Citrus Sinensis ID: 002153

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKLQR
ccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccEEEccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccEEEEEEcccccccHHHHHHHHHccccEEEccEEEcccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccEEEEEEEcccccccEEcccccccccccEEEEEEcccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEccccHHHHHHHHHHccccccccccEEEEEEEEEEEccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHccc
ccHHHHHHHHEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHccHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHcccEEEEEccccccccccccccccHHHcccEEEccccccEEEEEccccccccHHHHHHHcccccccccccHHHccccccEEEEEccEEcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEEEEcccccccEEEEcccccccccEEEEEccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccEEcccHHHHHHHHHHHHHccEEEccccEEEEEEEEEEccccEEEEEcccccccccccccccccccccHHHccccccccccccccccccccEEEEEEEEcccccccHHHHHHHHcHcccccccccccccccHHHHHHHHHHHHHHccEEEEEEccccccEEEEEEEEcccccccccccccccccccccccHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHccccccEEEEEcccccccccEHEEHccccccc
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMncfmnyeskdtktdLRGEVFKMWLNCWerisgnsyyIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTfhhgknpsaidqmTFTRYtertaferpltsGVAYAVRVLRSEREEFEKQQGwtikrmdtfehnpvhkdepspieeeyapvifaqDTVSHVISLdmlsgkedRENVLRARAsgkgvltapfrllkTNRLGVILTFAVYkrelpsnatpnerieatdgylggiFDIESLVEKLLHQLASKQTIFVNVYDitnlshpismygsnvsddglWLVSTlnfgdpfrkhemrcrfkqkapwpllaiSTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHeirtpmngvLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSlfsgksqdkGVELAVYISdrvpetligdpgRFRQIITNLMgnsikfteKGHIFVTVYLVEEVVDSIEVETELssskntlsgypvadrchswkgfktfnqdgstspfksssaDLINLIVSVedtgqgipleaqsriftpfmqvgpsisrthggtgiGLSISKYLVGRMKgeigfvsipnigstfTFTAVfgngsstsnehnsqqmnnqpnsvssefqgmkalvvdprpirakvSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSIsssrantstdgvsipsvimkpLRSSMLAASLQRAMgvgnkgnirnwelpsmSLRHLLLGRKilivddnnvNLKVAAAGLKRYGAAVVCVERGKkatellmpphqfdacfmdiqmpemdGYLFCFFAGLKLQR
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTErtaferpltsgvAYAVRVLRSEREefekqqgwtikrmdtfehnpVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRArasgkgvltapfrllktnrLGVILTFAVykrelpsnatpneriEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLatvsheirtPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISdrvpetligdpgRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETelssskntlsgypvADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPsisrthggtgIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISssrantstdgvsipsviMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKLQR
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKLQR
**LLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMS********************MLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRS*********GWTIK********************EYAPVIFAQDTVSHVISLDMLS*******VLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNA**NERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETEL*****TLSGYPVADRCHSWKGFKTF**************DLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFG*****************************ALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSI*****************I*********AASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLK***
**LLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYES************KMWLNCWERISGN*******************TWWRKVLITWLLFWTLVSLWIFWYMSSQA******ALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTF**************EEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKT************SSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSST*****************SEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISS****TSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLK***
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGS*******************SEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKLQR
*SLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETEL*****TLSGYPVADRCHSWKGFKTFN************ADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGS****************SVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVG******************LLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKL**
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRxxxxxxxxxxxxxxxxxxxxxDVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFAGLKLQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query959 2.2.26 [Sep-21-2011]
Q9C5U11036 Histidine kinase 3 OS=Ara yes no 0.968 0.896 0.700 0.0
Q9C5U21176 Histidine kinase 2 OS=Ara no no 0.890 0.726 0.559 0.0
Q9C5U01080 Histidine kinase 4 OS=Ara no no 0.885 0.786 0.544 0.0
Q54YZ9 2062 Hybrid signal transductio yes no 0.460 0.214 0.331 2e-58
P0AEC5 918 Signal transduction histi N/A no 0.451 0.471 0.309 8e-54
P0AEC6 918 Signal transduction histi yes no 0.451 0.471 0.309 8e-54
P0AEC7 918 Signal transduction histi N/A no 0.451 0.471 0.309 8e-54
P59342 918 Signal transduction histi yes no 0.451 0.471 0.307 3e-53
P48027 907 Sensor protein GacS OS=Ps N/A no 0.467 0.493 0.302 2e-49
Q86CZ21213 Hybrid signal transductio no no 0.311 0.246 0.335 1e-48
>sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1316 bits (3407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/968 (70%), Positives = 766/968 (79%), Gaps = 39/968 (4%)

Query: 1   MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEV----------- 49
           MSL HV GFG+K+GHL WMLCCW VS      F++   +D    L G V           
Sbjct: 1   MSLFHVLGFGVKIGHLFWMLCCWFVS-----WFVDNGIEDKSGLLVGSVGDLEKTKMTTL 55

Query: 50  ---FKMWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWY 106
               KMW   W +IS +   I    YQ +GS +  + WWRK+++ W++FW LVS+W FWY
Sbjct: 56  KKKNKMWF--WNKISSSGLKIPSFSYQFLGSVKFNKAWWRKLVVVWVVFWVLVSIWTFWY 113

Query: 107 MSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFT 166
            SSQA EKR+E L SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGK PSAIDQ TF+
Sbjct: 114 FSSQAMEKRKETLASMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKIPSAIDQRTFS 173

Query: 167 RYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKD-------E 219
            YT+RT+FERPLTSGVAYA+RVL SEREEFE+QQGWTI++M + E NPVHKD       E
Sbjct: 174 EYTDRTSFERPLTSGVAYAMRVLHSEREEFERQQGWTIRKMYSLEQNPVHKDDYDLEALE 233

Query: 220 PSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLG 279
           PSP++EEYAPVIFAQDTVSHV+SLDMLSGKEDRENVLRAR+SGKGVLTAPF L+KTNRLG
Sbjct: 234 PSPVQEEYAPVIFAQDTVSHVVSLDMLSGKEDRENVLRARSSGKGVLTAPFPLIKTNRLG 293

Query: 280 VILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDIT 339
           VILTFAVYKR+LPSNATP ERIEAT+GYLGG+FDIESLVE LL QLASKQTI VNVYDIT
Sbjct: 294 VILTFAVYKRDLPSNATPKERIEATNGYLGGVFDIESLVENLLQQLASKQTILVNVYDIT 353

Query: 340 NLSHPISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIA 399
           N S PISMYG+NVS DGL  VS L FGDP RKHEMRCRFKQK PWP+L++ TS GILVIA
Sbjct: 354 NHSQPISMYGTNVSADGLERVSPLIFGDPLRKHEMRCRFKQKPPWPVLSMVTSFGILVIA 413

Query: 400 SLVGHIFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGML 459
            LV HI  ATV+RI KVEED   M +LKKKAEAADVAKSQFLATVSHEIRTPMNGVLGML
Sbjct: 414 LLVAHIIHATVSRIHKVEEDCDKMKQLKKKAEAADVAKSQFLATVSHEIRTPMNGVLGML 473

Query: 460 DMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDV 519
            MLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAK+ESGKLELE V F+LR ILDDV
Sbjct: 474 HMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKIESGKLELEEVRFDLRGILDDV 533

Query: 520 LSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYL 579
           LSLFS KSQ KGVELAVYISDRVP+ LIGDPGRFRQI+TNLMGNSIKFTEKGHIFVTV+L
Sbjct: 534 LSLFSSKSQQKGVELAVYISDRVPDMLIGDPGRFRQILTNLMGNSIKFTEKGHIFVTVHL 593

Query: 580 VEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIV 639
           V+E+ +SI+ ET  SS ++TLSG PVADR  SW+ FK F+ +G  S F+ S  D INLIV
Sbjct: 594 VDELFESIDGETA-SSPESTLSGLPVADRQRSWENFKAFSSNGHRS-FEPSPPD-INLIV 650

Query: 640 SVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPN 699
           SVEDTG GIP+EAQSRIFTPFMQVGPSISRTHGGTGIGLSISK LVG MKGEIGF S P 
Sbjct: 651 SVEDTGVGIPVEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFSSTPK 710

Query: 700 IGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQ 759
           +GSTFTFTAVF NG   +   N    NNQP  + SEF+GMKA+VVD RP RAKVS YH Q
Sbjct: 711 VGSTFTFTAVFSNGMQPAERKND---NNQP--IFSEFRGMKAVVVDHRPARAKVSWYHFQ 765

Query: 760 RLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSK 819
           RLGI+VEVV    Q L  +  G+  +NMIL+EQE+W ++      F+  L+K       K
Sbjct: 766 RLGIRVEVVPRVEQALHYLKIGTTTVNMILIEQEIWNREADD---FIKKLQKDPLFLSPK 822

Query: 820 LFLLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMS 879
           L LLANS+ SS +     G+  P VI+KPLR+SMLAA+LQR +G+G +   ++   P++ 
Sbjct: 823 LILLANSVESSISEALCTGIDPPIVIVKPLRASMLAATLQRGLGIGIREPPQHKGPPALI 882

Query: 880 LRHLLLGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDI 939
           LR+LLLGRKILIVDDNNVNL+VAA  LK+YGA VVC E G KA  LL PPH+FDACFMDI
Sbjct: 883 LRNLLLGRKILIVDDNNVNLRVAAGALKKYGADVVCAESGIKAISLLKPPHEFDACFMDI 942

Query: 940 QMPEMDGY 947
           QMPEMDG+
Sbjct: 943 QMPEMDGF 950
Cytokinins (CK) receptor related to bacterial two-component regulators. Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. In the presence of cytokinin, feed phosphate to phosphorelay-integrating histidine phosphotransfer protein (HPt) and activates subsequent cascade. Involved in meristems establishment in seedlings. Redundant negative regulator of drought and salt stress responses and abscisic acid (ABA) signaling. Together with AHK2, plays a negative regulatory role in cold stress signaling via inhibition of ABA response, occurring independently of the cold acclimation pathway. Redundant positive regulator of cytokinin signaling that regulates many development process including seed germination, cell division, seed size, chlorophyll retention during leaf senescence, root repression and shoot promotion. Can interact with isoprenoid-type cytokinins trans-zeatin (tZ and tZR), cis-zeatin (cZ), dihydrozeatin (DZ), buta-2,3-dienyladenine (HA-8), penta-2,3-dienyladenine (HA-1), 4-methyl-penta-2,3-dienyladenine (HA-10), 4-hydroxy-2-butynyladenine (RM1), 2-propynyladenine (RM3), 2-butynyladenine (RM6), and cytokinin ribosides and ribotides. Together with AHK4, involved in the cytokinin-dependent responses to Pi starvation and sucrose stresses. Promotes cytokinin-mediated leaf longevity through a specific phosphorylation of the response regulator ARR2. Involved in alkamides (e.g. N-isobutyl decanamide) and N-acylethanolamides (NAE) signaling that control meristematic activity and differentiation processes during plant development. Contributes to vascular bundle formation and secondary growth in a cytokinin-dependent manner, probably by promoting the maintenance of mitotic activity and/or identity of procambial cells. Plays a role in the cytokinin-mediated repression of the iron uptake pathway. Required by the cytokinin-dependent flower development regulation pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 3EC: .EC: 3
>sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 Back     alignment and function description
>sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 Back     alignment and function description
>sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 Back     alignment and function description
>sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 Back     alignment and function description
>sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 Back     alignment and function description
>sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 Back     alignment and function description
>sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 Back     alignment and function description
>sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query959
1901483571053 histidine kinase 3 [Betula pendula] 0.986 0.898 0.792 0.0
1901483611019 histidine kinase 3B [Populus trichocarpa 0.984 0.926 0.783 0.0
2240755491029 histidine kinase cytokinin receptor [Pop 0.984 0.917 0.775 0.0
2254253921039 PREDICTED: histidine kinase 3 [Vitis vin 0.986 0.910 0.783 0.0
2240535031020 histidine kinase cytokinin receptor [Pop 0.985 0.926 0.765 0.0
2555476881005 histidine kinase 1, 2, 3 plant, putative 0.949 0.906 0.780 0.0
3565123851030 PREDICTED: histidine kinase 3-like [Glyc 0.984 0.916 0.746 0.0
3565251721030 PREDICTED: histidine kinase 3-like [Glyc 0.984 0.916 0.742 0.0
1161093531027 histidine kinase 1 [Medicago sativa] 0.984 0.919 0.729 0.0
3574629611047 Histidine kinase [Medicago truncatula] g 0.984 0.901 0.72 0.0
>gi|190148357|gb|ACE63261.1| histidine kinase 3 [Betula pendula] Back     alignment and taxonomy information
 Score = 1537 bits (3980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/954 (79%), Positives = 822/954 (86%), Gaps = 8/954 (0%)

Query: 1   MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERI 60
           MSLL+V GFGLKVGHLLWMLC WIVSVISMN F+N    D+KT L  +  KMWL CWE+I
Sbjct: 1   MSLLNVVGFGLKVGHLLWMLCYWIVSVISMNWFINSGIMDSKTGLLSDSSKMWLRCWEKI 60

Query: 61  SGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALG 120
           SGNS  I H Y Q  GSKRV + WWRK+LITW+  WT+VSLWIFWY+SSQATEKR+E+L 
Sbjct: 61  SGNSCKIQHHYSQYFGSKRVPKEWWRKLLITWVFGWTIVSLWIFWYLSSQATEKRKESLA 120

Query: 121 SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTS 180
           SMCDERARMLQDQFNVSMNH+QAMSI+IS FHHGKNPSAIDQ TF RYTERTAFERPLTS
Sbjct: 121 SMCDERARMLQDQFNVSMNHIQAMSIMISIFHHGKNPSAIDQRTFARYTERTAFERPLTS 180

Query: 181 GVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKD-------EPSPIEEEYAPVIFA 233
           GVAYAVRVL SERE+FEKQQGWTIKRMDT E NPVH+D       EPSPI+EEYAPVIFA
Sbjct: 181 GVAYAVRVLHSEREQFEKQQGWTIKRMDTLEQNPVHEDDYAPEALEPSPIQEEYAPVIFA 240

Query: 234 QDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPS 293
           QDT+SHV+SLDMLSGKEDRENVL AR SGKGVLTAPF+LLKTNRLGVILTFAVYK +LPS
Sbjct: 241 QDTISHVVSLDMLSGKEDRENVLLARESGKGVLTAPFKLLKTNRLGVILTFAVYKTDLPS 300

Query: 294 NATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVS 353
           NATPNERI+ATDGYLGG+FDIESLVEKLL QLASKQTI VNVYD TN SHPISMYGSNVS
Sbjct: 301 NATPNERIQATDGYLGGVFDIESLVEKLLQQLASKQTILVNVYDTTNHSHPISMYGSNVS 360

Query: 354 DDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRI 413
           DDGL   S LNFGDPFRKHEM CRFKQK PWP LAI+TSIGILVIA LVG+IF ATVNRI
Sbjct: 361 DDGLQHGSALNFGDPFRKHEMHCRFKQKPPWPWLAITTSIGILVIALLVGYIFHATVNRI 420

Query: 414 AKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQD 473
           AKVE+D   M ELKK+AEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDT+LDVTQQD
Sbjct: 421 AKVEDDCQKMTELKKQAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTDLDVTQQD 480

Query: 474 YVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVE 533
           YVRTAQ SGKALVSLINEVLDQAK+ESG+LELEAV F+LRAILDDVLSLFSGKS   GVE
Sbjct: 481 YVRTAQDSGKALVSLINEVLDQAKIESGRLELEAVQFDLRAILDDVLSLFSGKSPGNGVE 540

Query: 534 LAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETEL 593
           LAVYISD+VPE LIGD GRFRQIITNLMGNSIKFTEKGHIFVTV+LVEEV+ SIEVETE 
Sbjct: 541 LAVYISDQVPEMLIGDAGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEEVIGSIEVETE- 599

Query: 594 SSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQ 653
           SSS NTLSG+PVADR  SW GF+TF+Q+GST P  SSS+DLINLIVSVEDTG GIP EAQ
Sbjct: 600 SSSNNTLSGFPVADRKSSWDGFRTFSQEGSTCPLSSSSSDLINLIVSVEDTGVGIPREAQ 659

Query: 654 SRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNG 713
           SR+FTPFMQVGPSISRTHGGTGIGLSISK LVG MKGEIGFVSIPN GSTFTFTAVF N 
Sbjct: 660 SRVFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFVSIPNTGSTFTFTAVFTNA 719

Query: 714 SSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQ 773
           SS  NE+ S Q+NNQ  S SSEFQGM ALVVDPRP+RAKVSRYHIQRLGI+VE+V D  Q
Sbjct: 720 SSHPNEYKSLQINNQSKSTSSEFQGMTALVVDPRPVRAKVSRYHIQRLGIRVELVPDLNQ 779

Query: 774 CLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRAN 833
             + I+SG+  I+M+LVEQEVW++D+ ++ LF+N  +K       KLFLLAN I SS+  
Sbjct: 780 GFANISSGNTAIDMVLVEQEVWDRDSGIAVLFINKFKKSYSRIPPKLFLLANPIGSSKTR 839

Query: 834 TSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVD 893
            +T     P VIMKPLR+SML+ASLQRAMGVGNKGN RN ELP  SLR+LLLGRKILIVD
Sbjct: 840 AATSDDYTPPVIMKPLRASMLSASLQRAMGVGNKGNPRNGELPGSSLRNLLLGRKILIVD 899

Query: 894 DNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGY 947
           DNNVNL+VAA  LK+YGA VVC E GKKA  LL PPH FDACFMDIQMPE+DG+
Sbjct: 900 DNNVNLRVAAGALKKYGADVVCAESGKKAISLLKPPHHFDACFMDIQMPEIDGF 953

Source: Betula pendula

Species: Betula pendula

Genus: Betula

Family: Betulaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|190148361|gb|ACE63263.1| histidine kinase 3B [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224075549|ref|XP_002304678.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222842110|gb|EEE79657.1| histidine kinase cytokinin receptor [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225425392|ref|XP_002276961.1| PREDICTED: histidine kinase 3 [Vitis vinifera] gi|297738469|emb|CBI27670.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224053503|ref|XP_002297846.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|190148359|gb|ACE63262.1| histidine kinase 3A [Populus trichocarpa] gi|222845104|gb|EEE82651.1| histidine kinase cytokinin receptor [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255547688|ref|XP_002514901.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] gi|223545952|gb|EEF47455.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512385|ref|XP_003524900.1| PREDICTED: histidine kinase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356525172|ref|XP_003531201.1| PREDICTED: histidine kinase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|116109353|gb|ABJ74169.1| histidine kinase 1 [Medicago sativa] Back     alignment and taxonomy information
>gi|357462961|ref|XP_003601762.1| Histidine kinase [Medicago truncatula] gi|355490810|gb|AES72013.1| Histidine kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query959
TAIR|locus:20159641036 HK3 "histidine kinase 3" [Arab 0.973 0.901 0.701 0.0
TAIR|locus:21772611176 HK2 "histidine kinase 2" [Arab 0.879 0.716 0.571 5.7e-249
TAIR|locus:20597181080 WOL "WOODEN LEG" [Arabidopsis 0.735 0.652 0.567 2.3e-204
TIGR_CMR|CPS_4165 1683 CPS_4165 "sensory box histidin 0.209 0.119 0.387 2.6e-53
UNIPROTKB|Q9KPC0 927 VC_2453 "Sensor histidine kina 0.355 0.367 0.299 4.3e-51
TIGR_CMR|VC_2453 927 VC_2453 "sensor histidine kina 0.355 0.367 0.299 4.3e-51
DICTYBASE|DDB_G0269204 1699 dhkE "histidine kinase E" [Dic 0.354 0.200 0.338 6.4e-51
TIGR_CMR|GSU_23141025 GSU_2314 "sensory box histidin 0.190 0.178 0.392 1.7e-48
TIGR_CMR|CPS_4117 948 CPS_4117 "sensor histidine kin 0.185 0.187 0.390 3e-47
TIGR_CMR|SPO_0132739 SPO_0132 "sensor histidine kin 0.261 0.339 0.357 6e-47
TAIR|locus:2015964 HK3 "histidine kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3329 (1176.9 bits), Expect = 0., P = 0.
 Identities = 676/963 (70%), Positives = 764/963 (79%)

Query:     1 MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYES---------KDTKTDLRGEVFK 51
             MSL HV GFG+K+GHL WMLCCW VS    N   +            + TK     +  K
Sbjct:     1 MSLFHVLGFGVKIGHLFWMLCCWFVSWFVDNGIEDKSGLLVGSVGDLEKTKMTTLKKKNK 60

Query:    52 MWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQA 111
             MW   W +IS +   I    YQ +GS +  + WWRK+++ W++FW LVS+W FWY SSQA
Sbjct:    61 MWF--WNKISSSGLKIPSFSYQFLGSVKFNKAWWRKLVVVWVVFWVLVSIWTFWYFSSQA 118

Query:   112 TEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTER 171
              EKR+E L SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGK PSAIDQ TF+ YT+R
Sbjct:   119 MEKRKETLASMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKIPSAIDQRTFSEYTDR 178

Query:   172 TAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKD-------EPSPIE 224
             T+FERPLTSGVAYA+RVL SEREEFE+QQGWTI++M + E NPVHKD       EPSP++
Sbjct:   179 TSFERPLTSGVAYAMRVLHSEREEFERQQGWTIRKMYSLEQNPVHKDDYDLEALEPSPVQ 238

Query:   225 EEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTF 284
             EEYAPVIFAQDTVSHV+SLDMLSGKEDRENVLRAR+SGKGVLTAPF L+KTNRLGVILTF
Sbjct:   239 EEYAPVIFAQDTVSHVVSLDMLSGKEDRENVLRARSSGKGVLTAPFPLIKTNRLGVILTF 298

Query:   285 AVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHP 344
             AVYKR+LPSNATP ERIEAT+GYLGG+FDIESLVE LL QLASKQTI VNVYDITN S P
Sbjct:   299 AVYKRDLPSNATPKERIEATNGYLGGVFDIESLVENLLQQLASKQTILVNVYDITNHSQP 358

Query:   345 ISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGH 404
             ISMYG+NVS DGL  VS L FGDP RKHEMRCRFKQK PWP+L++ TS GILVIA LV H
Sbjct:   359 ISMYGTNVSADGLERVSPLIFGDPLRKHEMRCRFKQKPPWPVLSMVTSFGILVIALLVAH 418

Query:   405 IFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMD 464
             I  ATV+RI KVEED   M +LKKKAEAADVAKSQFLATVSHEIRTPMNGVLGML MLMD
Sbjct:   419 IIHATVSRIHKVEEDCDKMKQLKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLHMLMD 478

Query:   465 TELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFS 524
             TELDVTQQDYVRTAQASGKALVSLINEVLDQAK+ESGKLELE V F+LR ILDDVLSLFS
Sbjct:   479 TELDVTQQDYVRTAQASGKALVSLINEVLDQAKIESGKLELEEVRFDLRGILDDVLSLFS 538

Query:   525 GKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVV 584
              KSQ KGVELAVYISDRVP+ LIGDPGRFRQI+TNLMGNSIKFTEKGHIFVTV+LV+E+ 
Sbjct:   539 SKSQQKGVELAVYISDRVPDMLIGDPGRFRQILTNLMGNSIKFTEKGHIFVTVHLVDELF 598

Query:   585 DSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDT 644
             +SI+ ET  SS ++TLSG PVADR  SW+ FK F+ +G  S F+ S  D INLIVSVEDT
Sbjct:   599 ESIDGETA-SSPESTLSGLPVADRQRSWENFKAFSSNGHRS-FEPSPPD-INLIVSVEDT 655

Query:   645 GQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTF 704
             G GIP+EAQSRIFTPFMQVGPSISRTHGGTGIGLSISK LVG MKGEIGF S P +GSTF
Sbjct:   656 GVGIPVEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFSSTPKVGSTF 715

Query:   705 TFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQ 764
             TFTAVF NG   +   N    NNQP  + SEF+GMKA+VVD RP RAKVS YH QRLGI+
Sbjct:   716 TFTAVFSNGMQPAERKND---NNQP--IFSEFRGMKAVVVDHRPARAKVSWYHFQRLGIR 770

Query:   765 VEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLA 824
             VEVV    Q L  +  G+  +NMIL+EQE+W ++      F+  L+K       KL LLA
Sbjct:   771 VEVVPRVEQALHYLKIGTTTVNMILIEQEIWNREADD---FIKKLQKDPLFLSPKLILLA 827

Query:   825 NSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLL 884
             NS+ SS +     G+  P VI+KPLR+SMLAA+LQR +G+G +   ++   P++ LR+LL
Sbjct:   828 NSVESSISEALCTGIDPPIVIVKPLRASMLAATLQRGLGIGIREPPQHKGPPALILRNLL 887

Query:   885 LGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEM 944
             LGRKILIVDDNNVNL+VAA  LK+YGA VVC E G KA  LL PPH+FDACFMDIQMPEM
Sbjct:   888 LGRKILIVDDNNVNLRVAAGALKKYGADVVCAESGIKAISLLKPPHEFDACFMDIQMPEM 947

Query:   945 DGY 947
             DG+
Sbjct:   948 DGF 950
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000156 "phosphorelay response regulator activity" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004673 "protein histidine kinase activity" evidence=IEA;ISS;IDA;IMP
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA;RCA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0018106 "peptidyl-histidine phosphorylation" evidence=IEA
GO:0009736 "cytokinin mediated signaling pathway" evidence=RCA;TAS
GO:0009884 "cytokinin receptor activity" evidence=TAS
GO:0016036 "cellular response to phosphate starvation" evidence=IMP
GO:0071329 "cellular response to sucrose stimulus" evidence=IMP
GO:0010029 "regulation of seed germination" evidence=RCA;IMP
GO:0010271 "regulation of chlorophyll catabolic process" evidence=IMP
GO:0048831 "regulation of shoot system development" evidence=RCA;IMP
GO:0010150 "leaf senescence" evidence=IMP
GO:0004721 "phosphoprotein phosphatase activity" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0043424 "protein histidine kinase binding" evidence=IPI
GO:0005034 "osmosensor activity" evidence=IGI
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0034757 "negative regulation of iron ion transport" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP;IDA
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0080117 "secondary growth" evidence=IMP
GO:0009909 "regulation of flower development" evidence=IMP
GO:0048509 "regulation of meristem development" evidence=IMP
GO:0070417 "cellular response to cold" evidence=IMP
GO:0071215 "cellular response to abscisic acid stimulus" evidence=IMP
GO:0000303 "response to superoxide" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0007623 "circadian rhythm" evidence=RCA
GO:0008219 "cell death" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0031537 "regulation of anthocyanin metabolic process" evidence=RCA
TAIR|locus:2177261 HK2 "histidine kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059718 WOL "WOODEN LEG" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4165 CPS_4165 "sensory box histidine kinase/response regulator" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPC0 VC_2453 "Sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2453 VC_2453 "sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269204 dhkE "histidine kinase E" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4117 CPS_4117 "sensor histidine kinase/response regulator" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0132 SPO_0132 "sensor histidine kinase/response regulator" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C5U1AHK3_ARATH2, ., 7, ., 1, 3, ., 30.70040.96870.8967yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.130.976
3rd Layer2.7.13.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
HK3B
histidine kinase cytokinin receptor (1029 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinas 7e-93
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 5e-62
PRK15347921 PRK15347, PRK15347, two component system sensor ki 5e-53
COG0642336 COG0642, BaeS, Signal transduction histidine kinas 2e-47
PRK11466914 PRK11466, PRK11466, hybrid sensory histidine kinas 1e-46
PRK11091779 PRK11091, PRK11091, aerobic respiration control se 3e-41
pfam03924190 pfam03924, CHASE, CHASE domain 7e-40
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinas 9e-31
smart01079176 smart01079, CHASE, This domain is found in the ext 5e-28
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor k 2e-27
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 1e-26
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 9e-23
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 2e-20
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine 5e-20
COG5002459 COG5002, VicK, Signal transduction histidine kinas 4e-19
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 5e-19
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) 6e-19
pfam0051266 pfam00512, HisKA, His Kinase A (phospho-acceptor) 8e-19
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regul 1e-17
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kina 2e-17
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; 8e-16
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisiona 1e-15
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/p 2e-15
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; 1e-13
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 3e-13
cd00156113 cd00156, REC, Signal receiver domain; originally t 8e-13
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 1e-12
PRK10549466 PRK10549, PRK10549, signal transduction histidine- 2e-12
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provision 4e-12
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; 3e-11
pfam00072111 pfam00072, Response_reg, Response regulator receiv 7e-11
PRK13837828 PRK13837, PRK13837, two-component VirA-like sensor 3e-10
smart0044855 smart00448, REC, cheY-homologous receiver domain 1e-09
COG3852363 COG3852, NtrB, Signal transduction histidine kinas 2e-09
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provision 7e-09
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kina 7e-09
PRK10618894 PRK10618, PRK10618, phosphotransfer intermediate p 8e-08
COG3437 360 COG3437, COG3437, Response regulator containing a 9e-08
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 2e-07
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kina 2e-07
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II) 7e-07
COG2204 464 COG2204, AtoC, Response regulator containing CheY- 1e-06
COG0745 229 COG0745, OmpR, Response regulators consisting of a 4e-06
PRK15347 921 PRK15347, PRK15347, two component system sensor ki 2e-05
PRK09470461 PRK09470, cpxA, two-component sensor protein; Prov 2e-05
COG3290537 COG3290, CitA, Signal transduction histidine kinas 3e-05
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative 3e-05
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system 4e-05
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provision 4e-05
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisi 6e-05
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicat 7e-05
COG4192673 COG4192, COG4192, Signal transduction histidine ki 8e-05
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regula 1e-04
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinas 2e-04
PRK11086542 PRK11086, PRK11086, sensory histidine kinase DcuS; 2e-04
COG4191603 COG4191, COG4191, Signal transduction histidine ki 3e-04
PRK11091 779 PRK11091, PRK11091, aerobic respiration control se 4e-04
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 7e-04
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 0.001
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information 
 Score =  314 bits (808), Expect = 7e-93
 Identities = 169/523 (32%), Positives = 242/523 (46%), Gaps = 82/523 (15%)

Query: 427 KKKA-EAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKAL 485
           KK+A EAA + KS+FLA +SHE+RTP+NGV+G     + T L  TQ+DY++T + S   L
Sbjct: 283 KKRAQEAARI-KSEFLANMSHELRTPLNGVIGFTRQTLKTPLTPTQRDYLQTIERSANNL 341

Query: 486 VSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPET 545
           +++IN++LD +K+E+GKL LE + F+LR  LD+V++L +  + +KG+EL + I   VP+ 
Sbjct: 342 LAIINDILDFSKLEAGKLVLENIPFSLRETLDEVVTLLAHSAHEKGLELTLNIDPDVPDN 401

Query: 546 LIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPV 605
           +IGDP R +QIITNL+GN+IKFTE G+I + V L                          
Sbjct: 402 VIGDPLRLQQIITNLVGNAIKFTESGNIDILVEL-------------------------- 435

Query: 606 ADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGP 665
                                 ++ S   + L V + DTG GI    QS++F  F Q   
Sbjct: 436 ----------------------RALSNTKVQLEVQIRDTGIGISERQQSQLFQAFRQADA 473

Query: 666 SISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQM 725
           SISR HGGTG+GL I++ LV  M G+I F S PN GSTF F           N +    +
Sbjct: 474 SISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHLPLD-----LNPN--PII 526

Query: 726 NNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQ--VEVVSDQLQCLSQIASGSK 783
           +  P        G + L V+P    A+        +  +  +EV       LSQ+     
Sbjct: 527 DGLPTDC---LAGKRLLYVEPNSAAAQA----TLDILSETPLEVTYSPT--LSQLPEAHY 577

Query: 784 IINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPS 843
            I ++ +            T+    L K        L L         A          +
Sbjct: 578 DILLLGLPV----TFREPLTMLHERLAKA-KSMTDFLILALPCHEQVLA-EQLKQDGADA 631

Query: 844 VIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAA 903
            + KPL  + L  +L          + +   LP      L L   ++ VDDN  NLK+  
Sbjct: 632 CLSKPLSHTRLLPALLE-----PCHHKQPPLLPPTDESRLPL--TVMAVDDNPANLKLIG 684

Query: 904 AGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDG 946
           A L+     VV  + G +A E       FD   MDIQMP MDG
Sbjct: 685 ALLEEQVEHVVLCDSGHQAVEQAK-QRPFDLILMDIQMPGMDG 726

Length = 919
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|217796 pfam03924, CHASE, CHASE domain Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|215015 smart01079, CHASE, This domain is found in the extracellular portion of receptor-like proteins - such as serine/threonine kinases and adenylyl cyclases Back     alignment and domain information
>gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain Back     alignment and domain information
>gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|226655 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|236839 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 959
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK10841924 hybrid sensory kinase in two-component regulatory 100.0
PRK15347921 two component system sensor kinase SsrA; Provision 100.0
PRK11091779 aerobic respiration control sensor protein ArcB; P 100.0
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 100.0
PRK10618894 phosphotransfer intermediate protein in two-compon 100.0
KOG0519786 consensus Sensory transduction histidine kinase [S 100.0
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK099591197 hybrid sensory histidine kinase in two-component r 100.0
PRK13837828 two-component VirA-like sensor kinase; Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal 100.0
PRK09303380 adaptive-response sensory kinase; Validated 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 100.0
PRK11006430 phoR phosphate regulon sensor protein; Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK13557540 histidine kinase; Provisional 100.0
PRK10815485 sensor protein PhoQ; Provisional 99.98
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 99.97
PRK10549466 signal transduction histidine-protein kinase BaeS; 99.97
PRK10490895 sensor protein KdpD; Provisional 99.97
PRK10364457 sensor protein ZraS; Provisional 99.97
PRK10755356 sensor protein BasS/PmrB; Provisional 99.97
COG4191603 Signal transduction histidine kinase regulating C4 99.97
PRK09835482 sensor kinase CusS; Provisional 99.97
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 99.97
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 99.97
COG3852363 NtrB Signal transduction histidine kinase, nitroge 99.97
PRK09470461 cpxA two-component sensor protein; Provisional 99.96
COG4251750 Bacteriophytochrome (light-regulated signal transd 99.96
PRK09467435 envZ osmolarity sensor protein; Provisional 99.96
PRK10337449 sensor protein QseC; Provisional 99.96
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 99.96
PRK11100475 sensory histidine kinase CreC; Provisional 99.95
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 99.95
COG0642336 BaeS Signal transduction histidine kinase [Signal 99.94
PRK11360607 sensory histidine kinase AtoS; Provisional 99.94
PF03924193 CHASE: CHASE domain; InterPro: IPR006189 The CHASE 99.93
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 99.92
PRK13560807 hypothetical protein; Provisional 99.92
PRK11086542 sensory histidine kinase DcuS; Provisional 99.89
PRK11644495 sensory histidine kinase UhpB; Provisional 99.88
COG5000712 NtrY Signal transduction histidine kinase involved 99.88
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 99.87
COG3614348 Predicted periplasmic ligand-binding sensor domain 99.87
COG4192673 Signal transduction histidine kinase regulating ph 99.84
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 99.8
PRK13559361 hypothetical protein; Provisional 99.79
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 99.74
COG3290537 CitA Signal transduction histidine kinase regulati 99.74
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.69
KOG0519786 consensus Sensory transduction histidine kinase [S 99.61
PRK10547670 chemotaxis protein CheA; Provisional 99.59
PRK04184 535 DNA topoisomerase VI subunit B; Validated 99.51
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 99.41
PRK09581 457 pleD response regulator PleD; Reviewed 99.27
PF0051268 HisKA: His Kinase A (phospho-acceptor) domain; Int 99.24
TIGR01052488 top6b DNA topoisomerase VI, B subunit. This model 99.23
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.23
COG3452297 Predicted periplasmic ligand-binding sensor domain 99.19
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 99.19
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 99.18
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 99.13
PRK03660146 anti-sigma F factor; Provisional 99.05
COG0643716 CheA Chemotaxis protein histidine kinase and relat 99.03
COG3851497 UhpB Signal transduction histidine kinase, glucose 98.99
COG4585365 Signal transduction histidine kinase [Signal trans 98.98
COG3920221 Signal transduction histidine kinase [Signal trans 98.95
COG3706 435 PleD Response regulator containing a CheY-like rec 98.9
COG0745 229 OmpR Response regulators consisting of a CheY-like 98.89
COG2972456 Predicted signal transduction protein with a C-ter 98.84
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 98.83
COG3850574 NarQ Signal transduction histidine kinase, nitrate 98.82
PRK04069161 serine-protein kinase RsbW; Provisional 98.74
COG4753 475 Response regulator containing CheY-like receiver d 98.7
COG3437 360 Response regulator containing a CheY-like receiver 98.63
COG3275557 LytS Putative regulator of cell autolysis [Signal 98.53
COG2204 464 AtoC Response regulator containing CheY-like recei 98.47
COG4564459 Signal transduction histidine kinase [Signal trans 98.46
KOG0787414 consensus Dehydrogenase kinase [Signal transductio 98.46
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 98.46
PF00072112 Response_reg: Response regulator receiver domain; 98.41
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimer 98.4
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 98.34
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.34
PRK15347 921 two component system sensor kinase SsrA; Provision 98.29
COG2197 211 CitB Response regulator containing a CheY-like rec 98.28
PLN03029 222 type-a response regulator protein; Provisional 98.28
PF14501100 HATPase_c_5: GHKL domain 98.26
COG2201 350 CheB Chemotaxis response regulator containing a Ch 98.26
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 98.25
COG3947 361 Response regulator containing CheY-like receiver a 98.13
COG4565 224 CitB Response regulator of citrate/malate metaboli 98.1
PRK10046 225 dpiA two-component response regulator DpiA; Provis 98.08
COG0745229 OmpR Response regulators consisting of a CheY-like 98.06
PF00072112 Response_reg: Response regulator receiver domain; 98.05
PRK11173 237 two-component response regulator; Provisional 98.05
PRK13856 241 two-component response regulator VirG; Provisional 98.02
PRK10529 225 DNA-binding transcriptional activator KdpE; Provis 98.0
PRK12555 337 chemotaxis-specific methylesterase; Provisional 97.99
PRK10701 240 DNA-binding transcriptional regulator RstA; Provis 97.97
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provis 97.95
PRK10766 221 DNA-binding transcriptional regulator TorR; Provis 97.93
PRK09468 239 ompR osmolarity response regulator; Provisional 97.93
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacce 97.93
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 97.93
PRK15029 755 arginine decarboxylase; Provisional 97.91
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provis 97.91
PRK14084 246 two-component response regulator; Provisional 97.91
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.9
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory 97.9
PRK09836 227 DNA-binding transcriptional activator CusR; Provis 97.89
PRK11697 238 putative two-component response-regulatory protein 97.88
PRK10643 222 DNA-binding transcriptional regulator BasR; Provis 97.88
PRK10161 229 transcriptional regulator PhoB; Provisional 97.88
TIGR02875 262 spore_0_A sporulation transcription factor Spo0A. 97.87
PRK00742 354 chemotaxis-specific methylesterase; Provisional 97.83
COG4566 202 TtrR Response regulator [Signal transduction mecha 97.81
PRK11517 223 transcriptional regulatory protein YedW; Provision 97.81
PRK15115 444 response regulator GlrR; Provisional 97.8
TIGR03787 227 marine_sort_RR proteobacterial dedicated sortase s 97.78
PRK10336 219 DNA-binding transcriptional regulator QseB; Provis 97.78
PRK10365 441 transcriptional regulatory protein ZraR; Provision 97.78
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 97.77
PRK10430 239 DNA-binding transcriptional activator DcuR; Provis 97.77
COG2204 464 AtoC Response regulator containing CheY-like recei 97.76
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 97.75
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 97.75
PRK11083 228 DNA-binding response regulator CreB; Provisional 97.67
TIGR01387 218 cztR_silR_copR heavy metal response regulator. Mem 97.65
CHL00148 240 orf27 Ycf27; Reviewed 97.64
PRK09390 202 fixJ response regulator FixJ; Provisional 97.64
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 97.61
PRK09958 204 DNA-binding transcriptional activator EvgA; Provis 97.61
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provis 97.59
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 97.58
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 97.56
PRK13558 665 bacterio-opsin activator; Provisional 97.54
PLN03029222 type-a response regulator protein; Provisional 97.51
PRK10360 196 DNA-binding transcriptional activator UhpA; Provis 97.51
PRK10100 216 DNA-binding transcriptional regulator CsgD; Provis 97.48
PRK09483 217 response regulator; Provisional 97.47
PRK15411 207 rcsA colanic acid capsular biosynthesis activation 97.46
PRK10841924 hybrid sensory kinase in two-component regulatory 97.45
PRK09935 210 transcriptional regulator FimZ; Provisional 97.42
PRK10840 216 transcriptional regulator RcsB; Provisional 97.4
PRK15479 221 transcriptional regulatory protein TctD; Provision 97.35
PRK09191261 two-component response regulator; Provisional 97.32
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 97.31
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 97.25
PRK13435145 response regulator; Provisional 97.23
COG3437 360 Response regulator containing a CheY-like receiver 97.19
COG4567 182 Response regulator consisting of a CheY-like recei 97.17
PRK09581 457 pleD response regulator PleD; Reviewed 97.15
PRK10610129 chemotaxis regulatory protein CheY; Provisional 97.09
PRK13557540 histidine kinase; Provisional 97.0
PRK10403 215 transcriptional regulator NarP; Provisional 96.97
COG3706435 PleD Response regulator containing a CheY-like rec 96.94
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 96.89
PRK15369 211 two component system sensor kinase SsrB; Provision 96.89
PRK10651 216 transcriptional regulator NarL; Provisional 96.88
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 96.88
PRK10161229 transcriptional regulator PhoB; Provisional 96.85
COG3707 194 AmiR Response regulator with putative antiterminat 96.85
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 96.83
COG4566202 TtrR Response regulator [Signal transduction mecha 96.78
smart0044855 REC cheY-homologous receiver domain. CheY regulate 96.77
PRK13837828 two-component VirA-like sensor kinase; Provisional 96.77
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 96.71
COG4565224 CitB Response regulator of citrate/malate metaboli 96.7
PRK09468239 ompR osmolarity response regulator; Provisional 96.69
PRK11173237 two-component response regulator; Provisional 96.66
PRK09836227 DNA-binding transcriptional activator CusR; Provis 96.63
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 96.62
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 96.59
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 96.58
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 96.55
COG4753 475 Response regulator containing CheY-like receiver d 96.54
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 96.53
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 96.52
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 96.48
cd00156113 REC Signal receiver domain; originally thought to 96.47
PRK10618 894 phosphotransfer intermediate protein in two-compon 96.45
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 96.42
PRK11517223 transcriptional regulatory protein YedW; Provision 96.42
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 96.41
PRK10046225 dpiA two-component response regulator DpiA; Provis 96.4
PRK10840216 transcriptional regulator RcsB; Provisional 96.36
PRK11083228 DNA-binding response regulator CreB; Provisional 96.36
PRK12555 337 chemotaxis-specific methylesterase; Provisional 96.33
COG3279 244 LytT Response regulator of the LytR/AlgR family [T 96.32
PRK13856241 two-component response regulator VirG; Provisional 96.31
CHL00148240 orf27 Ycf27; Reviewed 96.27
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 96.26
PRK15115 444 response regulator GlrR; Provisional 96.21
PRK10365 441 transcriptional regulatory protein ZraR; Provision 96.17
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 96.13
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 96.09
PRK11475 207 DNA-binding transcriptional activator BglJ; Provis 96.07
COG2197211 CitB Response regulator containing a CheY-like rec 96.05
PRK00742 354 chemotaxis-specific methylesterase; Provisional 95.92
PRK14084246 two-component response regulator; Provisional 95.91
PRK09483217 response regulator; Provisional 95.82
PRK10610129 chemotaxis regulatory protein CheY; Provisional 95.77
PRK13435145 response regulator; Provisional 95.69
COG3947 361 Response regulator containing CheY-like receiver a 95.67
COG4567182 Response regulator consisting of a CheY-like recei 95.66
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 95.62
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 95.53
PRK11697238 putative two-component response-regulatory protein 95.46
PRK15479221 transcriptional regulatory protein TctD; Provision 95.45
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 95.4
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 95.35
PRK09191261 two-component response regulator; Provisional 95.27
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 95.16
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 94.97
PRK09390202 fixJ response regulator FixJ; Provisional 94.92
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 94.88
PRK09935210 transcriptional regulator FimZ; Provisional 94.63
cd00156113 REC Signal receiver domain; originally thought to 93.71
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 93.26
PRK15369211 two component system sensor kinase SsrB; Provision 93.13
PRK10651216 transcriptional regulator NarL; Provisional 93.05
PRK10403215 transcriptional regulator NarP; Provisional 92.71
PRK13558 665 bacterio-opsin activator; Provisional 92.61
PRK05644 638 gyrB DNA gyrase subunit B; Validated 92.6
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 92.51
COG3707194 AmiR Response regulator with putative antiterminat 92.36
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 92.35
PRK15411207 rcsA colanic acid capsular biosynthesis activation 92.35
PRK15029 755 arginine decarboxylase; Provisional 91.66
PRK05218 613 heat shock protein 90; Provisional 91.36
PRK14083 601 HSP90 family protein; Provisional 90.05
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 89.95
COG2201 350 CheB Chemotaxis response regulator containing a Ch 89.31
PTZ00130 814 heat shock protein 90; Provisional 88.9
smart0044855 REC cheY-homologous receiver domain. CheY regulate 86.77
COG5381184 Uncharacterized protein conserved in bacteria [Fun 86.51
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 85.79
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 85.48
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 85.19
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 83.06
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.9e-53  Score=536.57  Aligned_cols=451  Identities=36%  Similarity=0.503  Sum_probs=364.7

Q ss_pred             HHHHHHHHHHHHHhHhhcchhhhHHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCccee
Q 002153          427 KKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELE  506 (959)
Q Consensus       427 ~~~ae~a~~aks~Fla~iSHEIRTPL~~I~g~lelL~~~~l~~~q~~~l~~i~~s~~~L~~lIndlLd~skiesg~l~l~  506 (959)
                      +++++++++.|++|++++||||||||++|.|+++++.....++.+++|++.+..++++|..+|+++++++|+++++..++
T Consensus       283 ~~~~~~~~~~~~~~l~~isHelrtPL~~i~~~~~~l~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~~~~~~  362 (919)
T PRK11107        283 KKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRQTLKTPLTPTQRDYLQTIERSANNLLAIINDILDFSKLEAGKLVLE  362 (919)
T ss_pred             HHHHHHHHHHHHHHHHHhhHhhcccHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEE
Confidence            34566677788999999999999999999999999988888888999999999999999999999999999999999999


Q ss_pred             eEeecHHHHHHHHHHHHhhhhhccCcEEEEEecCCCCceEEecHHHHHHHHHHHHHHHHhccCCCcEEEEEEEeeccccc
Q 002153          507 AVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDS  586 (959)
Q Consensus       507 ~~~~dL~~ll~~vl~~~~~~a~~k~I~l~~~i~~~~p~~v~gD~~rL~QIL~NLl~NAiKfT~~G~I~v~v~~~~~~~~~  586 (959)
                      ..++++.+++++++..+...+..|++.+.+.+++..|..+.+|+.+|+||+.||++||+|||+.|.|.|++.....    
T Consensus       363 ~~~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~d~~~l~~vl~NLl~NAik~~~~g~v~i~v~~~~~----  438 (919)
T PRK11107        363 NIPFSLRETLDEVVTLLAHSAHEKGLELTLNIDPDVPDNVIGDPLRLQQIITNLVGNAIKFTESGNIDILVELRAL----  438 (919)
T ss_pred             EeecCHHHHHHHHHHHHHHHHHHcCCEEEEEeCCCCCceEEeCHHHHHHHHHHHHHHHhhcCCCCcEEEEEEEEec----
Confidence            9999999999999999999999999999999988888788999999999999999999999999998877754211    


Q ss_pred             chhhhhhccccCcCCCCCccccccccCccccccCCCCCCCCCCCccCceeEEEEEEEcCCCCChhhHhhccCCccccCCC
Q 002153          587 IEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPS  666 (959)
Q Consensus       587 i~i~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFepF~q~~~s  666 (959)
                                                                  ..+...+.|+|.|+|+|||++.++++|+||++.+.+
T Consensus       439 --------------------------------------------~~~~~~~~i~V~D~G~Gi~~~~~~~if~~f~~~~~~  474 (919)
T PRK11107        439 --------------------------------------------SNTKVQLEVQIRDTGIGISERQQSQLFQAFRQADAS  474 (919)
T ss_pred             --------------------------------------------CCCeeEEEEEEEEeCCCcCHHHHHHHhhhhccCCCC
Confidence                                                        112235789999999999999999999999999988


Q ss_pred             CcCcCCCccchHHHHHHHHHHcCCEEEEEEeCCCcEEEEEEEEeCCCCCCCCccccccccCCCCCCCcccCCceEEEeCC
Q 002153          667 ISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDP  746 (959)
Q Consensus       667 ~s~~~~GtGLGLsI~k~LVe~mgG~I~v~S~~g~GttF~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~rvLvvdd  746 (959)
                      .++..+|+||||+|||++++.|||+|+++|.+|+||+|+|++|+........          .......+.|.+++++||
T Consensus       475 ~~~~~~g~GLGL~i~~~i~~~~gG~i~v~s~~~~Gt~f~i~lp~~~~~~~~~----------~~~~~~~~~g~~ili~d~  544 (919)
T PRK11107        475 ISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHLPLDLNPNPII----------DGLPTDCLAGKRLLYVEP  544 (919)
T ss_pred             CCCCCCCcchhHHHHHHHHHHhCCEEEEEecCCCCEEEEEEEEeccCCcccc----------ccCCccccCCCeEEEEeC
Confidence            8888899999999999999999999999999999999999999964332110          111234577899999999


Q ss_pred             chhHHHHHHHHHHHcCCEEEEEcCHHHHHHHHhcCCCcccEEEEeccccccCccchHHHHHHHHhcCCCCCceEEEEecC
Q 002153          747 RPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANS  826 (959)
Q Consensus       747 ~~~~~~v~~~~l~~~G~~v~~~~~~~~al~~l~~~~~~~~~ilid~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~  826 (959)
                      ++..+..+..+|+.+|+.+..+.+..+ +     ....+|++++|..+........  ....++..... .+.++++..+
T Consensus       545 ~~~~~~~l~~~L~~~g~~v~~~~~~~~-l-----~~~~~d~il~~~~~~~~~~~~~--~~~~~~~~~~~-~~~~i~~~~~  615 (919)
T PRK11107        545 NSAAAQATLDILSETPLEVTYSPTLSQ-L-----PEAHYDILLLGLPVTFREPLTM--LHERLAKAKSM-TDFLILALPC  615 (919)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEcCCHHH-h-----ccCCCCEEEecccCCCCCCHHH--HHHHHHhhhhc-CCcEEEEeCC
Confidence            999999999999999999999998877 2     2466899999987764432221  22222222122 2233333332


Q ss_pred             CCcccccccCCCCCCCccccCCCChHHHHHHHHHHhcCCCCCCcccCCCCcchhhhccCCCEEEEEeCCHHHHHHHHHHH
Q 002153          827 ISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAAAGL  906 (959)
Q Consensus       827 ~~~~~~~~~~~~~~~~~~l~KPl~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ILivdDn~~~~~~l~~~L  906 (959)
                      ...... ......|...++.||+....+...+............      . .......+.+|||||||+.++..+..+|
T Consensus       616 ~~~~~~-~~~~~~g~~~~l~kp~~~~~l~~~l~~~~~~~~~~~~------~-~~~~~~~~~~vLivdd~~~~~~~l~~~L  687 (919)
T PRK11107        616 HEQVLA-EQLKQDGADACLSKPLSHTRLLPALLEPCHHKQPPLL------P-PTDESRLPLTVMAVDDNPANLKLIGALL  687 (919)
T ss_pred             cchhhH-HHHhhCCCceEECCCCCHHHHHHHHHHhhcccccccc------c-ccccccCCCeEEEEeCCHHHHHHHHHHH
Confidence            222222 2222336778999999999998888765421111000      0 0011123568999999999999999999


Q ss_pred             hhCCCEEEEEcChHHHHHHhCCCCCccEEEEcCCCCCCCHHHHHHHh
Q 002153          907 KRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYLFCFFA  953 (959)
Q Consensus       907 ~~~g~~v~~a~~g~eal~~~~~~~~~DlilmDi~MP~mdG~e~~~~~  953 (959)
                      +..|+.+.++.+|.+|++.+. ...||+||||+.||+|||+++|+..
T Consensus       688 ~~~~~~v~~~~~~~~al~~~~-~~~~dlil~D~~mp~~~g~~~~~~l  733 (919)
T PRK11107        688 EEQVEHVVLCDSGHQAVEQAK-QRPFDLILMDIQMPGMDGIRACELI  733 (919)
T ss_pred             HHcCCEEEEECCHHHHHHHHH-hCCCCEEEEeCCCCCCcHHHHHHHH
Confidence            999999999999999999985 5789999999999999999999754

>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PF03924 CHASE: CHASE domain; InterPro: IPR006189 The CHASE domain is an extracellular domain of 200-230 amino acids, which is found in transmembrane receptors from bacteria, lower eukaryotes and plants Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>COG3614 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>COG3452 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
3t4j_A270 Arabidopsis Histidine Kinase 4 Sensor Domain In Com 2e-98
4ew8_A268 Crystal Structure Of A C-Terminal Part Of Tyrosine 8e-13
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 1e-11
3dge_A258 Structure Of A Histidine Kinase-response Regulator 1e-11
3sl2_A177 Atp Forms A Stable Complex With The Essential Histi 4e-08
3a0r_A349 Crystal Structure Of Histidine Kinase Thka (Tm1359) 7e-08
3mm4_A206 Crystal Structure Of The Receiver Domain Of The His 9e-08
1r62_A160 Crystal Structure Of The C-terminal Domain Of The T 1e-05
3d36_A244 How To Switch Off A Histidine Kinase: Crystal Struc 2e-04
3dge_C122 Structure Of A Histidine Kinase-response Regulator 4e-04
>pdb|3T4J|A Chain A, Arabidopsis Histidine Kinase 4 Sensor Domain In Complex With N- Isopentenyl Adenine Length = 270 Back     alignment and structure 
Iteration: 1

 Score =  357 bits (916), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/271 (64%), Positives = 208/271 (76%), Gaps = 10/271 (3%)
Query: 114 KRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTA 173
           +R E L SMCD+RARMLQDQF+VS+NHV A++IL+STFH+ KNPSAIDQ TF  YT RTA
Sbjct: 8   RREEVLVSMCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFAEYTARTA 67
Query: 174 FERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFA 233
           FERPL SGVAYA +V+  ERE FE+Q  W IK MD        + EPSP+ +EYAPVIF+
Sbjct: 68  FERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMD--------RGEPSPVRDEYAPVIFS 119
Query: 234 QDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPS 293
           QD+VS++ SLDM+SG+EDREN+LRAR +GK VLT+PFRLL+T+ LGV+LTF VYK  LP 
Sbjct: 120 QDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPFRLLETHHLGVVLTFPVYKSSLPE 179
Query: 294 NATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSN-- 351
           N T  ERI AT GYLGG FD+ESLVE LL QLA  Q I V+VYDITN S P+ MYG+   
Sbjct: 180 NPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLVMYGNQDE 239
Query: 352 VSDDGLWLVSTLNFGDPFRKHEMRCRFKQKA 382
            +D  L   S L+FGDPFRKH+M CR+ QKA
Sbjct: 240 EADRSLSHESKLDFGDPFRKHKMICRYHQKA 270
>pdb|4EW8|A Chain A, Crystal Structure Of A C-Terminal Part Of Tyrosine Kinase (Divl) From Caulobacter Crescentus Cb15 At 2.50 A Resolution Length = 268 Back     alignment and structure
>pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure
>pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 Back     alignment and structure
>pdb|3SL2|A Chain A, Atp Forms A Stable Complex With The Essential Histidine Kinase Walk (yycg) Domain Length = 177 Back     alignment and structure
>pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 Back     alignment and structure
>pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 Back     alignment and structure
>pdb|1R62|A Chain A, Crystal Structure Of The C-terminal Domain Of The Two-component System Transmitter Protein Nrii (ntrb) Length = 160 Back     alignment and structure
>pdb|3D36|A Chain A, How To Switch Off A Histidine Kinase: Crystal Structure Of Geobacillus Stearothermophilus Kinb With The Inhibitor Sda Length = 244 Back     alignment and structure
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query959
3t4l_A270 Histidine kinase 4; PAS domain, hormone receptor, 1e-87
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 1e-79
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 2e-76
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 1e-35
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 5e-34
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 5e-32
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 4e-30
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 7e-30
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 1e-26
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 6e-25
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 2e-24
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 2e-24
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 1e-21
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 4e-20
1mb3_A124 Cell division response regulator DIVK; signal tran 3e-19
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 3e-19
3c97_A140 Signal transduction histidine kinase; structural g 1e-18
2ayx_A254 Sensor kinase protein RCSC; two independent struct 3e-18
2ayx_A254 Sensor kinase protein RCSC; two independent struct 6e-17
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 3e-18
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 4e-18
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 6e-18
3i42_A127 Response regulator receiver domain protein (CHEY- 6e-18
3luf_A259 Two-component system response regulator/ggdef doma 4e-17
3luf_A 259 Two-component system response regulator/ggdef doma 2e-11
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 8e-17
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 8e-17
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 1e-16
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 3e-16
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 2e-14
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 3e-14
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 1e-13
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 1e-10
1w25_A 459 Stalked-cell differentiation controlling protein; 4e-10
1w25_A 459 Stalked-cell differentiation controlling protein; 4e-05
3grc_A140 Sensor protein, kinase; protein structure initiati 5e-10
3hdv_A136 Response regulator; PSI-II, structural genomics, P 7e-10
3bre_A 358 Probable two-component response regulator; protein 1e-09
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 2e-09
3lua_A140 Response regulator receiver protein; two-component 2e-09
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 2e-09
3h5i_A140 Response regulator/sensory box protein/ggdef domai 2e-09
3eq2_A 394 Probable two-component response regulator; adaptor 3e-09
3hdg_A137 Uncharacterized protein; two-component sensor acti 4e-09
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 8e-09
2rjn_A154 Response regulator receiver:metal-dependent phosph 1e-08
3gt7_A154 Sensor protein; structural genomics, signal receiv 1e-08
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 1e-08
2zay_A147 Response regulator receiver protein; structural ge 1e-08
3c3m_A138 Response regulator receiver protein; structural ge 1e-08
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 3e-08
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 3e-08
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 4e-08
3cnb_A143 DNA-binding response regulator, MERR family; signa 4e-08
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 4e-08
1srr_A124 SPO0F, sporulation response regulatory protein; as 6e-08
4fmt_A228 CHPT protein; A phosphotransfer protein, A two-com 8e-08
3jte_A143 Response regulator receiver protein; structural ge 1e-07
3nhm_A133 Response regulator; protein structure initiative I 1e-07
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 2e-07
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 2e-07
3cfy_A137 Putative LUXO repressor protein; structural genomi 2e-07
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 2e-07
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 2e-07
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 3e-07
3lte_A132 Response regulator; structural genomics, PSI, prot 3e-07
3heb_A152 Response regulator receiver domain protein (CHEY); 5e-07
4dad_A146 Putative pilus assembly-related protein; response 6e-07
3cg4_A142 Response regulator receiver domain protein (CHEY-; 6e-07
3n53_A140 Response regulator receiver modulated diguanylate; 8e-07
2rdm_A132 Response regulator receiver protein; structural ge 1e-06
3eqz_A135 Response regulator; structural genomics, unknown f 1e-06
3a10_A116 Response regulator; phosphoacceptor, signaling pro 1e-06
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 1e-06
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 2e-06
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 3e-06
1xhf_A123 DYE resistance, aerobic respiration control protei 4e-06
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 4e-06
2qr3_A140 Two-component system response regulator; structura 6e-06
2qxy_A142 Response regulator; regulation of transcription, N 6e-06
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 7e-06
1s8n_A 205 Putative antiterminator; RV1626, structural genomi 7e-06
2qv0_A143 Protein MRKE; structural genomics, transcription, 7e-06
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 8e-06
1zgz_A122 Torcad operon transcriptional regulatory protein; 1e-05
3rqi_A 184 Response regulator protein; structural genomics, s 1e-05
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 2e-05
3cg0_A140 Response regulator receiver modulated diguanylate 2e-05
1mvo_A136 PHOP response regulator; phosphate regulon, transc 3e-05
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 5e-05
2oqr_A 230 Sensory transduction protein REGX3; response regul 5e-05
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 5e-05
2gwr_A 238 DNA-binding response regulator MTRA; two-component 5e-05
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 6e-05
3snk_A135 Response regulator CHEY-like protein; P-loop conta 6e-05
2gkg_A127 Response regulator homolog; social motility, recei 6e-05
1qo0_D 196 AMIR; binding protein, gene regulator, receptor; 2 6e-05
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 8e-05
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 1e-04
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 3e-04
3crn_A132 Response regulator receiver domain protein, CHEY-; 6e-04
3q9s_A 249 DNA-binding response regulator; DNA binding protei 7e-04
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 8e-04
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 8e-04
>3t4l_A Histidine kinase 4; PAS domain, hormone receptor, endop reticulum; HET: ZEA; 1.53A {Arabidopsis thaliana} PDB: 3t4k_A* 3t4j_A* 3t4o_A* 3t4q_A* 3t4s_A* 3t4t_A* Length = 270 Back     alignment and structure
 Score =  280 bits (717), Expect = 1e-87
 Identities = 175/278 (62%), Positives = 209/278 (75%), Gaps = 10/278 (3%)

Query: 107 MSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFT 166
           M      +R E L SMCD+RARMLQDQF+VS+NHV A++IL+STFH+ KNPSAIDQ TF 
Sbjct: 1   MDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFA 60

Query: 167 RYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEE 226
            YT RTAFERPL SGVAYA +V+  ERE FE+Q  W IK MD        + EPSP+ +E
Sbjct: 61  EYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMD--------RGEPSPVRDE 112

Query: 227 YAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAV 286
           YAPVIF+QD+VS++ SLDM+SG+EDREN+LRAR +GK VLT+PFRLL+T+ LGV+LTF V
Sbjct: 113 YAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPFRLLETHHLGVVLTFPV 172

Query: 287 YKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPIS 346
           YK  LP N T  ERI AT GYLGG FD+ESLVE LL QLA  Q I V+VYDITN S P+ 
Sbjct: 173 YKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLV 232

Query: 347 MYGSN--VSDDGLWLVSTLNFGDPFRKHEMRCRFKQKA 382
           MYG+    +D  L   S L+FGDPFRKH+M CR+ QKA
Sbjct: 233 MYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKA 270
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Length = 145 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query959
3t4l_A270 Histidine kinase 4; PAS domain, hormone receptor, 100.0
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 100.0
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 100.0
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 100.0
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 100.0
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 100.0
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 100.0
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 100.0
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 99.97
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.97
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 99.97
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 99.97
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 99.94
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 99.9
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 99.9
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 99.9
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 99.89
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 99.89
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 99.89
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 99.88
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 99.86
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 99.78
3zxo_A129 Redox sensor histidine kinase response regulator; 99.77
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 99.73
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.64
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.64
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 99.63
3luf_A259 Two-component system response regulator/ggdef doma 99.62
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.57
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.47
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.37
1w25_A 459 Stalked-cell differentiation controlling protein; 99.35
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.34
2lpm_A123 Two-component response regulator; transcription re 99.3
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.02
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.02
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 98.98
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 98.93
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 98.9
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 98.86
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 98.86
3rqi_A 184 Response regulator protein; structural genomics, s 98.85
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 98.82
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 98.8
3gt7_A154 Sensor protein; structural genomics, signal receiv 98.76
1mb3_A124 Cell division response regulator DIVK; signal tran 98.72
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 98.72
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 98.72
3i42_A127 Response regulator receiver domain protein (CHEY- 98.72
3grc_A140 Sensor protein, kinase; protein structure initiati 98.72
3h5i_A140 Response regulator/sensory box protein/ggdef domai 98.71
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 98.71
1srr_A124 SPO0F, sporulation response regulatory protein; as 98.71
3c3m_A138 Response regulator receiver protein; structural ge 98.7
3a10_A116 Response regulator; phosphoacceptor, signaling pro 98.7
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 98.69
3crn_A132 Response regulator receiver domain protein, CHEY-; 98.69
1xhf_A123 DYE resistance, aerobic respiration control protei 98.67
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 98.67
3lte_A132 Response regulator; structural genomics, PSI, prot 98.67
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 98.66
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 98.66
3c97_A140 Signal transduction histidine kinase; structural g 98.66
1yio_A 208 Response regulatory protein; transcription regulat 98.66
1zgz_A122 Torcad operon transcriptional regulatory protein; 98.65
3r0j_A 250 Possible two component system response transcript 98.65
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 98.65
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 98.64
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 98.64
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 98.64
3lua_A140 Response regulator receiver protein; two-component 98.63
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 98.63
3heb_A152 Response regulator receiver domain protein (CHEY); 98.63
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 98.63
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 98.63
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 98.62
3hdv_A136 Response regulator; PSI-II, structural genomics, P 98.62
3eq2_A 394 Probable two-component response regulator; adaptor 98.62
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 98.62
1mvo_A136 PHOP response regulator; phosphate regulon, transc 98.61
3kto_A136 Response regulator receiver protein; PSI-II,struct 98.59
2rjn_A154 Response regulator receiver:metal-dependent phosph 98.59
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 98.58
1s8n_A 205 Putative antiterminator; RV1626, structural genomi 98.58
3nhm_A133 Response regulator; protein structure initiative I 98.58
3cfy_A137 Putative LUXO repressor protein; structural genomi 98.58
4dad_A146 Putative pilus assembly-related protein; response 98.57
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 98.57
3cg4_A142 Response regulator receiver domain protein (CHEY-; 98.57
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 98.56
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 98.56
2lpm_A123 Two-component response regulator; transcription re 98.56
3jte_A143 Response regulator receiver protein; structural ge 98.55
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 98.55
1dz3_A130 Stage 0 sporulation protein A; response regulator, 98.55
2rdm_A132 Response regulator receiver protein; structural ge 98.54
3snk_A135 Response regulator CHEY-like protein; P-loop conta 98.54
3f6c_A134 Positive transcription regulator EVGA; structural 98.52
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 98.52
3hdg_A137 Uncharacterized protein; two-component sensor acti 98.52
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 98.51
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 98.51
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 98.5
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 98.5
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 98.49
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 98.49
1w25_A 459 Stalked-cell differentiation controlling protein; 98.49
3q9s_A 249 DNA-binding response regulator; DNA binding protei 98.49
2qxy_A142 Response regulator; regulation of transcription, N 98.48
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 98.48
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 98.47
3cnb_A143 DNA-binding response regulator, MERR family; signa 98.47
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 98.46
1ys7_A 233 Transcriptional regulatory protein PRRA; response 98.45
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 98.45
2zay_A147 Response regulator receiver protein; structural ge 98.45
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 98.45
3eqz_A135 Response regulator; structural genomics, unknown f 98.44
3eul_A152 Possible nitrate/nitrite response transcriptional 98.44
3n53_A140 Response regulator receiver modulated diguanylate; 98.43
1a04_A 215 Nitrate/nitrite response regulator protein NARL; s 98.42
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.41
3r0j_A250 Possible two component system response transcript 98.41
2gkg_A127 Response regulator homolog; social motility, recei 98.41
2gwr_A 238 DNA-binding response regulator MTRA; two-component 98.41
2oqr_A 230 Sensory transduction protein REGX3; response regul 98.4
3cg0_A140 Response regulator receiver modulated diguanylate 98.39
2qr3_A140 Two-component system response regulator; structura 98.38
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 98.38
3cz5_A153 Two-component response regulator, LUXR family; str 98.37
3n0r_A286 Response regulator; sigma factor, receiver, two-co 98.37
2qv0_A143 Protein MRKE; structural genomics, transcription, 98.36
3bre_A 358 Probable two-component response regulator; protein 98.33
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 98.33
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 98.33
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 98.31
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 98.31
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 98.29
3grc_A140 Sensor protein, kinase; protein structure initiati 98.29
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 98.29
3i42_A127 Response regulator receiver domain protein (CHEY- 98.29
3c3w_A 225 Two component transcriptional regulatory protein; 98.28
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 98.26
3lua_A140 Response regulator receiver protein; two-component 98.26
3klo_A 225 Transcriptional regulator VPST; REC domain, HTH do 98.24
3gt7_A154 Sensor protein; structural genomics, signal receiv 98.24
3h5i_A140 Response regulator/sensory box protein/ggdef domai 98.24
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 98.24
2qsj_A154 DNA-binding response regulator, LUXR family; struc 98.23
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 98.23
3cg4_A142 Response regulator receiver domain protein (CHEY-; 98.23
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 98.23
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 98.23
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription 98.22
3heb_A152 Response regulator receiver domain protein (CHEY); 98.22
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 98.22
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 98.21
3lte_A132 Response regulator; structural genomics, PSI, prot 98.21
2pln_A137 HP1043, response regulator; signaling protein; 1.8 98.2
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 98.2
3nhm_A133 Response regulator; protein structure initiative I 98.2
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 98.18
1qo0_D 196 AMIR; binding protein, gene regulator, receptor; 2 98.16
3hdv_A136 Response regulator; PSI-II, structural genomics, P 98.16
2gkg_A127 Response regulator homolog; social motility, recei 98.15
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 98.13
3jte_A143 Response regulator receiver protein; structural ge 98.12
1mb3_A124 Cell division response regulator DIVK; signal tran 98.12
3zcc_A114 HAMP, osmolarity sensor protein ENVZ; signaling pr 98.12
3c3m_A138 Response regulator receiver protein; structural ge 98.12
2ayx_A254 Sensor kinase protein RCSC; two independent struct 98.11
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 98.11
3cnb_A143 DNA-binding response regulator, MERR family; signa 98.1
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 98.1
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 98.1
3rqi_A184 Response regulator protein; structural genomics, s 98.09
3c97_A140 Signal transduction histidine kinase; structural g 98.07
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 98.06
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 98.06
3luf_A259 Two-component system response regulator/ggdef doma 98.06
2zay_A147 Response regulator receiver protein; structural ge 98.04
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 98.04
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 98.03
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 98.03
3n53_A140 Response regulator receiver modulated diguanylate; 98.03
2rjn_A154 Response regulator receiver:metal-dependent phosph 98.03
3snk_A135 Response regulator CHEY-like protein; P-loop conta 98.02
4dad_A146 Putative pilus assembly-related protein; response 98.02
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 98.02
3a10_A116 Response regulator; phosphoacceptor, signaling pro 98.01
3kto_A136 Response regulator receiver protein; PSI-II,struct 98.01
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 98.0
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 97.99
2hqr_A 223 Putative transcriptional regulator; phosporylation 97.98
3hdg_A137 Uncharacterized protein; two-component sensor acti 97.98
1srr_A124 SPO0F, sporulation response regulatory protein; as 97.96
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 97.95
2rdm_A132 Response regulator receiver protein; structural ge 97.95
3cg0_A140 Response regulator receiver modulated diguanylate 97.95
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 97.94
3crn_A132 Response regulator receiver domain protein, CHEY-; 97.94
2pln_A137 HP1043, response regulator; signaling protein; 1.8 97.94
3f6c_A134 Positive transcription regulator EVGA; structural 97.94
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 97.94
1xhf_A123 DYE resistance, aerobic respiration control protei 97.94
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 97.93
2qxy_A142 Response regulator; regulation of transcription, N 97.92
1mvo_A136 PHOP response regulator; phosphate regulon, transc 97.92
1zgz_A122 Torcad operon transcriptional regulatory protein; 97.91
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 97.91
2qr3_A140 Two-component system response regulator; structura 97.9
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 97.89
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 97.86
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 97.85
1ys7_A233 Transcriptional regulatory protein PRRA; response 97.85
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 97.83
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 97.83
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 97.83
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 97.8
3eul_A152 Possible nitrate/nitrite response transcriptional 97.79
1s8n_A205 Putative antiterminator; RV1626, structural genomi 97.79
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 97.79
3eqz_A135 Response regulator; structural genomics, unknown f 97.77
1dz3_A130 Stage 0 sporulation protein A; response regulator, 97.75
3cfy_A137 Putative LUXO repressor protein; structural genomi 97.73
1yio_A208 Response regulatory protein; transcription regulat 97.71
3cz5_A153 Two-component response regulator, LUXR family; str 97.7
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 97.69
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 97.67
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 97.66
2qsj_A154 DNA-binding response regulator, LUXR family; struc 97.66
2qv0_A143 Protein MRKE; structural genomics, transcription, 97.64
3q9s_A249 DNA-binding response regulator; DNA binding protei 97.63
2gwr_A238 DNA-binding response regulator MTRA; two-component 97.62
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 97.6
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 97.56
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 97.56
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.53
2oqr_A230 Sensory transduction protein REGX3; response regul 97.52
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 97.51
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 97.48
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 97.45
2hqr_A223 Putative transcriptional regulator; phosporylation 97.44
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 97.42
3eq2_A 394 Probable two-component response regulator; adaptor 97.4
3zrx_A115 AF1503 protein, osmolarity sensor protein ENVZ; si 97.39
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 97.39
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 97.39
3c3w_A225 Two component transcriptional regulatory protein; 97.09
3bre_A 358 Probable two-component response regulator; protein 97.06
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 97.02
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 97.01
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 96.92
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 96.91
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 96.68
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 95.98
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 95.71
3lib_A290 Hypothetical sensory transduction histidine kinas; 95.47
4dah_A217 Sporulation kinase D; alpha-beta-alpha structure, 95.29
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 95.2
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 95.08
3peh_A281 Endoplasmin homolog; structural genomics, structur 95.07
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 95.03
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 94.99
3lif_A254 Putative diguanylate cyclase (ggdef) with PAS/PAC; 94.85
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 94.72
3li9_A291 Hypothetical sensory transduction histidine kinas; 94.57
3lic_A274 Sensor protein; PDC fold, ATP-binding, kinase, nuc 94.2
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 93.93
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 93.87
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 93.13
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 92.88
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 91.39
4duh_A220 DNA gyrase subunit B; structure-based drug design, 90.37
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 90.25
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 86.67
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 86.04
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 85.73
3lnu_A408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 80.98
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 80.62
>3t4l_A Histidine kinase 4; PAS domain, hormone receptor, endop reticulum; HET: ZEA; 1.53A {Arabidopsis thaliana} PDB: 3t4k_A* 3t4j_A* 3t4o_A* 3t4q_A* 3t4s_A* 3t4t_A* Back     alignment and structure
Probab=100.00  E-value=5.5e-48  Score=419.14  Aligned_cols=268  Identities=65%  Similarity=1.011  Sum_probs=248.3

Q ss_pred             HhHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCCHHHHHHHHhhhhhcCCCcceeeeec
Q 002153          107 MSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAV  186 (959)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~a~~lq~~~~~~~~~~~~l~~l~~~~~~~~~~~~id~~~f~~~~~~~~~~~p~~~~~~~~~  186 (959)
                      |+.+..++|++.|.++||+++.+|+++|+.+++++++|++||+++|++++++.||+++|..|+++++.++|+|+|++|+|
T Consensus         1 ~~~~~~~~~~~~~~~~a~~~a~~L~~~l~~~~~~l~~la~l~~~~~f~~~~~~v~~~~F~~~a~~l~~~~pgi~~l~~ap   80 (270)
T 3t4l_A            1 MDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAE   80 (270)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSSCCCCHHHHHHHHHHTGGGCTTEEEEEEEE
T ss_pred             CChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCHHHHHHHHHHHhhcCCCceEEEEEe
Confidence            46788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCchhHHHHHHHhccceeecccCCCCCCCCCCCCCCCCcccceEEecCCcceeEeeccccCcccHHHHHHHHHcCCcee
Q 002153          187 RVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVL  266 (959)
Q Consensus       187 ~v~~~~r~~fE~~~~~~i~~~~~~~~~~~~~~~~~~~~~~Y~pvi~~~~~~~~~~g~D~~s~~~~r~~i~~Ar~tg~~~~  266 (959)
                      +|+++||++||++++|.|+++..        ..|++.|++|+||+|+++.|+.++||||+|+|.||++|.+||+||++++
T Consensus        81 ~V~~~~r~~fe~~~~~~I~~~~~--------~~p~~~r~~y~pi~y~ep~N~~alG~D~~S~p~rr~al~~Ar~tg~~~l  152 (270)
T 3t4l_A           81 KVVNFEREMFERQHNWVIKTMDR--------GEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVL  152 (270)
T ss_dssp             CEEGGGHHHHHHHHTSCCBCTTT--------CCBCCCCSEECBEEEECGGGGGGBTBBGGGSHHHHHHHHHHHHHSSCEE
T ss_pred             ecCHhHHHHHHhccCceeeccCC--------cccCCCCCccceEEEeCCCCccceeeccCCCHHHHHHHHHHHHhCCcEE
Confidence            99999999999999999988753        4699999999999999999999999999999999999999999999999


Q ss_pred             eeceeecccCCceeEEEEEeeccCCCCCCChhHHHhhhcceeeeeeeHHHHHHHHHHHhhccceEEEeecccCCCCCcee
Q 002153          267 TAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPIS  346 (959)
Q Consensus       267 t~p~~l~~~~~~g~~l~~pvy~~~~~~~~~~~~r~~~~~G~~~~~~~v~~l~~~ll~~~~~~~~i~v~v~d~~~~~~~~~  346 (959)
                      |+|++|+|.++.|+++++|||..+.+++.|+++|+++++||++++|++++|++.++.+....+.+.+.+||.++.+.+..
T Consensus       153 s~pv~Lvq~~~~G~ll~~PVy~~~~~~~~t~~~R~~~~~G~v~~v~~~~~l~~~~l~~~~~~~~l~l~i~D~~~~~~~~~  232 (270)
T 3t4l_A          153 TSPFRLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLV  232 (270)
T ss_dssp             CCCEECTTTCCEEEEEEEEEECTTCCSSCCHHHHHHTEEEEEEEEECHHHHHHHHHHTSTTGGGEEEEEEECSSTTSCEE
T ss_pred             ecCeeeccCCCceEEEEEEeecCCCCCCCCHHHHHHHHhhEEEEEEEHHHHHHHHhhccccCCcEEEEEEECCCCCCCcc
Confidence            99999999889999999999999877778999999999999999999999999998777655789999999998777889


Q ss_pred             ccccccCC--CCceEEEeecCCCcccccceeeeccccC
Q 002153          347 MYGSNVSD--DGLWLVSTLNFGDPFRKHEMRCRFKQKA  382 (959)
Q Consensus       347 ~y~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~~~~  382 (959)
                      +|++....  .++.+.+.++||+|+|+|+|+|+|++++
T Consensus       233 ly~s~~~~~~~~~~~~~~l~~g~~~~~~~~~~~~~~~~  270 (270)
T 3t4l_A          233 MYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKA  270 (270)
T ss_dssp             EECC--CCCCTTCCEEEEECCSCTTCCEEEEEEECC--
T ss_pred             cccCCCCCCCCcceEEEEeecCCchhhhheeeecccCC
Confidence            99997764  3447899999999999999999999874
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3lib_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; 2.99A {Methanosarcina mazei} Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>3lif_A Putative diguanylate cyclase (ggdef) with PAS/PAC; PDC fold, signaling protein; HET: CIT; 2.70A {Rhodopseudomonas palustris} Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3li9_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; HET: BTB; 1.70A {Methanosarcina mazei} PDB: 3li8_A* 3lia_A* Back     alignment and structure
>3lic_A Sensor protein; PDC fold, ATP-binding, kinase, nucleotide-binding, phosphopr transferase, transmembrane; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 959
d2c2aa2161 d.122.1.3 (A:321-481) Sensor histidine kinase TM08 2e-35
d1ysra1148 d.122.1.3 (A:299-446) Sensor-type histidine kinase 6e-29
d1jm6a2190 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin 2e-27
d1id0a_146 d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche 6e-27
d1bxda_161 d.122.1.3 (A:) Histidine kinase domain of the osmo 6e-27
d1gkza2193 d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci 3e-19
d1r62a_156 d.122.1.3 (A:) Nitrogen regulation protein NtrB, C 1e-15
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 2e-11
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 4e-05
d2c2aa189 a.30.2.1 (A:232-320) Sensor histidine kinase TM085 7e-11
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 8e-10
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 2e-09
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 2e-09
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 2e-09
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 3e-09
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 4e-09
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 4e-09
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 1e-08
d1joya_67 a.30.2.1 (A:) EnvZ histidine kinase {Escherichia c 1e-08
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 2e-08
d1s8na_ 190 c.23.1.1 (A:) Probable two-component system transc 6e-08
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 1e-07
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 2e-07
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 5e-07
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 6e-07
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 7e-07
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 9e-07
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-06
d1i58a_189 d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m 1e-06
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 2e-06
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 2e-06
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 3e-06
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 3e-06
d1y8oa2125 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinas 3e-06
d1qo0d_ 189 c.23.1.3 (D:) Positive regulator of the amidase op 4e-06
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 4e-06
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 4e-06
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 1e-05
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 1e-05
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-05
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 5e-05
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 6e-05
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 6e-05
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 9e-05
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 1e-04
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 1e-04
d2gj4a1824 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit 3e-04
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 4e-04
d1ixma_179 d.123.1.1 (A:) Sporulation response regulatory pro 0.003
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]

 Score =  130 bits (327), Expect = 2e-35
 Identities = 43/204 (21%), Positives = 75/204 (36%), Gaps = 49/204 (24%)

Query: 504 ELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGN 563
           ++     +L  +++  ++     +    V +    +   P     DP R RQ++ NL+ N
Sbjct: 1   QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNN 60

Query: 564 SIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGS 623
            +K+++K      V ++ +  D                                      
Sbjct: 61  GVKYSKKDAPDKYVKVILDEKDG------------------------------------- 83

Query: 624 TSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKY 683
                        +++ VED G GIP  A+ RIF  F +V  S++    GTG+GL+I+K 
Sbjct: 84  ------------GVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKE 131

Query: 684 LVGRMKGEIGFVSIPNIGSTFTFT 707
           +V    G I   S    GS F   
Sbjct: 132 IVELHGGRIWVESEVGKGSRFFVW 155
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Length = 67 Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 824 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query959
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 100.0
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 99.96
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 99.96
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 99.96
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 99.94
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 99.94
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 99.94
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 99.71
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.61
d1i58a_189 Histidine kinase CheA {Thermotoga maritima [TaxId: 99.49
d2c2aa189 Sensor histidine kinase TM0853 {Thermotoga maritim 99.44
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.41
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.37
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.35
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.35
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 99.35
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.33
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.32
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.32
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.31
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.29
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.28
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.27
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.27
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.26
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.25
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.25
d1s8na_ 190 Probable two-component system transcriptional regu 99.25
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.25
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.24
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.24
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.24
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.24
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.24
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.24
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 99.23
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.23
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.19
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.18
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.18
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.17
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.16
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.16
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.15
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.04
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.04
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.03
d1joya_67 EnvZ histidine kinase {Escherichia coli [TaxId: 56 98.97
d1mb3a_123 Cell division response regulator DivK {Caulobacter 98.94
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 98.94
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 98.89
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 98.85
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 98.85
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 98.85
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 98.85
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 98.84
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 98.84
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 98.84
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 98.83
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 98.83
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 98.77
d1k68a_140 Response regulator for cyanobacterial phytochrome 98.75
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 98.75
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 98.71
d1qo0d_ 189 Positive regulator of the amidase operon AmiR {Pse 98.71
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 98.71
d1k66a_149 Response regulator for cyanobacterial phytochrome 98.7
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 98.7
d1i3ca_144 Response regulator for cyanobacterial phytochrome 98.69
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 98.69
d1yioa2128 Response regulatory protein StyR, N-terminal domai 98.66
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 98.63
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 98.62
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 98.61
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 98.58
d1qkka_140 Transcriptional regulatory protein DctD, receiver 98.48
d1s8na_190 Probable two-component system transcriptional regu 98.46
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 98.41
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 98.38
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 98.35
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 98.27
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 97.98
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 96.58
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 96.31
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 92.19
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 91.94
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 87.71
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 87.49
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 87.03
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=5.2e-33  Score=277.02  Aligned_cols=158  Identities=28%  Similarity=0.407  Sum_probs=130.6

Q ss_pred             ceeeEeecHHHHHHHHHHHHhhhhhccCcEEEEEecCCCCceEEecHHHHHHHHHHHHHHHHhccCCCcE--EEEEEEee
Q 002153          504 ELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHI--FVTVYLVE  581 (959)
Q Consensus       504 ~l~~~~~dL~~ll~~vl~~~~~~a~~k~I~l~~~i~~~~p~~v~gD~~rL~QIL~NLl~NAiKfT~~G~I--~v~v~~~~  581 (959)
                      +++.+++||.+++++++..+...+..+++++.+..+...|..+.+|+.+|+|||.||++||+|||++|..  .|.+....
T Consensus         1 el~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~   80 (161)
T d2c2aa2           1 QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDE   80 (161)
T ss_dssp             CCCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEE
T ss_pred             CCccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCCEEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEEEEe
Confidence            3566789999999999999999999999999988876666678999999999999999999999987642  33332211


Q ss_pred             cccccchhhhhhccccCcCCCCCccccccccCccccccCCCCCCCCCCCccCceeEEEEEEEcCCCCChhhHhhccCCcc
Q 002153          582 EVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFM  661 (959)
Q Consensus       582 ~~~~~i~i~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFepF~  661 (959)
                                                                         ....+.|+|+|+|+|||++.+++||+|||
T Consensus        81 ---------------------------------------------------~~~~~~i~V~D~G~GI~~~~~~~iF~~F~  109 (161)
T d2c2aa2          81 ---------------------------------------------------KDGGVLIIVEDNGIGIPDHAKDRIFEQFY  109 (161)
T ss_dssp             ---------------------------------------------------ETTEEEEEEEECSSCCCGGGTTGGGSTTC
T ss_pred             ---------------------------------------------------cCCEEEEEEEEcCCCCCHHHHHHhhCCcE
Confidence                                                               11247899999999999999999999999


Q ss_pred             ccCCCCcCcCCCccchHHHHHHHHHHcCCEEEEEEeCCCcEEEEEEEEeCC
Q 002153          662 QVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGN  712 (959)
Q Consensus       662 q~~~s~s~~~~GtGLGLsI~k~LVe~mgG~I~v~S~~g~GttF~~~lp~~~  712 (959)
                      |.+.+.++..+|+||||+|||+||++|||+|+++|.+|+||+|+|++|..+
T Consensus       110 ~~~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~~~Gt~f~i~lP~~~  160 (161)
T d2c2aa2         110 RVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR  160 (161)
T ss_dssp             CCC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEECCC
T ss_pred             EcCCCCCCCCCcccHHHHHHHHHHHHCCCEEEEEecCCCeeEEEEEEEccc
Confidence            999888888889999999999999999999999999999999999999753
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure