDQHQLTAKPPESLSPFKSSQSSSGSTSTKNDTAPKVLNKPLLQKAPPSSQPTLAPLPPDSTNQQEKDSCLLVEKGSSNYKIPKDIEDLSKKDVVPNVLKKPLSPSTYKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTPSSLKPALSPLPNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKPSYRSSHKSPSSSNPTPSPLPSDSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHKASSSSKPTLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
ccHHHHHHHEEEEEEcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccEEEEEEccccccccccccccEEEEEEccccccEEEEEEEEEEcccEEEEEEcccccccccccccEEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHcccccccccccccHHHHccccEEEEEcccccHHHccccccccccEEEEccccccccHHHHHHHccccccccEEEEEccccccccEEEcHHHHHccccccHHHHHHccccccccccccccHHHHHHcc
ccHHHHHHHHEEEccccccccccHHHHHHHHcccccccccccccccccccccccccccHHEEEcccccEEEEEEccccEcccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHcccHHHcccccccccccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHcccccHcccccccHHHHHHHHHHHHHHHHEEEcccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEcccccEEEEEEEEEccccccEEEcccEEccccccccccccccHEEEEEHccHHHcccccccEEEEEEcccccccccccccccHEEHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEccEEEEEEEEccccEEEEEEEccccccccEEEEccEEEEEEccccccEEEEEEEEEccccEEEEEccHHccccccccccEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEcccccccHcccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHcccccHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEccccccccccEEHHHHEcccccEEEEEccccccccEEccHHHHHccccHHHHHHHHHHHcHcccHHHcccHccccccc
MSVLVKILRCIFccydedyhdtERDYRARLLGTynhnssvgnssyhnssvrnssftnhdllrqhdsnkiyyyeyypnvsisepttkqpnamsqqteygnksslkgnnEVSQslkssrpsppssscytcssspnksqsltqlssfpnpasasskpflspkgpapssssnssssfpkpaipsskassslsspassalsqslsslkphsfnsdqhqltakppeslspfkssqsssgststkndtapkvlnkpllqkappssqptlaplppdstnqqekdscllvekgssnykipkdiedlskkdvvpnvlkkplspstykdyfaalpyaedfyhvegsssvymppknsenlmkkeaapevlkkpssplsrktpsslkpalsplpndctnqqtkgnrvwvqkgtspvylthknnenlmkkeampevltkpsyrsshkspsssnptpsplpsdstnqqtkgndtwvqkgtlpvymtpknnenfMKKEVVHEVlkkpssplfhkasssskptlsplptdstnqqkkASFIWVQkgatnykipKDIEDLIkkdivpkvlkkpllpstyKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDkslknknleesdetdDKLFVAFEidsvperrpfllsrdfvyaqrsggkskkfqGFLYRVVKWTTVLVEFEedfhsqhqpnhkydvsfsFNRVCLKRAHEAVADASdslfrnylfpdcasrksipypslcpysnykldsdsnsaVHQILSfegqspyllegplcnnfvlsktgNVVREAVLQIRRrspksrilicapwnRTCDKLMECLMKDIPASEMFRANAAfreadgvsdeIFQVSLVErecfscppleelrqykviSSTFVSSfrlhnqgitaghfSHIFlidassatepETMIVLGNLANENTRVIVtgaphnspsrvrsdiarknglkmSYFERLCLTEAYRSCNSMFFSQLFTEEVG
MSVLVKILRCIFCCYDEDYHDTERDYRARLLGTYNHNSSVGNSSYHNSSVRNSSFTNHDLLRQHDSNKIYYYEYYPNVSISEPTTKQPNAMSQQTEYGNKSSLKGNNEVSQSlkssrpsppsSSCYTCSSSPNKSQSLTQLSSFPNPASASSKPFLSPKGPAPSSSSNSSSSFPKPAIPSSKASSSLSSPASSALSQSLSSLKPHSFNSDQHQLTakppeslspfkssqsssgststkndtapkvLNKPLLQKAPPSSQPTLAPLPPDSTNQQEKDSCLlvekgssnykipkdiedlskkdvvpnvlkkplspstyKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKEAApevlkkpssplsrktpsslkpalsplpndctnqqtkgnrvwvqkgtspvylthknnenlmkkeaMPEVLTKPSyrsshkspsssnptpsplpsdSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSsplfhkasssskptlsplptdstnqqKKASFiwvqkgatnykiPKDIedlikkdivpkvlkkpllpstYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKslknknleesdetddKLFVAFEIdsvperrpfllSRDFVYAqrsggkskkfqgflYRVVKWTTVLVEFEEDfhsqhqpnhkydVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLqirrrspksrilicapwnrTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVtgaphnspsrvrsdiarkngLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
MSVLVKILRCIFCCYDEDYHDTERDYRARLLGTynhnssvgnssyhnssvrnssFTNHDLLRQHDSNKIYYYEYYPNVSISEPTTKQPNAMSQQTEYGNKSSLKGNNEVsqslkssrpsppssscytcssspnksQSLTQLSSFPNPASASSKPFLspkgpapssssnssssfpkpaipsskassslsspassalsqslsslkPHSFNSDQHQLTAKPPEslspfkssqsssgstsTKNDTAPKVLNKPLLQKAPPSSQPTLAPLPPDSTNQQEKDSCLLVEKGSSNYKIPKDIEDLSKKDVVPNVLKKPLSPSTYKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTpsslkpalsplpNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKpsyrsshkspsssnptpsplpsdsTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHKAsssskptlsplptdstNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
**VLVKILRCIFCCYDEDYHDTERDYRARLLGTYN************************LLRQHDSNKIYYYEYYPNVS*********************************************************************************************************************************************************************************************************************************NVLK**LSPSTYKDYFAALPYAEDFYHVE************************************************************VWVQKG**PVYL******************************************************WVQKGTLPVYM***************************************************SFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKS**************KLFVAFEIDSVPERRPFLLSRDFVY************GFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTG***************KNGLKMSYFERLCLTEAYRSCNSMFFSQLF*****
**VLVKILRCIFCCYDEDYHDTERDYRARLLGTYNH************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YM***********************************TLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
MSVLVKILRCIFCCYDEDYHDTERDYRARLLGTYNHNSSVGNSSYHNSSVRNSSFTNHDLLRQHDSNKIYYYEYYPNVSISEPT********************************************************************************************************************SLKPHSF**********************************APKVLNKPLLQKAPPSSQPTLAP**********KDSCLLVEKGSSNYKIPKDIEDLSKKDVVPNVLKKPLSPSTYKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKE**********************PALSPLPNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPE*********************************KGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPS**************************KKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
*SVLVKILRCIFCCYDEDYHDTERDYRARLLGTYNHNSSVGNSSYHN***RNSSFTNHDLLRQHDSNKIYYYEYYPNVSIS***************************************************************************************************************************************************************TAPKVLNKPLLQKAPPSSQPTLAPLPPDSTNQQEKDSCLLVEKGSSNYKIPKDIEDLSKKDVVPNVLKKPLSPSTYKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTPSSLKPALSPL*******QTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKP**RSSHKSPSSSNPTPSPLPSDSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHK**SSSKPTLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVLVKILRCIFCCYDEDYHDTERDYRARLLGTYNHNSSVGNSSYHNSSVRNSSFTNHDLLRQHDSNKIYYYEYYPNVSISEPTTKQPNAMSQQTEYGNKSSLKGNNEVSQSLKSSRPSPPSSSCYTCSSSPNKSQSLTQLSSFPNPASASSKPFLSPKGPAPSSSSNSSSSFPKPAIPSSKASSSLSSPASSALSQSLSSLKPHSFNSDQHQLTAKPPESLSPFKSSQSSSGSTSTKNDTAPKVLNKPLLQKAPPSSQPTLAPLPPDSTNQQEKDSCLLVEKGSSNYKIPKDIEDLSKKDVVPNVLKKPLSPSTYKDYFAALPYAEDFYHVEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTPSSLKPALSPLPNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKPSYRSSHKSPSSSNPTPSPLPSDSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHKASSSSKPTLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query961 2.2.26 [Sep-21-2011]
Q8GYD9 1002 Probable RNA helicase SDE yes no 0.405 0.389 0.306 6e-53
Q1LXK4 1013 Putative helicase mov-10- no no 0.387 0.367 0.302 2e-31
Q5ZKD7 967 Putative helicase MOV-10 yes no 0.380 0.378 0.245 6e-26
Q1LXK5 1015 Putative helicase mov-10- no no 0.376 0.356 0.282 9e-25
P23249 1004 Putative helicase MOV-10 yes no 0.326 0.312 0.277 4e-24
Q6J5K9 1274 Probable RNA helicase arm yes no 0.412 0.310 0.237 3e-23
Q0V8H6 1003 Putative helicase MOV-10 yes no 0.367 0.351 0.261 4e-23
Q9HCE1 1003 Putative helicase MOV-10 yes no 0.367 0.351 0.258 3e-22
Q9BXT6 1211 Putative helicase Mov10l1 no no 0.216 0.171 0.317 9e-20
Q99MV5 1187 Putative helicase Mov10l1 no no 0.209 0.169 0.313 1e-18
>sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 Back     alignment and function desciption
 Score =  209 bits (533), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 133/434 (30%), Positives = 225/434 (51%), Gaps = 44/434 (10%)

Query: 533 YKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDF-YEEKWSGFQLFNVTLEL 591
           Y+IPK+I ++I+    P  L + L    Y +Y+  LL  E+   EE    + + NV    
Sbjct: 217 YEIPKEIREMIENKEFPDDLNEGLTARNYANYYKTLLIMEELQLEEDMRAYDMENV---- 272

Query: 592 HKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRS--GGKSKK 649
                   S+K + +          +++ E+  + ERRP L+  DF++ + +   G    
Sbjct: 273 --------SMKRRGI----------YLSLEVPGLAERRPSLVHGDFIFVRHAYDDGTDHA 314

Query: 650 FQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRN 709
           +QGF++RV +   V ++F  +FH +H     Y+V F++NR+  +R ++AV DA++ L  N
Sbjct: 315 YQGFVHRV-EADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAV-DAAEMLDPN 372

Query: 710 YLFPDCASRKSI----PYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFV 765
           +LFP   S K +    P+  + P     L+++   ++  +L  +G  PY++ GP      
Sbjct: 373 FLFPSLHSGKRMIKTKPFVPISP----ALNAEQICSIEMVLGCKGAPPYVIHGPPGT--- 425

Query: 766 LSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLM----KDIPASEMFRANAA 821
             KT  +V EA++Q+      +R+L+CAP N   D ++E L+      I  +E+FR NAA
Sbjct: 426 -GKTMTLV-EAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAA 483

Query: 822 FREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIF 881
            R  + +  EI +    +   F CPPL+ L +YK++ ST++S+  L+ +G+  GHF+HI 
Sbjct: 484 TRSYEEIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHIL 543

Query: 882 LIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLT 941
           L +A  A+EPE MI + NL    T V++ G P      + S  A   GL  SY ERL   
Sbjct: 544 LDEAGQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFEC 603

Query: 942 EAYRSCNSMFFSQL 955
           + Y   +  + ++L
Sbjct: 604 DYYCEGDENYVTKL 617
Probable RNA helicase required for post-transcriptional gene silencing (PTGS), a process that provides protection in plants against virus infection and can suppress expression of transgenes Plays a central role in RNA interference (RNAi) process, a process that mediates mRNA destruction of translational repression. Required for the assembly of the RISC complex, a complex required for target RNA destruction or repression. May be required in the RISC assembly to unwind miRNAs, in the production of single-stranded miRNA from the double-stranded miRNA, a key step in RISC formation.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 Back     alignment and function description
>sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 Back     alignment and function description
>sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 Back     alignment and function description
>sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=2 SV=3 Back     alignment and function description
>sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 Back     alignment and function description
>sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=1 SV=1 Back     alignment and function description
>sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query961
224094027687 predicted protein [Populus trichocarpa] 0.470 0.657 0.617 1e-152
224081336773 predicted protein [Populus trichocarpa] 0.470 0.584 0.605 1e-151
356497432886 PREDICTED: probable RNA helicase SDE3-li 0.411 0.445 0.311 4e-55
168029561885 RNA helicase [Physcomitrella patens subs 0.392 0.425 0.330 2e-54
224112955894 hypothetical protein POPTRDRAFT_789212 [ 0.411 0.441 0.322 5e-53
115450873959 Os03g0160400 [Oryza sativa Japonica Grou 0.407 0.408 0.309 1e-52
357450659940 hypothetical protein MTR_2g049990 [Medic 0.409 0.419 0.311 1e-52
293331505973 uncharacterized protein LOC100382450 [Ze 0.404 0.399 0.318 2e-52
357480981940 hypothetical protein MTR_5g006890 [Medic 0.409 0.419 0.316 2e-52
242036863968 hypothetical protein SORBIDRAFT_01g04643 0.407 0.404 0.320 3e-52
>gi|224094027|ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  546 bits (1406), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 281/455 (61%), Positives = 337/455 (74%), Gaps = 3/455 (0%)

Query: 504 KPTLSPLPTDSTNQQKKASFIWVQKGAT-NYKIPKDIEDLIKKDIVPKVLKKPLLPSTYK 562
           KPTLS +  DS  +Q K S++WVQKG +  Y IPKDIEDLIK+D VP VL KPL  STYK
Sbjct: 214 KPTLSQVSPDSIKEQTKVSYMWVQKGMSPIYAIPKDIEDLIKRDKVPGVLNKPLSLSTYK 273

Query: 563 DYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEI 622
           DYFAALLYAEDFY EKWS F+L N+TL+L +A I  KS +N+   E+ E DDK+FV FEI
Sbjct: 274 DYFAALLYAEDFYIEKWSEFKLENITLKLQRAEIIKKSRRNEYRNETYEKDDKIFVEFEI 333

Query: 623 DSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYD 682
           DS  ERRPFLLSRDF +A+ SG  ++  QG +YRV + T V+VEF +DF  QH    KYD
Sbjct: 334 DSCCERRPFLLSRDFAFARPSGQMTEPCQGIIYRVERSTRVVVEFGKDFLLQHHSTRKYD 393

Query: 683 VSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAV 742
           VSFSFNRVCLKRAH A+  ASD LF+++LFPD  S+K  P  +   + N+KLD   +SAV
Sbjct: 394 VSFSFNRVCLKRAHHAIEAASDPLFKSFLFPDGVSKKIFPISTPLHFCNHKLDVYQSSAV 453

Query: 743 HQILSFEGQSPYLLEGPLC-NNFV-LSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCD 800
            +ILSF+G  PY++EGPLC N F  LS+TG V++EAVLQI + S K RILICAP NRTCD
Sbjct: 454 REILSFQGPPPYIVEGPLCLNKFSELSRTGLVIQEAVLQIYQSSSKLRILICAPINRTCD 513

Query: 801 KLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISST 860
            LM+ L  DIP S+MFRANAAFRE DGV  +I      + ECF+CP L+ELR+++VI ST
Sbjct: 514 LLMQSLNNDIPKSDMFRANAAFREIDGVPIDILPSCAYKGECFTCPSLQELRKFRVILST 573

Query: 861 FVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRV 920
           FVSSFRL N+GI AGHFSHIFL+DASSATEPE M+ L NLA+E T VIVTGAP N    V
Sbjct: 574 FVSSFRLRNEGIAAGHFSHIFLVDASSATEPEAMVPLANLASEETAVIVTGAPGNHSGWV 633

Query: 921 RSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQL 955
           RS+IARKNGL  SYFERL  ++ YRS    F +QL
Sbjct: 634 RSNIARKNGLMTSYFERLRHSKPYRSLLPKFITQL 668

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224081336|ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356497432|ref|XP_003517564.1| PREDICTED: probable RNA helicase SDE3-like [Glycine max] Back     alignment and taxonomy information
>gi|168029561|ref|XP_001767294.1| RNA helicase [Physcomitrella patens subsp. patens] gi|162681549|gb|EDQ67975.1| RNA helicase [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|224112955|ref|XP_002332671.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] gi|222836465|gb|EEE74872.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115450873|ref|NP_001049037.1| Os03g0160400 [Oryza sativa Japonica Group] gi|108706305|gb|ABF94100.1| RNA helicase SDE3, putative, expressed [Oryza sativa Japonica Group] gi|108706306|gb|ABF94101.1| RNA helicase SDE3, putative, expressed [Oryza sativa Japonica Group] gi|113547508|dbj|BAF10951.1| Os03g0160400 [Oryza sativa Japonica Group] gi|125585000|gb|EAZ25664.1| hypothetical protein OsJ_09495 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357450659|ref|XP_003595606.1| hypothetical protein MTR_2g049990 [Medicago truncatula] gi|355484654|gb|AES65857.1| hypothetical protein MTR_2g049990 [Medicago truncatula] Back     alignment and taxonomy information
>gi|293331505|ref|NP_001168662.1| uncharacterized protein LOC100382450 [Zea mays] gi|223950013|gb|ACN29090.1| unknown [Zea mays] gi|413957055|gb|AFW89704.1| putative RNA helicase family protein [Zea mays] Back     alignment and taxonomy information
>gi|357480981|ref|XP_003610776.1| hypothetical protein MTR_5g006890 [Medicago truncatula] gi|355512111|gb|AES93734.1| hypothetical protein MTR_5g006890 [Medicago truncatula] Back     alignment and taxonomy information
>gi|242036863|ref|XP_002465826.1| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor] gi|241919680|gb|EER92824.1| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query961
TAIR|locus:2200996 1002 SDE3 "SILENCING DEFECTIVE" [Ar 0.425 0.408 0.290 9.2e-44
ZFIN|ZDB-GENE-091230-8 1001 mov10a "Moloney leukemia virus 0.425 0.408 0.288 1.2e-29
ZFIN|ZDB-GENE-030131-9089 1013 mov10b.1 "Moloney leukemia vir 0.366 0.347 0.311 1e-28
UNIPROTKB|F1NNW1 735 MOV10 "Putative helicase MOV-1 0.416 0.544 0.255 1.4e-24
ZFIN|ZDB-GENE-060526-371 1015 mov10b.2 "Moloney leukemia vir 0.395 0.374 0.282 1.6e-24
UNIPROTKB|Q5ZKD7 967 MOV10 "Putative helicase MOV-1 0.416 0.413 0.255 8.3e-24
ZFIN|ZDB-GENE-061013-333 1106 zgc:154086 "zgc:154086" [Danio 0.239 0.207 0.295 2.2e-23
MGI|MGI:97054 1004 Mov10 "Moloney leukemia virus 0.406 0.389 0.259 2.1e-21
UNIPROTKB|Q9HCE1 1003 MOV10 "Putative helicase MOV-1 0.365 0.349 0.262 5.8e-21
UNIPROTKB|Q0V8H6 1003 MOV10 "Putative helicase MOV-1 0.386 0.369 0.266 6.3e-21
TAIR|locus:2200996 SDE3 "SILENCING DEFECTIVE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 491 (177.9 bits), Expect = 9.2e-44, P = 9.2e-44
 Identities = 126/433 (29%), Positives = 225/433 (51%)

Query:   539 IEDLIKKDIVPKVLKK------PL--LPSTYKDYFAALLYAEDFYEEKWS-GFQLFNVTL 589
             ++D +K     KV+++      PL  +P   ++      + +D  E   +  +  +  TL
Sbjct:   193 VDDYVKGSRPSKVVERSFRNRLPLYEIPKEIREMIENKEFPDDLNEGLTARNYANYYKTL 252

Query:   590 ELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRS--GGKS 647
              + +    ++ ++  ++E        ++++ E+  + ERRP L+  DF++ + +   G  
Sbjct:   253 LIMEELQLEEDMRAYDMENVSMKRRGIYLSLEVPGLAERRPSLVHGDFIFVRHAYDDGTD 312

Query:   648 KKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLF 707
               +QGF++RV +   V ++F  +FH +H     Y+V F++NR+  +R ++AV DA++ L 
Sbjct:   313 HAYQGFVHRV-EADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAV-DAAEMLD 370

Query:   708 RNYLFPDCAS-RKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVL 766
              N+LFP   S ++ I      P S   L+++   ++  +L  +G  PY++ GP       
Sbjct:   371 PNFLFPSLHSGKRMIKTKPFVPISP-ALNAEQICSIEMVLGCKGAPPYVIHGPPGTG--- 426

Query:   767 SKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLME---CLMK-DIPASEMFRANAAF 822
              KT  +V EA++Q+      +R+L+CAP N   D ++E   CL    I  +E+FR NAA 
Sbjct:   427 -KTMTLV-EAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAAT 484

Query:   823 READGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFL 882
             R  + +  EI +    +   F CPPL+ L +YK++ ST++S+  L+ +G+  GHF+HI L
Sbjct:   485 RSYEEIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILL 544

Query:   883 IDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTE 942
              +A  A+EPE MI + NL    T V++ G P      + S  A   GL  SY ERL   +
Sbjct:   545 DEAGQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECD 604

Query:   943 AYRSCNSMFFSQL 955
              Y   +  + ++L
Sbjct:   605 YYCEGDENYVTKL 617
GO:0005737 "cytoplasm" evidence=ISM
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0009616 "virus induced gene silencing" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0035194 "posttranscriptional gene silencing by RNA" evidence=IMP
ZFIN|ZDB-GENE-091230-8 mov10a "Moloney leukemia virus 10, homolog, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9089 mov10b.1 "Moloney leukemia virus 10, homolog, b.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNW1 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-371 mov10b.2 "Moloney leukemia virus 10, homolog, b.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKD7 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-333 zgc:154086 "zgc:154086" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97054 Mov10 "Moloney leukemia virus 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCE1 MOV10 "Putative helicase MOV-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8H6 MOV10 "Putative helicase MOV-10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VII000693
hypothetical protein (687 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query961
pfam13086220 pfam13086, AAA_11, AAA domain 4e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 4e-04
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 5e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.004
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information 
 Score = 54.3 bits (131), Expect = 4e-08
 Identities = 44/212 (20%), Positives = 79/212 (37%), Gaps = 62/212 (29%)

Query: 733 KLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGN--VVREAVLQIRRRSPKSRIL 790
           +L+     A+ + LS       L++GP         TG    + E + Q+   +P  ++L
Sbjct: 1   ELNDSQREAIKKALS--SSDITLIQGPP-------GTGKTTTIVEIIKQLLSNAPGKKVL 51

Query: 791 ICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSL---VERECFSCPP 847
           +CAP N   D ++E L++     ++ R  +  RE   + +++ Q SL   +E +      
Sbjct: 52  VCAPSNSAVDNILERLLEQKFGLKIVRIGSPARE---IHEDVLQYSLEYLLEAKFEQLLK 108

Query: 848 L-----------------------------------------EELRQYKVISSTFVSSFR 866
                                                     E L +  V+ +T   +  
Sbjct: 109 RIRKLKSLLEEKSKLKRERRKLRSEIKKLKKELERLRKSIRKEILDEADVVCTTLSGAGS 168

Query: 867 LHNQGITAGHFSHIFLID-ASSATEPETMIVL 897
              +G+    F  +  ID A+ ATEPET+I L
Sbjct: 169 SLLEGLK--KFDVVI-IDEAAQATEPETLIPL 197

This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 961
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 100.0
KOG1803 649 consensus DNA helicase [Replication, recombination 100.0
TIGR00376 637 DNA helicase, putative. The gene product may repre 100.0
KOG1805 1100 consensus DNA replication helicase [Replication, r 100.0
KOG1804 775 consensus RNA helicase [RNA processing and modific 100.0
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 100.0
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.74
COG1112 767 Superfamily I DNA and RNA helicases and helicase s 99.71
KOG1807 1025 consensus Helicases [Replication, recombination an 99.71
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 99.64
PRK10875 615 recD exonuclease V subunit alpha; Provisional 99.62
KOG1804 775 consensus RNA helicase [RNA processing and modific 99.5
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 99.46
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 99.45
PRK13889 988 conjugal transfer relaxase TraA; Provisional 99.4
PRK13826 1102 Dtr system oriT relaxase; Provisional 99.36
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 99.31
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 99.31
KOG1806 1320 consensus DEAD box containing helicases [Replicati 99.3
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 99.28
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 99.28
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 99.26
KOG1801 827 consensus tRNA-splicing endonuclease positive effe 99.25
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 99.21
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.21
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 99.2
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 99.18
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.18
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 99.14
smart00487201 DEXDc DEAD-like helicases superfamily. 99.11
PF1324576 AAA_19: Part of AAA domain 99.06
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.01
PRK11054 684 helD DNA helicase IV; Provisional 98.98
PRK10536262 hypothetical protein; Provisional 98.95
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 98.89
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.84
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.78
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.77
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.68
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 98.67
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 98.64
PRK05580 679 primosome assembly protein PriA; Validated 98.5
PHA02558 501 uvsW UvsW helicase; Provisional 98.46
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.45
COG4096 875 HsdR Type I site-specific restriction-modification 98.39
PTZ00424 401 helicase 45; Provisional 98.37
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.37
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.34
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 98.33
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.33
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.3
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.28
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.26
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.26
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.26
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.25
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.24
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.22
PRK01172 674 ski2-like helicase; Provisional 98.22
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.21
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.21
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.19
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.18
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.17
PRK02362 737 ski2-like helicase; Provisional 98.06
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 98.06
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.05
COG3972 660 Superfamily I DNA and RNA helicases [General funct 98.03
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.98
PRK13766 773 Hef nuclease; Provisional 97.96
PRK10689 1147 transcription-repair coupling factor; Provisional 97.95
PTZ00110 545 helicase; Provisional 97.94
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 97.92
PRK09401 1176 reverse gyrase; Reviewed 97.89
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.88
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 97.88
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 97.83
PRK00254 720 ski2-like helicase; Provisional 97.81
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.8
PLN03025319 replication factor C subunit; Provisional 97.8
COG0507 696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 97.74
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.72
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.68
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.68
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 97.67
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.66
KOG02601605 consensus RNA polymerase II, large subunit [Transc 97.64
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.64
PRK14701 1638 reverse gyrase; Provisional 97.61
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.6
PRK04296190 thymidine kinase; Provisional 97.57
PHA02653 675 RNA helicase NPH-II; Provisional 97.57
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.57
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 97.56
PRK13767 876 ATP-dependent helicase; Provisional 97.54
COG1204 766 Superfamily II helicase [General function predicti 97.54
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.54
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.51
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.5
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.5
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 97.44
PRK04914 956 ATP-dependent helicase HepA; Validated 97.44
KOG0354 746 consensus DEAD-box like helicase [General function 97.38
PRK09694 878 helicase Cas3; Provisional 97.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.29
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.28
PRK08181269 transposase; Validated 97.28
KOG4284 980 consensus DEAD box protein [Transcription] 97.26
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.26
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.26
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.22
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.19
PRK12402337 replication factor C small subunit 2; Reviewed 97.17
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.16
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.15
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.14
PRK06526254 transposase; Provisional 97.11
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 97.09
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 97.08
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.07
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.04
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.04
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 97.03
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.03
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.02
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.01
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.99
PRK14873 665 primosome assembly protein PriA; Provisional 96.98
PRK14974336 cell division protein FtsY; Provisional 96.96
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.93
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.9
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.89
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.87
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.86
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.86
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 96.83
PRK13342 413 recombination factor protein RarA; Reviewed 96.83
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.83
PRK13341 725 recombination factor protein RarA/unknown domain f 96.82
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.81
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.79
PRK00440319 rfc replication factor C small subunit; Reviewed 96.79
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.78
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.77
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.76
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 96.76
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.75
KOG0987 540 consensus DNA helicase PIF1/RRM3 [Cell cycle contr 96.72
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.68
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.68
PHA03333 752 putative ATPase subunit of terminase; Provisional 96.68
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 96.67
PRK07940 394 DNA polymerase III subunit delta'; Validated 96.65
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.65
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.61
PRK04195 482 replication factor C large subunit; Provisional 96.6
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 96.6
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.55
PHA02244 383 ATPase-like protein 96.52
PRK14087 450 dnaA chromosomal replication initiation protein; P 96.51
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.49
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 96.49
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.49
PRK12422 445 chromosomal replication initiation protein; Provis 96.47
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 96.45
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 96.45
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.41
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.41
cd03115173 SRP The signal recognition particle (SRP) mediates 96.39
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.33
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.32
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.32
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.31
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 96.31
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 96.29
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.29
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.28
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 96.28
KOG0335 482 consensus ATP-dependent RNA helicase [RNA processi 96.25
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 96.24
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.24
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.2
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 96.2
PRK10876 1181 recB exonuclease V subunit beta; Provisional 96.18
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 96.18
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 96.18
PRK14086617 dnaA chromosomal replication initiation protein; P 96.16
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 96.16
PRK07952244 DNA replication protein DnaC; Validated 96.15
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 96.14
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.14
COG1205 851 Distinct helicase family with a unique C-terminal 96.13
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 96.12
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 96.09
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.08
PF13173128 AAA_14: AAA domain 96.08
smart00382148 AAA ATPases associated with a variety of cellular 96.06
COG4889 1518 Predicted helicase [General function prediction on 96.04
KOG0328 400 consensus Predicted ATP-dependent RNA helicase FAL 96.03
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 95.97
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.89
PRK09200 790 preprotein translocase subunit SecA; Reviewed 95.86
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.85
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.85
PRK08058 329 DNA polymerase III subunit delta'; Validated 95.85
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 95.84
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.83
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.82
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.82
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 95.81
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.77
PRK08084235 DNA replication initiation factor; Provisional 95.76
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.75
PF00004132 AAA: ATPase family associated with various cellula 95.72
PRK13909 910 putative recombination protein RecB; Provisional 95.7
PRK09112 351 DNA polymerase III subunit delta'; Validated 95.68
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.66
PRK07471 365 DNA polymerase III subunit delta'; Validated 95.66
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 95.64
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 95.64
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.64
PRK12377248 putative replication protein; Provisional 95.61
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 95.59
PRK06893229 DNA replication initiation factor; Validated 95.58
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 95.54
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 95.51
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.47
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.45
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 95.36
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 95.29
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 95.28
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.26
PRK10867 433 signal recognition particle protein; Provisional 95.26
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.25
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.24
PRK05707 328 DNA polymerase III subunit delta'; Validated 95.23
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 95.18
PRK08116268 hypothetical protein; Validated 95.17
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 95.16
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 95.13
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 95.08
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.05
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.02
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.95
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 94.94
KOG4439 901 consensus RNA polymerase II transcription terminat 94.94
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 94.92
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 94.91
COG0714329 MoxR-like ATPases [General function prediction onl 94.9
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 94.9
PRK05564313 DNA polymerase III subunit delta'; Validated 94.9
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 94.89
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.87
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.85
PHA02533 534 17 large terminase protein; Provisional 94.81
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.78
KOG0343 758 consensus RNA Helicase [RNA processing and modific 94.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.73
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.71
PRK00149450 dnaA chromosomal replication initiation protein; R 94.68
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 94.65
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 94.57
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 94.57
PRK08769 319 DNA polymerase III subunit delta'; Validated 94.56
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.53
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 94.43
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 94.4
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 94.3
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.29
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.25
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.22
TIGR00959 428 ffh signal recognition particle protein. This mode 94.22
CHL00195489 ycf46 Ycf46; Provisional 94.2
PRK09183259 transposase/IS protein; Provisional 94.18
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.17
KOG2028 554 consensus ATPase related to the helicase subunit o 94.16
PHA03368 738 DNA packaging terminase subunit 1; Provisional 94.15
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.1
KOG0387 923 consensus Transcription-coupled repair protein CSB 94.08
PRK08727233 hypothetical protein; Validated 94.02
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 94.01
PRK10416318 signal recognition particle-docking protein FtsY; 93.92
KOG0781587 consensus Signal recognition particle receptor, al 93.88
PRK13531 498 regulatory ATPase RavA; Provisional 93.85
PRK03992389 proteasome-activating nucleotidase; Provisional 93.84
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.81
PRK13833323 conjugal transfer protein TrbB; Provisional 93.75
PHA00350 399 putative assembly protein 93.71
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.7
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 93.7
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.68
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.67
PHA03372 668 DNA packaging terminase subunit 1; Provisional 93.62
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.57
PRK06851 367 hypothetical protein; Provisional 93.5
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.43
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.35
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.34
COG3973 747 Superfamily I DNA and RNA helicases [General funct 93.26
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 93.26
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.22
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 93.21
CHL00181287 cbbX CbbX; Provisional 93.19
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 93.18
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 93.13
PHA02544316 44 clamp loader, small subunit; Provisional 93.12
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 93.12
PRK05642234 DNA replication initiation factor; Validated 93.12
PRK06871 325 DNA polymerase III subunit delta'; Validated 93.09
COG1202 830 Superfamily II helicase, archaea-specific [General 93.02
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.98
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 92.88
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 92.87
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.87
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 92.84
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 92.72
KOG1123 776 consensus RNA polymerase II transcription initiati 92.7
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 92.68
PF05729166 NACHT: NACHT domain 92.57
PRK13107 908 preprotein translocase subunit SecA; Reviewed 92.56
PRK04328249 hypothetical protein; Provisional 92.55
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 92.51
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 92.47
PRK06067234 flagellar accessory protein FlaH; Validated 92.37
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 92.36
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.32
PRK06835329 DNA replication protein DnaC; Validated 92.32
PRK05298 652 excinuclease ABC subunit B; Provisional 92.31
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 92.31
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.29
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 92.28
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.26
PRK05973237 replicative DNA helicase; Provisional 92.22
PRK12904 830 preprotein translocase subunit SecA; Reviewed 92.22
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 92.12
COG0552340 FtsY Signal recognition particle GTPase [Intracell 92.11
KOG0388 1185 consensus SNF2 family DNA-dependent ATPase [Replic 92.1
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 92.09
PRK09361225 radB DNA repair and recombination protein RadB; Pr 92.06
PRK11331459 5-methylcytosine-specific restriction enzyme subun 92.05
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.04
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 91.95
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.93
PRK13909 910 putative recombination protein RecB; Provisional 91.86
PRK06620214 hypothetical protein; Validated 91.85
cd01394218 radB RadB. The archaeal protein radB shares simila 91.82
PRK07399 314 DNA polymerase III subunit delta'; Validated 91.81
PRK08939306 primosomal protein DnaI; Reviewed 91.79
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 91.75
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 91.69
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 91.67
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 91.66
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.63
CHL00095 821 clpC Clp protease ATP binding subunit 91.61
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 91.6
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 91.56
TIGR02012321 tigrfam_recA protein RecA. This model describes or 91.56
PRK06964 342 DNA polymerase III subunit delta'; Validated 91.55
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 91.54
PRK06921266 hypothetical protein; Provisional 91.51
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.41
KOG1002 791 consensus Nucleotide excision repair protein RAD16 91.4
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 91.37
PRK06090 319 DNA polymerase III subunit delta'; Validated 91.33
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 91.29
PRK10876 1181 recB exonuclease V subunit beta; Provisional 91.26
PRK07993 334 DNA polymerase III subunit delta'; Validated 91.09
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 91.04
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.04
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 90.98
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 90.96
COG4178604 ABC-type uncharacterized transport system, permeas 90.92
PRK08699 325 DNA polymerase III subunit delta'; Validated 90.85
KOG0333 673 consensus U5 snRNP-like RNA helicase subunit [RNA 90.8
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 90.68
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 90.62
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 90.61
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 90.56
cd00983325 recA RecA is a bacterial enzyme which has roles in 90.55
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 90.54
PRK13695174 putative NTPase; Provisional 90.48
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 90.47
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.35
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 90.32
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 90.24
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 90.2
PRK12326 764 preprotein translocase subunit SecA; Reviewed 90.2
KOG2108 853 consensus 3'-5' DNA helicase [Replication, recombi 90.17
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 90.16
PHA00729226 NTP-binding motif containing protein 90.14
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 89.98
TIGR02533486 type_II_gspE general secretory pathway protein E. 89.88
PRK10865 857 protein disaggregation chaperone; Provisional 89.83
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 89.79
TIGR00064272 ftsY signal recognition particle-docking protein F 89.77
PRK15483 986 type III restriction-modification system StyLTI en 89.71
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 89.61
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 89.57
PRK10436462 hypothetical protein; Provisional 89.56
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 89.45
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 89.42
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 89.42
PRK09302509 circadian clock protein KaiC; Reviewed 89.26
PRK13765 637 ATP-dependent protease Lon; Provisional 89.22
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 89.19
COG0610 962 Type I site-specific restriction-modification syst 89.14
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.13
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 89.03
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 89.03
PF12846304 AAA_10: AAA-like domain 88.98
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 88.94
PHA02624647 large T antigen; Provisional 88.94
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 88.88
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 88.83
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 88.81
PRK09354349 recA recombinase A; Provisional 88.79
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 88.77
cd01393226 recA_like RecA is a bacterial enzyme which has rol 88.75
PRK00131175 aroK shikimate kinase; Reviewed 88.64
CHL00176 638 ftsH cell division protein; Validated 88.56
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.56
PRK05818261 DNA polymerase III subunit delta'; Validated 88.54
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 88.46
PRK05917 290 DNA polymerase III subunit delta'; Validated 88.4
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 88.38
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.35
PRK12608380 transcription termination factor Rho; Provisional 88.26
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 88.19
KOG1533290 consensus Predicted GTPase [General function predi 88.02
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 87.89
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 87.81
PRK08118167 topology modulation protein; Reviewed 87.74
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 87.68
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 87.65
KOG0329 387 consensus ATP-dependent RNA helicase [RNA processi 87.63
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 87.58
PRK15455 644 PrkA family serine protein kinase; Provisional 87.56
PRK14531183 adenylate kinase; Provisional 87.55
PRK14532188 adenylate kinase; Provisional 87.54
PRK03839180 putative kinase; Provisional 87.49
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 87.48
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 87.46
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 87.35
COG2204464 AtoC Response regulator containing CheY-like recei 87.34
PRK06851367 hypothetical protein; Provisional 87.31
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 87.3
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 87.29
TIGR02773 1158 addB_Gpos ATP-dependent nuclease subunit B. DNA re 87.22
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 87.15
KOG0327 397 consensus Translation initiation factor 4F, helica 87.13
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 87.08
PRK02496184 adk adenylate kinase; Provisional 86.94
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 86.84
PRK10865857 protein disaggregation chaperone; Provisional 86.8
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.54
KOG0334 997 consensus RNA helicase [RNA processing and modific 86.5
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 86.42
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 86.38
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 86.35
PRK14530215 adenylate kinase; Provisional 86.34
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 86.32
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 86.3
PRK11823 446 DNA repair protein RadA; Provisional 86.27
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 86.24
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 86.22
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 86.21
KOG3928461 consensus Mitochondrial ribosome small subunit com 85.97
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 85.84
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 85.8
PRK08154309 anaerobic benzoate catabolism transcriptional regu 85.79
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 85.7
PRK14528186 adenylate kinase; Provisional 85.59
PRK05541176 adenylylsulfate kinase; Provisional 85.57
PRK00279215 adk adenylate kinase; Reviewed 85.5
PRK09302 509 circadian clock protein KaiC; Reviewed 85.49
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 85.4
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 85.35
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 85.33
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 85.3
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 85.28
PRK07261171 topology modulation protein; Provisional 85.22
PRK06696223 uridine kinase; Validated 85.21
PRK11608326 pspF phage shock protein operon transcriptional ac 85.17
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 85.16
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 85.16
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 85.15
PLN02200234 adenylate kinase family protein 85.15
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 85.09
PF07726131 AAA_3: ATPase family associated with various cellu 85.02
PRK08233182 hypothetical protein; Provisional 85.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 84.95
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 84.91
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 84.9
KOG0346 569 consensus RNA helicase [RNA processing and modific 84.89
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 84.81
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 84.68
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-46  Score=425.52  Aligned_cols=368  Identities=23%  Similarity=0.289  Sum_probs=276.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHhc-cccccceEeeehhhhhhcccccccccCccCCCCceEEEEEeCCCCCCCCCCCCC
Q 002130          557 LPSTYKDYFAALLYAEDFYEEKWSG-FQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSR  635 (961)
Q Consensus       557 T~~NYk~rF~~LL~LEEi~~eeirr-y~me~v~Lk~~~~~i~~k~L~g~~~g~~~~~~G~~fl~LeVpgLaE~RPsLlvG  635 (961)
                      ....|...|..|+.+|......+++ -.+++++.+|..+                 .+...+..|..|.+ ++.-.+..|
T Consensus       238 da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW~~g-----------------Lnkk~~a~f~~~k~-~~e~kl~~G  299 (935)
T KOG1802|consen  238 DAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRWDIG-----------------LNKKRLAYFTLPKL-DSELKLAIG  299 (935)
T ss_pred             chHHHhhhcchhhhhhhhhhhhhhhhcccccceEEeeec-----------------cccceEEEEecCCC-cchhccccC
Confidence            4789999999999999876665544 3567888998421                 23456777877877 555678899


Q ss_pred             CEEEEEECCCCceeEE--EEEEEEecc--cEEEEEECCCcccCCCCCCcEEEEEeeChhHHHHHHHHHHHHhh-------
Q 002130          636 DFVYAQRSGGKSKKFQ--GFLYRVVKW--TTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASD-------  704 (961)
Q Consensus       636 D~VlL~~~g~~~~~y~--G~V~~V~~s--d~V~L~f~~~f~~~~~~~~~~~V~F~lNR~t~rR~h~ALd~l~~-------  704 (961)
                      |.+.|+..++....|.  |+|.++-..  +++.|++...-....+...-|.|+|.++.++|.||..|+..+..       
T Consensus       300 dE~~L~y~~~~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~vs~  379 (935)
T KOG1802|consen  300 DEIRLTYSGGLVLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHGFTVDFVWKSTSFDRMQLALKLLAVDEKKVSG  379 (935)
T ss_pred             CeeEEEecCCcCCcccccceEEecCCCCcceeEEEeecCCCCCcccccceEEEEEEcCccHHHHHHHHHHhhhccccchh
Confidence            9999999876544454  778887653  56666553321111124456999999999999999999987741       


Q ss_pred             hhhccccCCCCCC---CCCCCCCCCCCCCCCCCCHHHHHHHHHHHhccCCCCceEeccCCCCCCccchHHHHHHHHHHHH
Q 002130          705 SLFRNYLFPDCAS---RKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIR  781 (961)
Q Consensus       705 ~ll~~iLFP~~~~---~r~ip~~~~~~~~n~~LN~eQr~AV~~ILs~~~~~P~LI~GPPGTGKTls~~g~TLVeaIlQLl  781 (961)
                      .....+|+-....   ....|. .+..+..++||.+|..||+++|++.   ..|||||||||||     .|.+++|.+++
T Consensus       380 y~y~klLgh~~~~~~~k~~LP~-~~s~~~lpkLN~SQ~~AV~~VL~rp---lsLIQGPPGTGKT-----vtsa~IVyhl~  450 (935)
T KOG1802|consen  380 YLYHKLLGHPVEDSSLKKLLPR-RFSVPNLPKLNASQSNAVKHVLQRP---LSLIQGPPGTGKT-----VTSATIVYHLA  450 (935)
T ss_pred             hhhhHHhcCcchhhhhcccCch-hhcCCCchhhchHHHHHHHHHHcCC---ceeeecCCCCCce-----ehhHHHHHHHH
Confidence            1112223321111   111221 1122234789999999999999874   6799999999999     99999999999


Q ss_pred             HhCCCCeEEEEecchHHHHHHHHHHHhhCCCCceEecccccccccC--cc-------------HHHHHhhhhc-------
Q 002130          782 RRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADG--VS-------------DEIFQVSLVE-------  839 (961)
Q Consensus       782 k~~p~~RILVcAPSNsAaD~LleRL~~~l~~~~ilRV~a~sR~~~~--V~-------------~~I~~y~~~~-------  839 (961)
                      ++ ...+||||||||.|+|+|++++++  .+.+++|+.+.+|+...  ++             +++....+..       
T Consensus       451 ~~-~~~~VLvcApSNiAVDqLaeKIh~--tgLKVvRl~aksRE~~~S~vs~L~lh~~~~~~~~pELq~l~klkde~gelS  527 (935)
T KOG1802|consen  451 RQ-HAGPVLVCAPSNIAVDQLAEKIHK--TGLKVVRLCAKSREDIESDVSFLSLHEQLRNMDKPELQKLLKLKDEGGELS  527 (935)
T ss_pred             Hh-cCCceEEEcccchhHHHHHHHHHh--cCceEeeeehhhhhhccCCccHHHHHHHHhccCcHHHHHHHhhhhhccccc
Confidence            87 678999999999999999999997  46899999999887432  11             1222111111       


Q ss_pred             ---cccc----CCChhhhhccceEEEEeeccchhhhccCCCCCCccEEEEecCCCCChHHHHHHHhccccCCCeEEEEeC
Q 002130          840 ---RECF----SCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGA  912 (961)
Q Consensus       840 ---~~~F----~~p~~e~L~~~rVVvtT~ssag~L~~~~~~~g~FdhVIIDEASQAtEPEaLIPLa~LA~~~trVVLaGD  912 (961)
                         +..|    +....+.|.+++||||||.+||...   +..-.|..|+||||.|++||||||||..   ..+++|||||
T Consensus       528 ~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~r---l~~~kfr~VLiDEaTQatEpe~LiPlvl---G~kq~VlVGD  601 (935)
T KOG1802|consen  528 SSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRR---LSKFKFRTVLIDEATQATEPECLIPLVL---GAKQLVLVGD  601 (935)
T ss_pred             chhhHHHHHHHHHHHHHHHhhcCEEEEecccccchh---hccccccEEEEecccccCCcchhhhhhh---cceeEEEecc
Confidence               1111    1124577899999999999998543   3335899999999999999999999983   5699999999


Q ss_pred             CCCCCccccChHHHhcCCChhHHHHHHcC--------Cccccc-------CchhhhhhhhcCC
Q 002130          913 PHNSPSRVRSDIARKNGLKMSYFERLCLT--------EAYRSC-------NSMFFSQLFTEEV  960 (961)
Q Consensus       913 pkQLpPvV~S~~A~k~GL~~SLFERL~~~--------~~Y~~~-------np~fITKLv~Ngv  960 (961)
                      |+||||+|..+.|...||.+||||||+..        .+||||       +..||.+-++|||
T Consensus       602 h~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGV  664 (935)
T KOG1802|consen  602 HKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGV  664 (935)
T ss_pred             ccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCc
Confidence            99999999999999999999999999874        789999       8999999999998

>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0260 consensus RNA polymerase II, large subunit [Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query961
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 4e-31
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 8e-30
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 2e-29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 5e-04
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
 Score =  129 bits (326), Expect = 4e-31
 Identities = 94/460 (20%), Positives = 151/460 (32%), Gaps = 97/460 (21%)

Query: 558 PSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEE-----SDET 612
            S Y+D +         Y+  +       V LE    A YDK LK    ++      D  
Sbjct: 3   GSRYEDAYQ--------YQNIFGPL----VKLE----ADYDKKLKESQTQDNITVRWDLG 46

Query: 613 DDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTT----VLVEFE 668
            +K  +A+      +    L+  D +  +  G  +  ++G  + +         + +E  
Sbjct: 47  LNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELR 106

Query: 669 EDFHSQHQPNHKYDVSFSFNRVCLKRAHEAV------ADASDSLFRNYLF----PDCASR 718
               +  +  H + V F +      R   A+        +      + L      D   +
Sbjct: 107 SSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIK 166

Query: 719 KSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVV-REAV 777
             +P           L+     AV  +L    +   L++GP         TG  V    +
Sbjct: 167 CQLPKRFTAQ-GLPDLNHSQVYAVKTVLQ---RPLSLIQGPP-------GTGKTVTSATI 215

Query: 778 LQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSL 837
           +    R     +L+CAP N   D+L E + +     ++ R  A  REA         +  
Sbjct: 216 VYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGL--KVVRLCAKSREAIDSPVSFLALHN 273

Query: 838 VERECFSCPPLEELRQYK------------------------------VISSTFVSSFRL 867
             R   S P L++L+Q K                              VI  T V +   
Sbjct: 274 QIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDP 333

Query: 868 HNQGITAGHFSHIFLID-ASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIAR 926
               +    F  I  ID ++ ATEPE M+ +   A    ++I+ G        V    A 
Sbjct: 334 R---LAKMQFRSIL-IDESTQATEPECMVPVVLGAK---QLILVGDHCQLGPVVMCKKAA 386

Query: 927 KNGLKMSYFERLC--------LTEAYRSCN--SMFFSQLF 956
           K GL  S FERL         L   YR     S F S +F
Sbjct: 387 KAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIF 426
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query961
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 100.0
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 100.0
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 100.0
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 100.0
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.68
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 99.67
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 99.63
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 99.53
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 99.32
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 99.26
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 99.14
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.0
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.99
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.98
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.92
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.9
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.89
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.89
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.83
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.82
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.81
3bor_A237 Human initiation factor 4A-II; translation initiat 98.8
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.8
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.76
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.75
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.75
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.72
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.71
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.7
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.7
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.69
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.69
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.69
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.68
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.68
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.66
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.65
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.65
3h1t_A 590 Type I site-specific restriction-modification syst 98.64
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.64
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.64
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 98.63
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.57
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.57
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.54
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.54
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.51
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.5
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.47
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.46
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.43
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.42
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.34
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.33
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.32
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.31
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.29
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.29
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.28
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.28
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.27
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.25
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.22
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.21
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.2
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.19
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.11
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.97
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.95
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.93
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.92
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.9
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.89
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.85
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.84
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.83
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.73
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.63
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 97.59
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.58
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.58
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.5
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.49
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.49
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 97.47
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.4
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.34
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.28
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 97.25
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.21
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.19
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.19
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.15
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.13
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.05
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.01
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.01
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.0
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 96.99
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.96
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.95
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 96.95
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 96.86
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 96.83
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.82
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 96.79
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.7
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.68
3bos_A242 Putative DNA replication factor; P-loop containing 96.61
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.6
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.57
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.49
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.48
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.47
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.45
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.44
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 96.44
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 96.44
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.33
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.33
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.29
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.24
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.23
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.22
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.18
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.1
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.07
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 96.05
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.03
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 95.99
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.86
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 95.78
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.78
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.74
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.71
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.7
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.63
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.58
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.57
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.5
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.45
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.44
3co5_A143 Putative two-component system transcriptional RES 95.36
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.32
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.31
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.3
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.28
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.24
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.22
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.18
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.1
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.09
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.02
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.96
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 94.96
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 94.88
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.83
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.77
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.75
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.72
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.69
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.67
3pvs_A 447 Replication-associated recombination protein A; ma 94.6
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.53
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.35
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.3
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 94.19
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.12
1tue_A212 Replication protein E1; helicase, replication, E1E 93.79
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 93.77
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.72
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.53
2qgz_A308 Helicase loader, putative primosome component; str 93.41
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.2
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.2
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.19
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.03
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.81
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.72
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.7
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.61
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.3
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.27
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.17
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 91.74
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 91.68
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 91.37
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 91.31
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 91.22
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.17
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.13
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.99
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.81
3io5_A333 Recombination and repair protein; storage dimer, i 90.48
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 90.32
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 90.3
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 90.12
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.06
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 89.49
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 89.39
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.39
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.26
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.91
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 88.75
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 88.74
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 88.54
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 88.53
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 88.5
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.39
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 88.28
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 88.2
1xp8_A366 RECA protein, recombinase A; recombination, radior 88.05
2r6a_A454 DNAB helicase, replicative helicase; replication, 87.89
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 87.85
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 87.76
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.62
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 87.35
1p9r_A418 General secretion pathway protein E; bacterial typ 87.2
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 87.11
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 87.11
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 87.03
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.94
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.9
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.89
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 86.85
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 86.77
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 86.74
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 86.65
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.48
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.48
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 86.31
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 86.29
1kag_A173 SKI, shikimate kinase I; transferase, structural g 86.05
1via_A175 Shikimate kinase; structural genomics, transferase 85.88
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.82
3vaa_A199 Shikimate kinase, SK; structural genomics, center 85.7
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 85.48
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 85.45
2fna_A 357 Conserved hypothetical protein; structural genomic 85.29
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 85.27
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 85.02
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 84.96
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 84.95
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 84.81
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 84.69
2vli_A183 Antibiotic resistance protein; transferase, tunica 84.69
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 84.68
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 84.68
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 84.68
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 84.65
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 84.57
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.5
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 84.39
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 84.33
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.2
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 84.11
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.01
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 83.97
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 83.96
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 83.95
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 83.87
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 83.75
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 83.73
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.69
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 83.68
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 83.53
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.44
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 83.42
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 83.39
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 83.13
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 82.9
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 82.84
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 82.64
3jux_A 822 Protein translocase subunit SECA; protein transloc 82.42
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.34
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 82.31
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 82.26
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 82.22
1vma_A306 Cell division protein FTSY; TM0570, structural gen 82.15
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 82.04
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 81.96
2z43_A324 DNA repair and recombination protein RADA; archaea 81.88
3tlx_A243 Adenylate kinase 2; structural genomics, structura 81.84
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 81.82
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 81.59
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 81.49
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 81.46
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 81.38
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 81.31
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 81.26
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 81.11
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 81.07
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 81.05
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 81.03
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 80.77
3l0o_A427 Transcription termination factor RHO; helicase, RH 80.72
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 80.7
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 80.4
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 80.14
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 80.07
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=100.00  E-value=9.6e-50  Score=464.47  Aligned_cols=362  Identities=24%  Similarity=0.243  Sum_probs=260.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHH-HHhccccccceEeeehhhhhhccccccccc------CccCCCCceEEEEEeCCCCCC-
Q 002130          557 LPSTYKDYFAALLYAEDFYEE-KWSGFQLFNVTLELHKAAIYDKSLKNKNLE------ESDETDDKLFVAFEIDSVPER-  628 (961)
Q Consensus       557 T~~NYk~rF~~LL~LEEi~~e-eirry~me~v~Lk~~~~~i~~k~L~g~~~g------~~~~~~G~~fl~LeVpgLaE~-  628 (961)
                      ++++|+++|..||.+|+.+.. +.+.. ++...++.       .+-.|.+++      ......|+.+++|+.+..... 
T Consensus         3 ~~~~~~~~~~~Ll~~E~~~e~~~~~~~-~~~~~~~~-------~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~   74 (646)
T 4b3f_X            3 AVESFVTKQLDLLELERDAEVEERRSW-QENISLKE-------LQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAA   74 (646)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHSSCHHH-------HGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC---C
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHH-HhcCCHHH-------HHhCCceecceEEEEEEecCCCeEEEEEEecCCCCCC
Confidence            468999999999999965432 22221 11111100       001122111      112235777888987644332 


Q ss_pred             -CC--CCCCCCEEEEEECCC-CceeEEEEEEEEecccEEEEEECCCccc--CCCCCCcEEEEEeeChhHHHHHHHHHHHH
Q 002130          629 -RP--FLLSRDFVYAQRSGG-KSKKFQGFLYRVVKWTTVLVEFEEDFHS--QHQPNHKYDVSFSFNRVCLKRAHEAVADA  702 (961)
Q Consensus       629 -RP--sLlvGD~VlL~~~g~-~~~~y~G~V~~V~~sd~V~L~f~~~f~~--~~~~~~~~~V~F~lNR~t~rR~h~ALd~l  702 (961)
                       -|  .+..||.|+|...++ ....++|+|++|.. +.|.|.|+.....  .......|.|.+..|+++|+||++|++.+
T Consensus        75 ~l~~~~~~~Gd~v~~~~~~~~~~~~~~g~v~~~~~-~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~al~~l  153 (646)
T 4b3f_X           75 ALPSNSFTSGDIVGLYDAANEGSQLATGILTRVTQ-KSVTVAFDESHDFQLSLDRENSYRLLKLANDVTYRRLKKALIAL  153 (646)
T ss_dssp             CCCCCCCCTTCEEEEEETTTTSCCCEEEEEEEEET-TEEEEECC-------CCCSSCCEEEEEECCHHHHHHHHHHHHHH
T ss_pred             CCccCCCCCCCEEEEEecCCCCCceEEEEEEEEeC-CEEEEEECCccccccccCCCCcEEEEEeccchHHHHHHHHHHHh
Confidence             22  588999999997654 34679999999999 9999999875332  22345679999999999999999999988


Q ss_pred             hh------hhhccccCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhccCCCCceEeccCCCCCCccchHHHHHHH
Q 002130          703 SD------SLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREA  776 (961)
Q Consensus       703 ~~------~ll~~iLFP~~~~~r~ip~~~~~~~~n~~LN~eQr~AV~~ILs~~~~~P~LI~GPPGTGKTls~~g~TLVea  776 (961)
                      ..      ..+.++||+........ ......|.+..||++|++||..+|...  +++||+||||||||     +||+++
T Consensus       154 ~~~~~~~~~~l~~~l~~~~~p~~~~-~~~~~~~~~~~LN~~Q~~AV~~al~~~--~~~lI~GPPGTGKT-----~ti~~~  225 (646)
T 4b3f_X          154 KKYHSGPASSLIEVLFGRSAPSPAS-EIHPLTFFNTCLDTSQKEAVLFALSQK--ELAIIHGPPGTGKT-----TTVVEI  225 (646)
T ss_dssp             HTCCSSTTHHHHHHHTTSSCCCCCC-CCCCCCCSSTTCCHHHHHHHHHHHHCS--SEEEEECCTTSCHH-----HHHHHH
T ss_pred             hhcccCchHHHHHHHcCCCCCCCcc-ccCcccccCCCCCHHHHHHHHHHhcCC--CceEEECCCCCCHH-----HHHHHH
Confidence            53      23557788765432211 122345667899999999999999764  37899999999999     999999


Q ss_pred             HHHHHHhCCCCeEEEEecchHHHHHHHHHHHhhCCCCceEecccccccccCccHHHHHhhhhc-----------------
Q 002130          777 VLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVE-----------------  839 (961)
Q Consensus       777 IlQLlk~~p~~RILVcAPSNsAaD~LleRL~~~l~~~~ilRV~a~sR~~~~V~~~I~~y~~~~-----------------  839 (961)
                      |+++++.  +.+|||||+||.|||+|++||..  .+.+++|++...|..    +.+..++...                 
T Consensus       226 I~~l~~~--~~~ILv~a~TN~AvD~i~erL~~--~~~~ilRlG~~~r~~----~~~~~~~l~~~~~~~~~~~~~~~~~~~  297 (646)
T 4b3f_X          226 ILQAVKQ--GLKVLCCAPSNIAVDNLVERLAL--CKQRILRLGHPARLL----ESIQQHSLDAVLARSDSAQIVADIRKD  297 (646)
T ss_dssp             HHHHHHT--TCCEEEEESSHHHHHHHHHHHHH--TTCCEEECSCCSSCC----HHHHTTBHHHHHTTTTCSSTHHHHHHH
T ss_pred             HHHHHhC--CCeEEEEcCchHHHHHHHHHHHh--cCCceEEecchhhhh----hhhhhhhHHHHHhhchHHHHHHHHHHH
Confidence            9999986  78999999999999999999986  357899999876532    2222111100                 


Q ss_pred             -cccc------------------------------CCChhhhhccceEEEEeeccchhhhc-cCCCCCCccEEEEecCCC
Q 002130          840 -RECF------------------------------SCPPLEELRQYKVISSTFVSSFRLHN-QGITAGHFSHIFLIDASS  887 (961)
Q Consensus       840 -~~~F------------------------------~~p~~e~L~~~rVVvtT~ssag~L~~-~~~~~g~FdhVIIDEASQ  887 (961)
                       +..+                              .....+.|..++||++||.+++.... ..+...+||+||||||+|
T Consensus       298 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ  377 (646)
T 4b3f_X          298 IDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVIDECAQ  377 (646)
T ss_dssp             HTTSSTTTTC------CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCSEEEETTGGG
T ss_pred             HHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCCEEEEcCccc
Confidence             0000                              00012346788999999998875322 224567899999999999


Q ss_pred             CChHHHHHHHhccccCCCeEEEEeCCCCCCccccChHHHhcCCChhHHHHHHc----------CCccccc
Q 002130          888 ATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCL----------TEAYRSC  947 (961)
Q Consensus       888 AtEPEaLIPLa~LA~~~trVVLaGDpkQLpPvV~S~~A~k~GL~~SLFERL~~----------~~~Y~~~  947 (961)
                      ++||++|+||.    ..+++||||||+||+|+|.+..|...||++||||||++          ..+||||
T Consensus       378 ~~e~~~lipL~----~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~L~~qYRmh  443 (646)
T 4b3f_X          378 ALEASCWIPLL----KARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRTLTVQYRMH  443 (646)
T ss_dssp             SCHHHHTTTGG----GSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEECCEESSSC
T ss_pred             cchHHHHhhcc----ccceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeeecccccCCc
Confidence            99999999996    45899999999999999999999999999999999975          2679998
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query961
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.87
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.64
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 99.5
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 99.25
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.92
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.72
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.69
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.65
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.65
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.62
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.62
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.62
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.57
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.53
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.51
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.49
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.48
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.46
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.42
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.36
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.33
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.29
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.11
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.04
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.03
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 97.85
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.6
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.4
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.01
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.98
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.92
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.87
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.84
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.83
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.63
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.57
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.54
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.5
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.49
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.37
d2qy9a2211 GTPase domain of the signal recognition particle r 96.28
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.15
d1vmaa2213 GTPase domain of the signal recognition particle r 96.1
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.02
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.83
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.58
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.27
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 95.23
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.18
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.12
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 94.48
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.45
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.44
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.37
d1okkd2207 GTPase domain of the signal recognition particle r 94.22
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.04
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.0
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 93.88
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.81
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.76
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.71
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 93.42
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.28
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.91
d1svma_362 Papillomavirus large T antigen helicase domain {Si 92.84
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.7
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.64
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.63
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.39
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.37
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.3
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.26
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.14
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.01
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.81
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.76
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.73
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.7
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.52
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 91.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.32
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.31
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.23
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.2
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.95
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.9
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.88
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.72
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 90.51
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.5
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.5
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.46
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.1
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.72
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.69
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.56
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.44
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.14
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.23
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.21
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.2
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 87.93
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 87.72
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 87.65
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 87.34
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.87
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 86.84
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.63
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.02
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.88
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 85.7
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.55
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 85.08
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.76
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 84.69
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 84.48
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.42
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.16
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 84.15
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 83.57
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 81.8
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 81.63
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 80.96
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.68
d1xpua3289 Transcription termination factor Rho, ATPase domai 80.49
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=4.8e-23  Score=224.19  Aligned_cols=237  Identities=14%  Similarity=0.113  Sum_probs=136.7

Q ss_pred             ChhHHHHHHHHHHHHhhhhhccccCCCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHhccCCCCceEeccCCCCCCc
Q 002130          688 NRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSL-CPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVL  766 (961)
Q Consensus       688 NR~t~rR~h~ALd~l~~~ll~~iLFP~~~~~r~ip~~~~-~~~~n~~LN~eQr~AV~~ILs~~~~~P~LI~GPPGTGKTl  766 (961)
                      +|+.++|+|++-..+.+. +.+...+......... ..+ ..+....++++|+.||..++.+.   .++|+|||||||| 
T Consensus       104 ~~lyl~~~~~~E~~ia~~-l~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~Q~~A~~~al~~~---~~vI~G~pGTGKT-  177 (359)
T d1w36d1         104 DRLYLNRMWCNERTVARF-FNEVNHAIEVDEALLA-QTLDKLFPVSDEINWQKVAAAVALTRR---ISVISGGPGTGKT-  177 (359)
T ss_dssp             SEEEEHHHHHHHHHHHHH-HTSCCBCCCCCHHHHH-HHHHTTCCCTTSCCHHHHHHHHHHTBS---EEEEECCTTSTHH-
T ss_pred             CEeehHHHHHHHHHHHHH-HHHhcCCCCCChHHHH-HHHHHhccCcccccHHHHHHHHHHcCC---eEEEEcCCCCCce-
Confidence            467788888887777642 3333322211100000 000 01112357889999999999764   7899999999999 


Q ss_pred             cchHHHHHHHHHHHHHh--CCCCeEEEEecchHHHHHHHHHHHhhCCCCceEecccccccccCccHHHHHhhhhcccccC
Q 002130          767 SKTGNVVREAVLQIRRR--SPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFS  844 (961)
Q Consensus       767 s~~g~TLVeaIlQLlk~--~p~~RILVcAPSNsAaD~LleRL~~~l~~~~ilRV~a~sR~~~~V~~~I~~y~~~~~~~F~  844 (961)
                          +|+++++..+++.  ..+.+|++|||||.||++|.+++......     +.........+..+..           
T Consensus       178 ----t~i~~~l~~l~~~~~~~~~~I~l~ApTgkAA~~L~e~~~~~~~~-----~~~~~~~~~~~~~~~~-----------  237 (359)
T d1w36d1         178 ----TTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQ-----LPLTDEQKKRIPEDAS-----------  237 (359)
T ss_dssp             ----HHHHHHHHHHHHTCSSCCCCEEEEBSSHHHHHHHHHHHTHHHHH-----SSCCSCCCCSCSCCCB-----------
T ss_pred             ----ehHHHHHHHHHHHHhccCCeEEEecCcHHHHHHHHHHHHHHHhh-----cCchhhhhhhhhhhhh-----------
Confidence                8988888777654  35679999999999999999998752110     0000000000000000           


Q ss_pred             CChhhhhccceEEEEeeccchhhhccCCCCCCccEEEEecCCCCChHHHHHHHhccccCCCeEEEEeCCCCCCcccc---
Q 002130          845 CPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVR---  921 (961)
Q Consensus       845 ~p~~e~L~~~rVVvtT~ssag~L~~~~~~~g~FdhVIIDEASQAtEPEaLIPLa~LA~~~trVVLaGDpkQLpPvV~---  921 (961)
                             .-+++...+.. ...+.........||+||||||+|+.++.....+. ....+++|||+||++||+||-.   
T Consensus       238 -------t~~~ll~~~~~-~~~~~~~~~~~l~~d~lIIDEaSmv~~~l~~~ll~-~~~~~~~lILvGD~~QLppV~~G~v  308 (359)
T d1w36d1         238 -------TLHRLLGAQPG-SQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLID-ALPDHARVIFLGDRDQLASVEAGAV  308 (359)
T ss_dssp             -------TTTSCC------------CTTSCCSCSEEEECSGGGCBHHHHHHHHH-TCCTTCEEEEEECTTSGGGTSTTBC
T ss_pred             -------HHHHHHhhhhc-chHHHHhhhcccccceeeehhhhccCHHHHHHHHH-HhcCCCEEEEECChhhccCCCCCcH
Confidence                   00010000000 11111222244579999999999999887666665 3356789999999999999843   


Q ss_pred             -ChHHH--hcCCChhHHHHHHcCCccccc-----Cc----hhhhhhhhcC
Q 002130          922 -SDIAR--KNGLKMSYFERLCLTEAYRSC-----NS----MFFSQLFTEE  959 (961)
Q Consensus       922 -S~~A~--k~GL~~SLFERL~~~~~Y~~~-----np----~fITKLv~Ng  959 (961)
                       .+..+  +.++.....++|.....|...     +.    .-+++|.+|+
T Consensus       309 l~dl~~~~~~~~~~~~~~~l~r~~~~~~~~~~~~~~~~i~d~l~~L~kny  358 (359)
T d1w36d1         309 LGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSY  358 (359)
T ss_dssp             HHHHGGGGTTCCCHHHHHHHHHHSSSCCCCCSTTTTHHHHTTEEECCCCC
T ss_pred             HHHHHHHHhcCCCHHHHHHHHHHhccccccccccccchhcChhhccccCC
Confidence             33332  346666555555443222222     11    1256777775
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure