Citrus Sinensis ID: 002197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950----
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQGSSSSSESSQCREVSPVEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ
ccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccEEEEccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccEEEEEEcccccHHHHHHcccEEEEEcccccEEEEEccccccccccHHHHHHHHccccccccccccccccEEEcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEccEEEEEccEEEcccEEEEEEHHHHHHHHHHcHHHHHHHHHccEEEEccEEEEEEccccccccEEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEcccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEccccEEEEEEcccccHHHHHcccEEEEEEcccccEEHHHHHcccccccccccccEEEccccccccccccccccEEEEEEcccccccccccccEEEEEEcccccHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEccccccEEEccEEEEEEEEEEEEEEEcccHHHHHHHHHHcccEEccEEEEEEcccccccccEEEEccccHHHHHHHcccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcc
ccHHHHHHHHHHccccHHccccccccccccEEcccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHccEEEEEccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEccccEEEEEEEEEHcHHHHHHccEEEEEEcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccHEEEEEEHEcccccEEEEEccccccccccEEEEEEcccccccccccccEEEEEccccEEEEEEEccEEccccEEEEccEEEEEEHHHHHHHHHHccEEEEEEEEccEEEEccEEEEEEEHHHHccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccEEEEcccccEEcccccccHHHccccccccccccccccEEEEEEEEccccccccccEEccccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHccEEEEEccccccHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEEcEEccccccEEEEccccccEEEEEHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEEEccccccEHHHHHHHHHHHHHcccHHHHHHHHccccccccccccEEEEEcccccccccccccccEEEEEccccEEEEEEEEEcccccEEEEccEEEEEEHHHHHHHHHHHHHHHHEEEcccEEEEcccEEEEEccHHcccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MDDGVVQRVFEeggrdyfqqqpstsssspsilqslpvhasfdhGYYLLVKSIQELRekkggivtvgiggpsgsgkTSLAEKLASVIGCTLismenyrvgvdegndldsiDFDALVQNLQDltegkdtlipmfdyqqknrigskvikgassgvviVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVqydigdscsldsliDSIFPLFrkhiepdlhhAQIRINNRFVSSFREAIYKLKcrseapgacsisafqgneaqtdnfiemylrppsateeARINDWIKMRQSGIRYYLSigdqrivdknfiirpkaefeVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLrgtnrktvGAEALRmgingpwiTKSYLEMVLekkgvprlntpplfpntpttsnqesviaaprpirtnpnlvmkledlsqpwtrsptkskmepvlATWHfissdpshagssvigsssfrdtvklvpmpdsydfdrGLLLSVQAIQALLEnkglpvivgiggpsgsgktsLAHKMANIVGCEVVSLesyfkseqvkdfkyddfssldLSLLSKNisdirngrrtkvpifdletgarsgfkelevsedcgviIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVqrdksrmgcfmsqndimmtVFPMFQQHIEPHLVHAHLKirndfdpvlspesslfvlksnkqVAYQDILKIldpakfcssAQNFIDMYlrlpgiptngqltesdcIRVRICEGRFALLireplregnfiiqpkvdfdisISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVdhlqdapspylqikgvdKEAVAAAGStlkldgsyttKSYLQIILEKlpaversssgihTQQAARLQELVDFIqsqgsssssessqcrevspveGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGivtvgiggpsgsgKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQqknrigskvikgassgvvIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLsigdqrivdKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGtnrktvgaealrmgingpwITKSYLEMVLEKKGVPRLNTPplfpntpttsnqesviaaprpirtnpnLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLsknisdirngrrtkvpifdletgarsgfkelevSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLIsrvqrdksrmGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIptngqltesdcIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGstlkldgsytTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSqgsssssessqcrevspvegiIEDMQSRIKRLERWQMINTVLWTFLMSALVGYslyqrkrq
MDDGVVQRVFEEGGRDYFqqqpstsssspsilqslpVHASFDHGYYLLVKSIQELREKkggivtvgiggpsgsgktSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYdigdscsldslidsiFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRlntpplfpntpttSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPshagssvigsssFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLpvivgiggpsgsgKTSLAHKMANIVGCEVVSLESYFKSEQVkdfkyddfssldlsllskNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIqsqgsssssessqCREVSPVEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ
**********************************LPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGG*******SLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGV********************************************************VLATWHFI****************FRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAV********************************************IIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLY*****
****VVQ*VFE*****************************FDHGYYLLVKSIQE**EKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGS*VIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAP***************DNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLE************************************************************************************************SYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNK*******************AQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAV************************************************MQSRIKRLERWQMINTVLWTFLMSALVGYSLY*****
MDDGVVQRVFEEGGRDY**************LQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPS********EKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAV**********QAARLQELVDFI*****************SPVEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ
**DGVVQRVFEEGGRDY*QQ********PSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAG**VIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSG********LQELVDFIQSQ****************VEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQGSSSSSESSQCREVSPVEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query954 2.2.26 [Sep-21-2011]
Q54R62449 Uridine-cytidine kinase C yes no 0.395 0.839 0.379 6e-70
Q9GNF0492 Uridine-cytidine kinase D no no 0.393 0.762 0.311 1e-44
B5ZBE2207 Uridine kinase OS=Ureapla yes no 0.180 0.830 0.320 7e-14
Q9PQF9207 Uridine kinase OS=Ureapla yes no 0.176 0.811 0.314 3e-13
B1AIX1207 Uridine kinase OS=Ureapla yes no 0.176 0.811 0.314 3e-13
O74427454 Uridine kinase OS=Schizos yes no 0.140 0.295 0.331 1e-10
Q9Z7H0222 Uridine kinase OS=Chlamyd yes no 0.190 0.819 0.269 1e-10
Q38VV6211 Uridine kinase OS=Lactoba yes no 0.175 0.791 0.304 1e-10
P44533213 Uridine kinase OS=Haemoph yes no 0.174 0.779 0.306 2e-10
A5UFT8213 Uridine kinase OS=Haemoph yes no 0.174 0.779 0.306 2e-10
>sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 Back     alignment and function desciption
 Score =  266 bits (680), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 149/393 (37%), Positives = 241/393 (61%), Gaps = 16/393 (4%)

Query: 482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLE-NKGLPVIVGIGGPSGSGKTSLAHKMANI 540
           R T+K  P+ D+  FD+G  L+V+AIQ++ + ++G  ++VGI GPSG+GKTS+A K+ ++
Sbjct: 17  RYTIK--PLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGKTSIAQKIVSV 74

Query: 541 VGCEV-VSLESYF-KSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGAR 598
           +   + +SL++Y   S Q+ +  YDD+  +D  LL KNISD+ + + T +P++D     R
Sbjct: 75  LPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDLPLYDFTKSGR 134

Query: 599 SGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMG--C 656
             +K ++  E   V++ EG+YALH EIR  LDL +++ GGVH  LI R+ RD  R G   
Sbjct: 135 YAYKRVQPPE-SKVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFRDVHRTGQQP 193

Query: 657 FMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILK 716
             S   I  TV+PM++  IEP L  A +++ N F+P     + +++LKS KQ    D++ 
Sbjct: 194 HESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVKQGVTVDMIH 253

Query: 717 -ILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTES---DCIRVRICEGRFALLIREPLREG 772
            +L+ +    +   + D+YL    IP N     S   D IRVR  +G+++++  E ++EG
Sbjct: 254 SVLNKSTIQENTARYYDIYL----IPPNTTFANSSSCDWIRVRNADGQYSIMFSEEIKEG 309

Query: 773 NFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQI 832
            FII P+VDF + ++ + GL++LGYQ VA I   + I++DGKI+I  D L++    ++QI
Sbjct: 310 PFIISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELGQTFVQI 369

Query: 833 KGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEK 865
           KG D  +V  AG  L L+ +Y  KSY+++  +K
Sbjct: 370 KGFDATSVQEAGKKLGLENNYLQKSYIELYQDK 402
Catalyzes the conversion of uridine into uridine monophosphate and cytidine into cytidine monophosphate in the pyrimidine salvage pathway.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9GNF0|UCKD_DICDI Uridine-cytidine kinase D OS=Dictyostelium discoideum GN=udkD PE=2 SV=1 Back     alignment and function description
>sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z7H0|URK_CHLPN Uridine kinase OS=Chlamydia pneumoniae GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q38VV6|URK_LACSS Uridine kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|P44533|URK_HAEIN Uridine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|A5UFT8|URK_HAEIG Uridine kinase OS=Haemophilus influenzae (strain PittGG) GN=udk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query954
356519766945 PREDICTED: uncharacterized protein LOC10 0.987 0.996 0.836 0.0
356577089964 PREDICTED: uncharacterized protein LOC10 0.992 0.982 0.815 0.0
297737698981 unnamed protein product [Vitis vinifera] 0.997 0.970 0.835 0.0
449445419955 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.991 0.990 0.814 0.0
359472620951 PREDICTED: uncharacterized protein LOC10 0.981 0.984 0.832 0.0
334184093955 P-loop containing nucleoside triphosphat 0.984 0.983 0.806 0.0
297814378945 hypothetical protein ARALYDRAFT_322489 [ 0.982 0.991 0.805 0.0
334184095954 P-loop containing nucleoside triphosphat 0.983 0.983 0.794 0.0
255570128975 uridine cytidine kinase I, putative [Ric 0.923 0.903 0.757 0.0
224111502842 predicted protein [Populus trichocarpa] 0.830 0.940 0.769 0.0
>gi|356519766|ref|XP_003528540.1| PREDICTED: uncharacterized protein LOC100778905 [Glycine max] Back     alignment and taxonomy information
 Score = 1588 bits (4111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 801/957 (83%), Positives = 873/957 (91%), Gaps = 15/957 (1%)

Query: 1   MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKG 60
           MDD VVQRVF EGGRDYFQQQPSTSSSS SILQSLP+H SFDHGYYLLVKSIQELREKK 
Sbjct: 1   MDDEVVQRVFHEGGRDYFQQQPSTSSSSSSILQSLPLHVSFDHGYYLLVKSIQELREKKD 60

Query: 61  GIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQD 120
           G+VTVGIGGPSGSGKTSL EK+ASVIGCT+ISMENYR GVDEGND+DSIDFD L++NL+D
Sbjct: 61  GLVTVGIGGPSGSGKTSLTEKVASVIGCTVISMENYRDGVDEGNDVDSIDFDTLIKNLED 120

Query: 121 LTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVH 180
           LT+G DT IP FDYQQK R+G K IK  SS VVIVDGTYAL A+LRSLLDIRVAVVGGVH
Sbjct: 121 LTKGNDTSIPEFDYQQKRRVGYKAIKSPSS-VVIVDGTYALHAKLRSLLDIRVAVVGGVH 179

Query: 181 FSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKC 240
           FSL+SKV+YDIGDSCSLD LIDSIFPLFRKHIEPDLHHAQIRINN FVSSFREA+YK+KC
Sbjct: 180 FSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHAQIRINNSFVSSFREAVYKVKC 239

Query: 241 RSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQR 300
           RS+    CS  AFQGNEAQTDNFIEMYLRPPSA+EEARINDWIK+RQSGIRYYLS+GDQR
Sbjct: 240 RSKV---CS--AFQGNEAQTDNFIEMYLRPPSASEEARINDWIKVRQSGIRYYLSLGDQR 294

Query: 301 IVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDET 360
           IVDKNFIIRPKAEFEVGRMTLGGLL LGY VV SYKRAST V  G +S+SFETID L ET
Sbjct: 295 IVDKNFIIRPKAEFEVGRMTLGGLLALGYIVVVSYKRASTTVNNGKVSMSFETIDVLGET 354

Query: 361 FMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQES 420
           FMV+RGTNRKTVG EALRMGINGPWITKSYLEM+LE+KGVPRL+TPPL  NT    +QE+
Sbjct: 355 FMVMRGTNRKTVGTEALRMGINGPWITKSYLEMILERKGVPRLSTPPLVSNTTVPGSQET 414

Query: 421 VIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGS-- 478
           VIAAP+PIR  PNLV  L+DL QPWTRSPTKSKMEPV+A WHFISSD S   +SV+ +  
Sbjct: 415 VIAAPKPIRVTPNLVTGLDDLPQPWTRSPTKSKMEPVVAEWHFISSDSSLPDNSVLATTD 474

Query: 479 -SSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKM 537
            SSFRD+V+L PMPDS+D DRGLLL+VQAIQALLENKG+PVIVGIGGPSGSGKTSLAHKM
Sbjct: 475 PSSFRDSVRLAPMPDSFDLDRGLLLAVQAIQALLENKGVPVIVGIGGPSGSGKTSLAHKM 534

Query: 538 ANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGA 597
           ANI+GCEVVSLESY+K  QVKDFKYDDFS+LDLSLLSKNI DIRNG+RTKVPIFDLE+GA
Sbjct: 535 ANIIGCEVVSLESYYK--QVKDFKYDDFSALDLSLLSKNIDDIRNGQRTKVPIFDLESGA 592

Query: 598 RSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCF 657
           RSGFKELEVSEDCGVIIFEG+YALHP+IR SLDLWIAVVGGVHSHLISRVQRDKSR+GCF
Sbjct: 593 RSGFKELEVSEDCGVIIFEGIYALHPDIRISLDLWIAVVGGVHSHLISRVQRDKSRVGCF 652

Query: 658 MSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKI 717
           +SQN+IMMTVFPMFQQ IEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNK+VAYQDI+ I
Sbjct: 653 ISQNEIMMTVFPMFQQLIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKKVAYQDIVAI 712

Query: 718 LDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQ 777
           LD AKFCSS Q FID+Y+RLPGIP+NGQL +SDCIRVRICEGRFALLIREP++EGNFIIQ
Sbjct: 713 LDSAKFCSSVQKFIDIYIRLPGIPSNGQLRDSDCIRVRICEGRFALLIREPIKEGNFIIQ 772

Query: 778 PKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDK 837
           PKVDFDI ISTVAGLLNLGYQAVAYIEASAFIYQDGK    VDHLQD P PY+QIKGV+K
Sbjct: 773 PKVDFDIGISTVAGLLNLGYQAVAYIEASAFIYQDGK----VDHLQDVPGPYIQIKGVNK 828

Query: 838 EAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQGSS 897
           +AVAAAGS LKLDGSYTTKSYL+IILE+LPA+ER+S GIH+QQ+ARL E+V+FIQSQG S
Sbjct: 829 DAVAAAGSMLKLDGSYTTKSYLEIILERLPAIERTSGGIHSQQSARLLEIVEFIQSQGCS 888

Query: 898 SSSESSQCREVSPVEGIIEDMQSRIKRLERWQMINTVLWTFLMSALVGYSLYQRKRQ 954
           S+SESS  R VSP+EG+IE+MQSRI+RLERW  INTVLWTFLMSALVGYSLYQRKRQ
Sbjct: 889 SASESSSSRVVSPIEGVIEEMQSRIRRLERWLAINTVLWTFLMSALVGYSLYQRKRQ 945

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356577089|ref|XP_003556660.1| PREDICTED: uncharacterized protein LOC100787760 [Glycine max] Back     alignment and taxonomy information
>gi|297737698|emb|CBI26899.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445419|ref|XP_004140470.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101220584 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359472620|ref|XP_002280757.2| PREDICTED: uncharacterized protein LOC100261233 [Vitis vinifera] Back     alignment and taxonomy information
>gi|334184093|ref|NP_178255.5| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|330250362|gb|AEC05456.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297814378|ref|XP_002875072.1| hypothetical protein ARALYDRAFT_322489 [Arabidopsis lyrata subsp. lyrata] gi|297320910|gb|EFH51331.1| hypothetical protein ARALYDRAFT_322489 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334184095|ref|NP_001189495.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|330250363|gb|AEC05457.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255570128|ref|XP_002526026.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223534673|gb|EEF36366.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111502|ref|XP_002315881.1| predicted protein [Populus trichocarpa] gi|222864921|gb|EEF02052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query954
DICTYBASE|DDB_G0283371449 udkC "adenylate cyclase domain 0.398 0.846 0.338 1.2e-56
TAIR|locus:2028809 674 AT1G26190 [Arabidopsis thalian 0.397 0.562 0.293 2.8e-48
TAIR|locus:2031541 643 AT1G73980 [Arabidopsis thalian 0.393 0.583 0.303 2.1e-46
DICTYBASE|DDB_G0271146492 udkD "adenylate cyclase domain 0.389 0.756 0.277 6.7e-35
CGD|CAL0002407545 URK1 [Candida albicans (taxid: 0.070 0.122 0.394 0.00024
SGD|S000005295501 URK1 "Uridine/cytidine kinase" 0.101 0.193 0.350 0.00058
DICTYBASE|DDB_G0283371 udkC "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 584 (210.6 bits), Expect = 1.2e-56, P = 1.2e-56
 Identities = 132/390 (33%), Positives = 220/390 (56%)

Query:   482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLE-NKGLXXXXXXXXXXXXXKTSLAHKMANI 540
             R T+K  P+ D+  FD+G  L+V+AIQ++ + ++G              KTS+A K+ ++
Sbjct:    17 RYTIK--PLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGKTSIAQKIVSV 74

Query:   541 VGCEV-VSLESYF-KSEQVXXXXXXXXXXXXXXXXXXNISDIRNGRRTKVPIFDLETGAR 598
             +   + +SL++Y   S Q+                  NISD+ + + T +P++D     R
Sbjct:    75 LPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDLPLYDFTKSGR 134

Query:   599 SGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGC-- 656
               +K ++  E   V++ EG+YALH EIR  LDL +++ GGVH  LI R+ RD  R G   
Sbjct:   135 YAYKRVQPPES-KVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFRDVHRTGQQP 193

Query:   657 FMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDIL- 715
               S   I  TV+PM++  IEP L  A +++ N F+P     + +++LKS KQ    D++ 
Sbjct:   194 HESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVKQGVTVDMIH 253

Query:   716 KILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFI 775
              +L+ +    +   + D+YL +P   T    +  D IRVR  +G+++++  E ++EG FI
Sbjct:   254 SVLNKSTIQENTARYYDIYL-IPPNTTFANSSSCDWIRVRNADGQYSIMFSEEIKEGPFI 312

Query:   776 IQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGV 835
             I P+VDF + ++ + GL++LGYQ VA I   + I++DGKI+I  D L++    ++QIKG 
Sbjct:   313 ISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELGQTFVQIKGF 372

Query:   836 DKEAVAAAGSTLKLDGSYTTKSYLQIILEK 865
             D  +V  AG  L L+ +Y  KSY+++  +K
Sbjct:   373 DATSVQEAGKKLGLENNYLQKSYIELYQDK 402
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004849 "uridine kinase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0016740 "transferase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0044211 "CTP salvage" evidence=IEA
GO:0044206 "UMP salvage" evidence=IEA
TAIR|locus:2028809 AT1G26190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031541 AT1G73980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271146 udkD "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0002407 URK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000005295 URK1 "Uridine/cytidine kinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030501001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (952 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00020734001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (423 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query954
PLN02318 656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 3e-72
PLN02318656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 2e-65
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 4e-54
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 1e-53
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 6e-26
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 2e-23
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 3e-22
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 4e-22
TIGR00235207 TIGR00235, udk, uridine kinase 2e-20
TIGR00235207 TIGR00235, udk, uridine kinase 3e-19
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 2e-17
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 2e-17
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 6e-17
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 7e-13
PRK06696223 PRK06696, PRK06696, uridine kinase; Validated 9e-09
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 7e-08
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 2e-06
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 3e-06
pfam13207114 pfam13207, AAA_17, AAA domain 4e-06
PRK06547172 PRK06547, PRK06547, hypothetical protein; Provisio 7e-06
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 2e-05
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 2e-05
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 4e-05
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 5e-05
pfam13207114 pfam13207, AAA_17, AAA domain 1e-04
PRK06696223 PRK06696, PRK06696, uridine kinase; Validated 2e-04
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 2e-04
COG1437178 COG1437, CyaB, Adenylate cyclase, class 2 (thermop 2e-04
COG1763161 COG1763, MobB, Molybdopterin-guanine dinucleotide 3e-04
PRK06547172 PRK06547, PRK06547, hypothetical protein; Provisio 4e-04
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 6e-04
COG0378202 COG0378, HypB, Ni2+-binding GTPase involved in reg 7e-04
PRK00091307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp 8e-04
PRK04182180 PRK04182, PRK04182, cytidylate kinase; Provisional 8e-04
pfam13238128 pfam13238, AAA_18, AAA domain 0.001
cd03116159 cd03116, MobB, Molybdenum is an essential trace el 0.001
COG0324308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph 0.003
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information 
 Score =  251 bits (642), Expect = 3e-72
 Identities = 133/392 (33%), Positives = 223/392 (56%), Gaps = 15/392 (3%)

Query: 482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIV 541
            D  ++VP+ D   F++G  + ++A Q L +     ++VG+ GPSG+GKT    K+ N +
Sbjct: 30  SDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKTVFTEKVLNFM 89

Query: 542 -GCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSG 600
               V+S+++Y  S ++ D  +DD    D   L  NI D++ G+  +VPI+D ++ +R G
Sbjct: 90  PSIAVISMDNYNDSSRIIDGNFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVG 149

Query: 601 FKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQ 660
           ++ LEV     VII EG+YAL  ++R  LDL ++V GGVH  L+ RV RD  R G     
Sbjct: 150 YRTLEVPSSRIVII-EGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAG--QEP 206

Query: 661 NDIMM----TVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILK 716
            +I+     TV+PM++  IEP L  AH+KI N F+P    ++  ++LKS++ V  + I  
Sbjct: 207 EEIIHQISETVYPMYKAFIEPDLQTAHIKIVNKFNPFSGFQNPTYILKSSRSVTVEQIKA 266

Query: 717 ILDPAKFCSSAQNFIDMYLRLPG-IPTNGQLTESDCIRVRICEGRFALLIREPLREGNFI 775
           +L       + +   D+YL  PG  P   Q      +R+R  +G+++L+  E + +  FI
Sbjct: 267 VLS-EDHTETTEETYDIYLLPPGEDPETCQ----SYLRMRNRDGKYSLMFEEWVTDEPFI 321

Query: 776 IQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGV 835
           I P++ F++S+  + GL+ LGY     ++ S+ ++ D K+ +++D L+     Y+Q++G 
Sbjct: 322 ISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGK 381

Query: 836 DKEAVAAAGSTLKLDGSYTTKSYL-QIILEKL 866
           D+  V      L L+GSY  ++Y+ QI LEKL
Sbjct: 382 DRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKL 413

Length = 656
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|180660 PRK06696, PRK06696, uridine kinase; Validated Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235825 PRK06547, PRK06547, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|180660 PRK06696, PRK06696, uridine kinase; Validated Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|224354 COG1437, CyaB, Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|224677 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235825 PRK06547, PRK06547, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|223455 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>gnl|CDD|235244 PRK04182, PRK04182, cytidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|222000 pfam13238, AAA_18, AAA domain Back     alignment and domain information
>gnl|CDD|239390 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 954
PLN02318 656 phosphoribulokinase/uridine kinase 100.0
PLN02318656 phosphoribulokinase/uridine kinase 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 100.0
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.97
PTZ00301210 uridine kinase; Provisional 99.96
KOG2878282 consensus Predicted kinase [General function predi 99.96
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.95
PLN02348395 phosphoribulokinase 99.94
PRK05439311 pantothenate kinase; Provisional 99.94
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.94
PLN02796347 D-glycerate 3-kinase 99.94
PLN03046460 D-glycerate 3-kinase; Provisional 99.94
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.93
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.93
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.93
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.92
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.92
COG4240300 Predicted kinase [General function prediction only 99.92
PRK05439311 pantothenate kinase; Provisional 99.91
PTZ00301210 uridine kinase; Provisional 99.91
PRK15453290 phosphoribulokinase; Provisional 99.91
PRK05480209 uridine/cytidine kinase; Provisional 99.91
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.9
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.9
PLN02348395 phosphoribulokinase 99.88
PRK07429327 phosphoribulokinase; Provisional 99.88
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.88
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.87
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.87
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.87
PRK06696223 uridine kinase; Validated 99.86
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.85
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.85
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.85
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.84
PRK05480209 uridine/cytidine kinase; Provisional 99.84
PRK06696223 uridine kinase; Validated 99.83
PRK07667193 uridine kinase; Provisional 99.82
PRK15453290 phosphoribulokinase; Provisional 99.82
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.82
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.82
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.81
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.8
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.8
PRK07667193 uridine kinase; Provisional 99.8
PRK07429327 phosphoribulokinase; Provisional 99.79
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.79
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.78
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.77
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.76
PRK06547172 hypothetical protein; Provisional 99.75
PRK06547172 hypothetical protein; Provisional 99.74
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.73
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 99.7
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.69
PTZ00451244 dephospho-CoA kinase; Provisional 99.68
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.68
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.67
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.66
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.65
PLN02422232 dephospho-CoA kinase 99.62
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.61
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.59
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.59
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.58
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.58
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.57
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.54
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 99.53
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 99.53
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.52
PRK08233182 hypothetical protein; Provisional 99.5
PRK08233182 hypothetical protein; Provisional 99.49
KOG3308225 consensus Uncharacterized protein of the uridine k 99.48
PLN03046460 D-glycerate 3-kinase; Provisional 99.47
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.47
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.42
KOG3308225 consensus Uncharacterized protein of the uridine k 99.42
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.41
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.38
PLN02796347 D-glycerate 3-kinase 99.38
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.36
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.34
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.32
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.3
PLN02422232 dephospho-CoA kinase 99.28
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 99.28
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.28
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.25
PTZ00451244 dephospho-CoA kinase; Provisional 99.25
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.16
PRK01184184 hypothetical protein; Provisional 99.16
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.16
COG4240300 Predicted kinase [General function prediction only 99.16
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.14
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.11
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.1
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.1
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.09
PRK06217183 hypothetical protein; Validated 99.07
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.04
PRK04182180 cytidylate kinase; Provisional 99.02
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.02
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.02
PRK06217183 hypothetical protein; Validated 99.01
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.99
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.98
PRK08118167 topology modulation protein; Reviewed 98.96
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.92
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.92
PRK06762166 hypothetical protein; Provisional 98.9
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.9
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 98.88
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.87
PRK07261171 topology modulation protein; Provisional 98.87
KOG2878282 consensus Predicted kinase [General function predi 98.86
PRK08118167 topology modulation protein; Reviewed 98.85
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 98.85
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 98.85
PRK07261171 topology modulation protein; Provisional 98.84
PRK00023225 cmk cytidylate kinase; Provisional 98.84
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 98.82
PRK08356195 hypothetical protein; Provisional 98.8
PRK01184184 hypothetical protein; Provisional 98.79
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.77
PRK04182180 cytidylate kinase; Provisional 98.76
PRK00023225 cmk cytidylate kinase; Provisional 98.73
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 98.72
PRK00131175 aroK shikimate kinase; Reviewed 98.72
PRK13949169 shikimate kinase; Provisional 98.71
PLN02200234 adenylate kinase family protein 98.7
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 98.64
PRK04040188 adenylate kinase; Provisional 98.64
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.63
PRK05541176 adenylylsulfate kinase; Provisional 98.62
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 98.61
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.61
PRK03839180 putative kinase; Provisional 98.58
PRK06762166 hypothetical protein; Provisional 98.58
PRK00625173 shikimate kinase; Provisional 98.56
PRK00131175 aroK shikimate kinase; Reviewed 98.55
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.55
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 98.54
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.53
PRK08356195 hypothetical protein; Provisional 98.52
PRK14737186 gmk guanylate kinase; Provisional 98.51
PRK04040188 adenylate kinase; Provisional 98.48
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.48
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.47
PRK03839180 putative kinase; Provisional 98.47
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.46
PLN02200234 adenylate kinase family protein 98.46
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.45
PRK14528186 adenylate kinase; Provisional 98.44
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.44
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.44
PRK05057172 aroK shikimate kinase I; Reviewed 98.43
PRK14527191 adenylate kinase; Provisional 98.43
PRK05541176 adenylylsulfate kinase; Provisional 98.39
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.38
PRK13946184 shikimate kinase; Provisional 98.36
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.36
PRK00625173 shikimate kinase; Provisional 98.36
PRK03731171 aroL shikimate kinase II; Reviewed 98.36
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.36
PRK13947171 shikimate kinase; Provisional 98.34
PRK02496184 adk adenylate kinase; Provisional 98.34
PRK14531183 adenylate kinase; Provisional 98.34
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.34
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.32
PRK14532188 adenylate kinase; Provisional 98.31
PRK14530215 adenylate kinase; Provisional 98.3
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.29
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.28
PRK00279215 adk adenylate kinase; Reviewed 98.27
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.26
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.25
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.24
PRK14527191 adenylate kinase; Provisional 98.23
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.23
PRK13949169 shikimate kinase; Provisional 98.23
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.22
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.21
PRK13948182 shikimate kinase; Provisional 98.21
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.2
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 98.19
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.19
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.18
PRK03846198 adenylylsulfate kinase; Provisional 98.17
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.17
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.16
PTZ00088229 adenylate kinase 1; Provisional 98.16
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.15
PRK13946184 shikimate kinase; Provisional 98.15
PHA02530300 pseT polynucleotide kinase; Provisional 98.15
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.14
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.14
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.13
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.13
PRK14528186 adenylate kinase; Provisional 98.12
PRK05057172 aroK shikimate kinase I; Reviewed 98.11
PRK12269863 bifunctional cytidylate kinase/ribosomal protein S 98.1
PRK13808333 adenylate kinase; Provisional 98.1
PLN02165334 adenylate isopentenyltransferase 98.09
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.09
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 98.09
PRK14530215 adenylate kinase; Provisional 98.09
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.09
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 98.08
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 98.08
PRK14531183 adenylate kinase; Provisional 98.07
PRK03731171 aroL shikimate kinase II; Reviewed 98.07
PLN02199303 shikimate kinase 98.06
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 98.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.05
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.05
PRK14737186 gmk guanylate kinase; Provisional 98.04
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.04
PRK12338319 hypothetical protein; Provisional 98.03
PRK12338319 hypothetical protein; Provisional 98.02
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.0
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.0
PRK14532188 adenylate kinase; Provisional 98.0
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.99
PLN02674244 adenylate kinase 97.99
PRK02496184 adk adenylate kinase; Provisional 97.98
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 97.97
PLN02840421 tRNA dimethylallyltransferase 97.96
PRK00279215 adk adenylate kinase; Reviewed 97.96
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.95
PTZ00088229 adenylate kinase 1; Provisional 97.95
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.93
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.92
PLN02748468 tRNA dimethylallyltransferase 97.92
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.91
PRK00300205 gmk guanylate kinase; Provisional 97.9
PRK00889175 adenylylsulfate kinase; Provisional 97.9
PRK12339197 2-phosphoglycerate kinase; Provisional 97.88
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.87
PRK13947171 shikimate kinase; Provisional 97.86
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 97.83
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.81
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.8
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.79
PRK04220301 2-phosphoglycerate kinase; Provisional 97.79
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.79
PRK13975196 thymidylate kinase; Provisional 97.78
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.77
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 97.77
PRK13948182 shikimate kinase; Provisional 97.76
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.76
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.76
PRK12339197 2-phosphoglycerate kinase; Provisional 97.74
PRK13808333 adenylate kinase; Provisional 97.7
PRK14529223 adenylate kinase; Provisional 97.69
PLN02459261 probable adenylate kinase 97.69
PLN02674244 adenylate kinase 97.68
PRK14526211 adenylate kinase; Provisional 97.67
PRK03846198 adenylylsulfate kinase; Provisional 97.66
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.65
PRK00698205 tmk thymidylate kinase; Validated 97.64
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.63
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.62
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.62
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.61
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.61
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 97.6
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.59
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.59
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.59
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.58
PHA02530300 pseT polynucleotide kinase; Provisional 97.57
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.56
PRK09825176 idnK D-gluconate kinase; Provisional 97.55
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.55
PHA00729226 NTP-binding motif containing protein 97.55
PRK00300205 gmk guanylate kinase; Provisional 97.53
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.53
PLN02842505 nucleotide kinase 97.52
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.52
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.52
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.5
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 97.5
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.47
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.47
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.46
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.46
PRK00889175 adenylylsulfate kinase; Provisional 97.45
PLN02199303 shikimate kinase 97.44
PLN02459261 probable adenylate kinase 97.43
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.43
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.42
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.42
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.41
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 97.41
PRK09825176 idnK D-gluconate kinase; Provisional 97.39
PRK11545163 gntK gluconate kinase 1; Provisional 97.38
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.38
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.37
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.35
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.35
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.35
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 97.34
PHA00729226 NTP-binding motif containing protein 97.34
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.33
PRK14526211 adenylate kinase; Provisional 97.31
PRK14738206 gmk guanylate kinase; Provisional 97.3
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.29
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.29
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.28
PRK04220301 2-phosphoglycerate kinase; Provisional 97.27
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.27
PRK14529223 adenylate kinase; Provisional 97.27
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.26
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.25
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.24
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 97.24
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.24
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.19
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.19
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.19
COG0645170 Predicted kinase [General function prediction only 97.18
PRK12337475 2-phosphoglycerate kinase; Provisional 97.16
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.15
PRK13975196 thymidylate kinase; Provisional 97.13
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.12
PLN02842505 nucleotide kinase 97.12
COG4639168 Predicted kinase [General function prediction only 97.07
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.06
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.05
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.02
PRK13973213 thymidylate kinase; Provisional 97.0
PLN02840421 tRNA dimethylallyltransferase 97.0
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 96.96
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 96.94
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.93
PLN02165334 adenylate isopentenyltransferase 96.92
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.92
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 96.91
PRK11545163 gntK gluconate kinase 1; Provisional 96.89
PRK09435332 membrane ATPase/protein kinase; Provisional 96.89
PRK07933213 thymidylate kinase; Validated 96.81
PRK14738206 gmk guanylate kinase; Provisional 96.8
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.77
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 96.77
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.73
PLN02748468 tRNA dimethylallyltransferase 96.71
PF00004132 AAA: ATPase family associated with various cellula 96.71
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 96.69
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.67
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 96.66
PLN02924220 thymidylate kinase 96.65
PF00004132 AAA: ATPase family associated with various cellula 96.65
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 96.64
COG4639168 Predicted kinase [General function prediction only 96.64
PRK09435332 membrane ATPase/protein kinase; Provisional 96.63
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.63
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.58
PRK13973213 thymidylate kinase; Provisional 96.54
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.51
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.5
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.37
PLN02772398 guanylate kinase 96.32
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.26
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.18
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 96.18
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.16
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.14
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 96.06
COG1660286 Predicted P-loop-containing kinase [General functi 96.05
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.04
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.04
PRK12337475 2-phosphoglycerate kinase; Provisional 96.01
COG3025432 Uncharacterized conserved protein [Function unknow 95.98
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.97
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.95
KOG3062281 consensus RNA polymerase II elongator associated p 95.94
PHA03132580 thymidine kinase; Provisional 95.93
PRK13974212 thymidylate kinase; Provisional 95.92
COG4619223 ABC-type uncharacterized transport system, ATPase 95.89
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 95.89
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.85
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.85
smart00382148 AAA ATPases associated with a variety of cellular 95.84
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.82
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.82
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.82
COG4619223 ABC-type uncharacterized transport system, ATPase 95.82
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.81
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 95.79
PRK06761282 hypothetical protein; Provisional 95.79
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 95.78
smart00382148 AAA ATPases associated with a variety of cellular 95.77
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 95.77
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.74
PRK13976209 thymidylate kinase; Provisional 95.74
TIGR00064272 ftsY signal recognition particle-docking protein F 95.73
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.73
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.72
TIGR00101199 ureG urease accessory protein UreG. This model rep 95.72
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.71
COG1855604 ATPase (PilT family) [General function prediction 95.68
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 95.67
PRK06761282 hypothetical protein; Provisional 95.64
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 95.62
PRK10416318 signal recognition particle-docking protein FtsY; 95.58
PRK10646153 ADP-binding protein; Provisional 95.57
PRK00698205 tmk thymidylate kinase; Validated 95.56
TIGR00064272 ftsY signal recognition particle-docking protein F 95.56
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 95.55
COG2954156 Uncharacterized protein conserved in bacteria [Fun 95.53
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.49
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.47
PRK10416318 signal recognition particle-docking protein FtsY; 95.46
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.46
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.4
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.39
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.39
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 95.39
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.34
PRK14974336 cell division protein FtsY; Provisional 95.33
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.33
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.31
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.29
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.29
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.28
cd03115173 SRP The signal recognition particle (SRP) mediates 95.27
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.19
PRK10867433 signal recognition particle protein; Provisional 95.18
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.18
cd03115173 SRP The signal recognition particle (SRP) mediates 95.17
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.15
COG3709192 Uncharacterized component of phosphonate metabolis 95.14
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.13
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.11
PRK14974336 cell division protein FtsY; Provisional 95.1
TIGR00959428 ffh signal recognition particle protein. This mode 95.1
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 95.09
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.09
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.06
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.06
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.05
TIGR00101199 ureG urease accessory protein UreG. This model rep 95.02
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.02
COG0802149 Predicted ATPase or kinase [General function predi 95.02
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.01
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 94.98
COG0645170 Predicted kinase [General function prediction only 94.97
PF13173128 AAA_14: AAA domain 94.95
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 94.95
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 94.94
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.94
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.94
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.88
PF1355562 AAA_29: P-loop containing region of AAA domain 94.88
PRK10646153 ADP-binding protein; Provisional 94.87
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.87
PRK00771437 signal recognition particle protein Srp54; Provisi 94.87
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.86
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.86
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.85
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.84
COG0802149 Predicted ATPase or kinase [General function predi 94.83
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.81
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.8
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.79
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.76
CHL00195489 ycf46 Ycf46; Provisional 94.72
cd03116159 MobB Molybdenum is an essential trace element in t 94.72
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.66
PRK09087226 hypothetical protein; Validated 94.64
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 94.64
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.64
PF1355562 AAA_29: P-loop containing region of AAA domain 94.63
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.63
cd03116159 MobB Molybdenum is an essential trace element in t 94.63
PRK10867433 signal recognition particle protein; Provisional 94.62
PRK13768253 GTPase; Provisional 94.59
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.55
COG1855604 ATPase (PilT family) [General function prediction 94.54
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.53
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 94.53
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 94.52
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.51
PHA02544316 44 clamp loader, small subunit; Provisional 94.5
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.5
PRK00771437 signal recognition particle protein Srp54; Provisi 94.49
PF13173128 AAA_14: AAA domain 94.48
PRK13768253 GTPase; Provisional 94.45
PHA02624647 large T antigen; Provisional 94.43
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.43
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.42
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 94.42
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.41
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.38
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.34
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.32
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information 
Probab=100.00  E-value=6.9e-76  Score=675.77  Aligned_cols=383  Identities=33%  Similarity=0.624  Sum_probs=357.0

Q ss_pred             ccceecccCCCCccchhhhHHHHHHHHHHHHcCCCCEEEeeeCCCCccHHHHHHHHHHHh-CCceeccccccchhhhccc
Q 002197          482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIV-GCEVVSLESYFKSEQVKDF  560 (954)
Q Consensus       482 ~~~~~~~~~~~~l~~~e~~~~~i~~i~~l~~~~~~p~iIGIsGpsGSGKTTlA~~La~~L-g~~vIs~Ddfy~~~~~~~~  560 (954)
                      .++++++|+|++++|++||++++++++.+..+.+++++|||+||+||||||||+.|+..+ ++.+|++|+|+.......+
T Consensus        30 ~~~~~i~~~~~~~sfd~g~~~~ira~qlL~~~~~~riIIGIaGpSGSGKTTLAk~LaglLp~vgvIsmDdy~~~~~~i~~  109 (656)
T PLN02318         30 SDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVISMDNYNDSSRIIDG  109 (656)
T ss_pred             CCceEEEeCCCccccccchhhhhHHHHHHHhcCCCeEEEEEECCCCCcHHHHHHHHHhhCCCcEEEEEcceecchhhhCc
Confidence            478999999999999999999999999999888889999999999999999999999988 4679999999876544567


Q ss_pred             cCCCCCcccHHHHHHHHHHHHcCCceecccccccccccCCccceeeccCccEEEEEeecccchhhhhcCCeEEEEEcChh
Q 002197          561 KYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVH  640 (954)
Q Consensus       561 n~d~p~t~D~~lL~~~L~~L~~g~~v~~P~yD~~~~dr~~~~~~~~~~~~dVVIvEG~~~~~~~l~~~~D~~I~v~~~~d  640 (954)
                      +|++|.++|.+.+.++|..|++|+.+.+|.||+.++++.+... ....+.+|||+||+|++++.+++++|++|||++|.+
T Consensus       110 nfD~P~a~D~d~L~enL~~Lr~GksV~iPiYDf~t~~r~~~~~-i~v~p~~VVIVEGIyaL~~~Lr~LlDlkIFVDtdvD  188 (656)
T PLN02318        110 NFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRT-LEVPSSRIVIIEGIYALSEKLRPLLDLRVSVTGGVH  188 (656)
T ss_pred             cCCChhhcchhHHHHHHHHHhCCCceecCccccccCcccCCce-eecCCCcEEEEechhhccHhHHhhCCEEEEEcCCcc
Confidence            8999999999999999999999999999999999998874322 334678999999999999999999999999999999


Q ss_pred             HHHHHHHhcCccccccccch--hhHHhhhcchhhhhcccccCcccEEEcCCCCCCCCccchhhhhccccchhhHHHhhcC
Q 002197          641 SHLISRVQRDKSRMGCFMSQ--NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKIL  718 (954)
Q Consensus       641 ~rl~Rri~RD~~~rg~~~~~--~q~~~~v~p~~~~~Iep~~~~ADivI~n~~~~rl~qe~~~~~~k~~~~~~~~~~~~~m  718 (954)
                      .++.||+.||..++|++.+.  .+|...++|+|..||+|++++||++|.|.|+|+-..+++.+++++.+++.+|+|+..|
T Consensus       189 irL~RRI~RD~~eRGrs~EsVi~q~~~~VkP~y~~FIeP~kk~ADIII~n~f~P~~g~~np~~Ilk~~~~~~~~~i~~~L  268 (656)
T PLN02318        189 FDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNKFNPFSGFQNPTYILKSSRSVTVEQIKAVL  268 (656)
T ss_pred             HHHHHHHHHHHHHhCCCHHHHHHHHHHhhcchHHHHhCcchhcceEEEecCCCCCCCCCCCeEEecCCccccHHHHHHHh
Confidence            99999999999999998875  6888899999999999999999999999999999999999999999999999999999


Q ss_pred             ChhhhhhhhhhcccccccCCCCCCCCCcCCcceEEEEeeCCEEEEEeeccccccCcccccceeEEehhhHHHHHHHhCce
Q 002197          719 DPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQ  798 (954)
Q Consensus       719 ~~e~v~~fv~~y~~~Y~~~~~l~~~~~~~~~~~irir~~~~~~~l~~~~~~~d~~~~~~~~~~~~v~~~~~~~l~~lg~~  798 (954)
                      +.+ .++.+++|+||||++|+.+.   .++++|||||+|+|+|+|||++||+||+|||+|+++|||++++++|||+|||+
T Consensus       269 ~~~-~~~~~~~~~DiYl~~P~~d~---~~~~e~LRvR~~~Gk~~Ltyke~i~dgp~ii~pk~~fEv~v~~~~gL~aLGy~  344 (656)
T PLN02318        269 SED-HTETTEETYDIYLLPPGEDP---ETCQSYLRMRNRDGKYSLMFEEWVTDEPFIISPRITFEVSVRLLGGLMALGYT  344 (656)
T ss_pred             hhc-cccccceeeEEEecCCCCCc---hhccceEEEEecCCEEEEEEecccccCCeecCcceeEEEeeehHhHHHHcCCc
Confidence            864 77888999999999997653   35678999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeeeeeEEeecCcEEEEEecccCCCCceEEEecccHHHHHHHHhhcCCCCCccchhHHHH-HHhhcccc
Q 002197          799 AVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQI-ILEKLPAV  869 (954)
Q Consensus       799 ~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~v~~~~~~l~~~~~~~~~syle~-~~~~~~~~  869 (954)
                      +++++||.|++|++|+++|++||||+||++|+||+|.+|+.|.++|++|||+|+|+|+||||| ++|||++.
T Consensus       345 ~~a~vkk~r~iy~~g~v~i~lD~ve~Lg~~FvqIeg~~r~~V~~~a~kLGl~g~~i~~SYlE~i~~~~~~~~  416 (656)
T PLN02318        345 IATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKLVNE  416 (656)
T ss_pred             eEEEEEEEEEEEecCCEEEEeehhhccCCeeEEEehhHHHHHHHHHHHcCCCCCcccccHHHHHHHHHhHHH
Confidence            999999999999999999999999999999999999999999999999999999999999995 68888764

>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG3025 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>COG2954 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query954
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 6e-39
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 8e-26
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 4e-33
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 1e-27
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 4e-29
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 5e-25
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 4e-26
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 7e-24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 6e-24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 6e-18
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-19
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-14
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 2e-17
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 6e-13
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 4e-10
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 4e-11
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-10
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 7e-10
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 3e-09
1yem_A179 Hypothetical protein; structural genomics, southea 4e-08
1yem_A179 Hypothetical protein; structural genomics, southea 9e-06
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 1e-05
2hf9_A226 Probable hydrogenase nickel incorporation protein 1e-05
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 2e-04
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 3e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 4e-04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 4e-04
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 4e-04
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 6e-04
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
 Score =  144 bits (365), Expect = 6e-39
 Identities = 51/211 (24%), Positives = 97/211 (45%), Gaps = 24/211 (11%)

Query: 503 SVQAIQALLE-NKGLPVIVGIGGPSGSGKTSLAHKMANIVGCE----------VVSLESY 551
           S Q +Q   + N G P ++G+ G + SGK+S+  K+  ++G            ++S +S+
Sbjct: 7   SEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSF 66

Query: 552 FKS----EQVKDFK----YDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKE 603
           ++     ++ K  K    +D   + D  L+ K + +I  G+  ++P++D  + +R    E
Sbjct: 67  YRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKE--E 124

Query: 604 LEVSEDCGVIIFEGVYALH-PEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQ-- 660
                   V++FEG+ A +  E+R    + + V     + L  RV RD S  G  + Q  
Sbjct: 125 TVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQIL 184

Query: 661 NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFD 691
           +  +  V P F++   P   +A + I    D
Sbjct: 185 SQYITFVKPAFEEFCLPTKKYADVIIPRGAD 215
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Length = 179 Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Length = 179 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Length = 221 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Length = 226 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Length = 183 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Length = 230 Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query954
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.93
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.89
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 99.86
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.84
1yem_A179 Hypothetical protein; structural genomics, southea 99.84
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 99.84
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.83
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.83
3n10_A179 Adenylate cyclase 2; CYTH domain, antiparallel bar 99.81
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.8
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.8
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.79
2dc4_A165 PH1012 protein, 165AA long hypothetical protein; d 99.78
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.77
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.77
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.76
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 99.74
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.74
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.73
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.72
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.72
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.71
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.7
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.7
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.69
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.68
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.67
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.66
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.62
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.6
1yem_A179 Hypothetical protein; structural genomics, southea 99.59
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 99.56
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 99.56
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.52
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.51
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.46
2dc4_A165 PH1012 protein, 165AA long hypothetical protein; d 99.44
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.42
3bhd_A234 Thtpase, thiamine triphosphatase; hydrolase, struc 99.42
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.42
3n10_A179 Adenylate cyclase 2; CYTH domain, antiparallel bar 99.41
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.41
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.38
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.38
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.35
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.34
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 99.25
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.24
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.22
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.21
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.17
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.15
3v85_A210 CYTH-like phosphatase; CYTH domain, hydrolase; HET 99.13
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.12
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.11
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.11
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.09
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.08
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.08
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.08
3tj7_A195 GBAA_1210 protein; structural genomics, adenosine 99.07
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.07
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.03
2gfg_A193 BH2851; antiparallel barrel, structural genomics, 99.02
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.01
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 98.99
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 98.97
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.96
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.95
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.94
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.91
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.89
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.88
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 98.88
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.87
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.86
3r20_A233 Cytidylate kinase; structural genomics, seattle st 98.85
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.84
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.84
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.83
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.83
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.83
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.82
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.81
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.8
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.8
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.78
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.78
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.74
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.74
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 98.73
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.73
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.72
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.69
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.65
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.63
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.63
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.62
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.62
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.62
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.6
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.6
3bhd_A234 Thtpase, thiamine triphosphatase; hydrolase, struc 98.6
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.6
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.59
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.58
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.58
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.57
1via_A175 Shikimate kinase; structural genomics, transferase 98.56
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.52
2fbl_A153 Hypothetical protein NE1496; APC5855, PSI, protein 98.5
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.5
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.5
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.5
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.49
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.49
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.48
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.48
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.47
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.47
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.47
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.46
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.46
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.46
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.45
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.44
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.44
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.42
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.41
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.41
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.41
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.4
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.38
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.37
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.36
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.36
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.35
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.34
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.33
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.33
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.33
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.33
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.31
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.3
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.3
3tj7_A195 GBAA_1210 protein; structural genomics, adenosine 98.28
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.26
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.26
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.25
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.25
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.25
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.24
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.24
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.23
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.22
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.22
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.22
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.21
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.21
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.21
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.19
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.18
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.18
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.18
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.17
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.17
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.17
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.16
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.16
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.16
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.15
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 98.15
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.12
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.12
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.12
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.11
1via_A175 Shikimate kinase; structural genomics, transferase 98.09
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.08
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.08
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.07
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.07
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 98.06
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 98.06
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.05
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 98.05
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.05
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.05
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.05
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.04
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 98.02
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.02
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.96
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.93
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.93
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.92
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 97.92
2gfg_A193 BH2851; antiparallel barrel, structural genomics, 97.89
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 97.88
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.87
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.87
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.87
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.84
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.8
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.8
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.77
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.74
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.73
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 97.72
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.71
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.69
3v85_A210 CYTH-like phosphatase; CYTH domain, hydrolase; HET 97.63
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.59
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.58
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.52
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.52
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 97.52
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 97.5
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.5
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.46
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.46
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.44
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.39
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.38
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.38
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 97.37
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.34
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.31
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.3
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.3
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.28
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.26
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.26
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.23
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.21
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 97.18
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.17
2fbl_A153 Hypothetical protein NE1496; APC5855, PSI, protein 97.17
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.16
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 97.13
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.1
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.09
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.04
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.04
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.02
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.01
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.0
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.95
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.87
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.84
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.77
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.72
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.7
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.68
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.62
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 96.59
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 96.49
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.41
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.4
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.31
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.28
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.25
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.25
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.2
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.18
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.16
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.13
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.12
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.12
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.11
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.11
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.89
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.87
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.85
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.82
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.77
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.75
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.71
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.64
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.61
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.6
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.59
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.55
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.52
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.52
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.51
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.5
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.47
1tue_A212 Replication protein E1; helicase, replication, E1E 95.46
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.44
1tue_A212 Replication protein E1; helicase, replication, E1E 95.43
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.4
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.38
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.37
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.34
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.32
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.31
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.3
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.27
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.23
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.23
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.21
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.18
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.17
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.16
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.15
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.14
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.13
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.13
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.1
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.1
3bos_A242 Putative DNA replication factor; P-loop containing 95.08
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.08
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.05
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.04
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.03
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.03
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.03
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.03
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.01
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.0
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.99
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.96
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.96
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 94.93
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.93
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.92
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.91
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.9
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.9
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.85
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 94.82
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.81
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.8
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.77
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.77
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.77
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.75
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.73
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.71
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.7
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.66
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.66
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.66
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.66
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.65
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.63
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.62
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.61
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.61
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.6
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.58
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.56
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.55
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.54
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.52
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.51
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.5
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.49
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.48
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.48
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.43
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.42
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.41
3bos_A242 Putative DNA replication factor; P-loop containing 94.39
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.38
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.37
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.35
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.32
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.32
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.31
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 94.28
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.27
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.27
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.26
2og2_A359 Putative signal recognition particle receptor; nuc 94.25
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.25
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.24
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.24
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.2
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.19
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.17
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.16
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.16
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.16
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.15
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.15
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.12
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.1
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.1
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.09
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.09
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.07
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.06
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.06
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.03
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.02
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.02
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.0
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.99
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.97
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.94
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.93
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.91
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.91
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.88
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.87
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.87
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.86
1g6h_A257 High-affinity branched-chain amino acid transport 93.84
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.81
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.8
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.78
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.78
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.78
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.76
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.76
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.75
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.75
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.75
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.74
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.74
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.73
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.73
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.71
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.71
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.7
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.68
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.68
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 93.67
2ghi_A260 Transport protein; multidrug resistance protein, M 93.64
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.62
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 93.62
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 93.61
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.61
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.6
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.59
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.58
2cvh_A220 DNA repair and recombination protein RADB; filamen 93.58
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.58
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 93.57
2og2_A359 Putative signal recognition particle receptor; nuc 93.57
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.55
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.52
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 93.52
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.5
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.48
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.46
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.44
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.44
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.43
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 93.43
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 93.42
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.41
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.39
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.39
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.39
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.35
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.35
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.34
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.34
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.33
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.33
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.31
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.29
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.29
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.29
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.27
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.27
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.26
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.25
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.24
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 93.24
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.24
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 93.23
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.22
1g6h_A257 High-affinity branched-chain amino acid transport 93.17
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.16
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.14
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.13
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.13
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.12
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.12
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.1
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.09
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.09
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.08
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.06
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.06
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.05
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.05
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.05
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.03
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 93.02
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
Probab=99.93  E-value=3e-26  Score=254.43  Aligned_cols=242  Identities=17%  Similarity=0.207  Sum_probs=179.9

Q ss_pred             ccccccccceecccCCCcCCC--ccccCCCcccceecccCCCCc-cchhhhHHHHHHHHHHH-------H--cCCCCEEE
Q 002197          453 KMEPVLATWHFISSDPSHAGS--SVIGSSSFRDTVKLVPMPDSY-DFDRGLLLSVQAIQALL-------E--NKGLPVIV  520 (954)
Q Consensus       453 ~~~~~~~~W~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~l-~~~e~~~~~i~~i~~l~-------~--~~~~p~iI  520 (954)
                      -+.....+|+.+..+.+++|+  ++-...++++.+.+..+.+-| ++.+.+.+.....+.+.       .  ..+.|++|
T Consensus        16 ~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~y~pl~rll~~~~~~~~~l~~~~~~~l~~~~~~~p~ii   95 (321)
T 3tqc_A           16 YLQFNRQQWGNFRKDTPLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYII   95 (321)
T ss_dssp             EEEEEHHHHTC------CCCCHHHHHHTTTTHHHHCHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCCEEE
T ss_pred             ceEECHHHHHHHhcCCCCCCCHHHHHHhhCCCCCcCHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHhccCCCCCCEEE
Confidence            345788999977777766655  455566777777665554444 34443333333333321       2  24678999


Q ss_pred             eeeCCCCccHHHHHHHHHHHhC-------Cceeccccccchhhh----c-cccCCCCCcccHHHHHHHHHHHHcCC-cee
Q 002197          521 GIGGPSGSGKTSLAHKMANIVG-------CEVVSLESYFKSEQV----K-DFKYDDFSSLDLSLLSKNISDIRNGR-RTK  587 (954)
Q Consensus       521 GIsGpsGSGKTTlA~~La~~Lg-------~~vIs~Ddfy~~~~~----~-~~n~d~p~t~D~~lL~~~L~~L~~g~-~v~  587 (954)
                      ||+||+|||||||++.|+..++       +.++++|+||.+...    . ..+++.|+++|.+++.+.|..+++|+ .+.
T Consensus        96 gI~GpsGSGKSTl~~~L~~ll~~~~~~~~v~~i~~D~f~~~~~~l~~~~~~~~~g~P~~~D~~~l~~~L~~L~~g~~~v~  175 (321)
T 3tqc_A           96 GIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVR  175 (321)
T ss_dssp             EEECCTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHTTCGGGTTSGGGBCHHHHHHHHHHHHTTCSSEE
T ss_pred             EEECCCCCCHHHHHHHHHHHhcccCCCCeEEEEeecccccchhhhhhHHHHhhccCcccccHHHHHHHHHhhhccccccc
Confidence            9999999999999999998874       568999999987332    1 12467899999999999999999999 899


Q ss_pred             cccccccccccCCccceeeccCccEEEEEeecccchh-----------hhhcCCeEEEEEcChhHHHHHHHhcCcccccc
Q 002197          588 VPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPE-----------IRKSLDLWIAVVGGVHSHLISRVQRDKSRMGC  656 (954)
Q Consensus       588 ~P~yD~~~~dr~~~~~~~~~~~~dVVIvEG~~~~~~~-----------l~~~~D~~I~v~~~~d~rl~Rri~RD~~~rg~  656 (954)
                      +|.||+.++++.+. .+....+.+|||+||++++++.           +.+.+|++|||+++.+.++.|++.||...+|.
T Consensus       176 ~P~yd~~~~~r~~~-~~~~v~~~dIVIvEGi~lL~~~~~~~~~~~~~~l~~~~D~~I~Vda~~d~~~~R~i~Rd~~~r~~  254 (321)
T 3tqc_A          176 IPVYSHHYYDIVRG-QYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRT  254 (321)
T ss_dssp             EEEEETTTTEEEEE-EEEEECSCSEEEEECTTTTCCCCCSSSSSCCCCGGGGCSEEEEEECCHHHHHHHHHHHHHHHHHT
T ss_pred             cchhhhhccccccC-ceeeccCCCEEEEEccccccccccccccchhhhhhhhcCeEEEEECCHHHHHHHHHHhcchhhhh
Confidence            99999999998742 3344567899999999999844           88999999999999999999999999887763


Q ss_pred             ccc---------------h------hhHHhhhcchhhhhcccccCcccEEEcCCCCCCCC
Q 002197          657 FMS---------------Q------NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLS  695 (954)
Q Consensus       657 ~~~---------------~------~q~~~~v~p~~~~~Iep~~~~ADivI~n~~~~rl~  695 (954)
                      ...               +      .+|.....|.+++||.|++.+||+||+.+-+...+
T Consensus       255 a~~~~~s~~~~y~~~s~~ea~~~a~~~w~~~~~pn~~~~I~ptr~~Adlil~~g~~~~v~  314 (321)
T 3tqc_A          255 TFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQ  314 (321)
T ss_dssp             GGGSTTSTTGGGGGSCHHHHHHHHHHHHHHTHHHHHHHHTGGGGGGCSEEEEECTTSCEE
T ss_pred             hccChHHHHHHHhcCCHHHHHHHHHHHHHhccccCHHHhCccCccCceEEEecCCCCcEE
Confidence            211               0      22333456999999999999999999888776543
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3n10_A Adenylate cyclase 2; CYTH domain, antiparallel barrel, product complex, cyclic AM; HET: CMP; 1.60A {Yersinia pestis} PDB: 3n0z_A* 3n0y_A* 2fjt_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dc4_A PH1012 protein, 165AA long hypothetical protein; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2dc4_A PH1012 protein, 165AA long hypothetical protein; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3bhd_A Thtpase, thiamine triphosphatase; hydrolase, structural genomics consortium, CYTH SGC; HET: MSE CIT; 1.50A {Homo sapiens} PDB: 2jmu_A Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3n10_A Adenylate cyclase 2; CYTH domain, antiparallel barrel, product complex, cyclic AM; HET: CMP; 1.60A {Yersinia pestis} PDB: 3n0z_A* 3n0y_A* 2fjt_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3v85_A CYTH-like phosphatase; CYTH domain, hydrolase; HET: CIT; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tj7_A GBAA_1210 protein; structural genomics, adenosine monophosphate, center for STR genomics of infectious diseases, csgid; HET: AMP; 2.10A {Bacillus anthracis} PDB: 3sy3_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2gfg_A BH2851; antiparallel barrel, structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, unknow function; 2.12A {Bacillus halodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3bhd_A Thtpase, thiamine triphosphatase; hydrolase, structural genomics consortium, CYTH SGC; HET: MSE CIT; 1.50A {Homo sapiens} PDB: 2jmu_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2fbl_A Hypothetical protein NE1496; APC5855, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.90A {Nitrosomonas europaea} SCOP: d.63.1.2 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3tj7_A GBAA_1210 protein; structural genomics, adenosine monophosphate, center for STR genomics of infectious diseases, csgid; HET: AMP; 2.10A {Bacillus anthracis} PDB: 3sy3_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2gfg_A BH2851; antiparallel barrel, structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, unknow function; 2.12A {Bacillus halodurans} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3v85_A CYTH-like phosphatase; CYTH domain, hydrolase; HET: CIT; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2fbl_A Hypothetical protein NE1496; APC5855, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.90A {Nitrosomonas europaea} SCOP: d.63.1.2 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 954
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 8e-24
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 2e-17
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 6e-18
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 1e-11
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 5e-15
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 7e-11
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 4e-11
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 8e-06
d1ckea_225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 4e-06
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 3e-05
d2acaa1174 d.63.1.2 (A:8-181) Putative adenylate cyclase VP17 2e-04
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 4e-04
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 4e-04
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 0.001
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.001
d1q3ta_223 c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae 0.002
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.003
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.003
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.003
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.004
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  100 bits (250), Expect = 8e-24
 Identities = 30/249 (12%), Positives = 83/249 (33%), Gaps = 48/249 (19%)

Query: 517 PVIVGIGGPSGSGKTSLAHKMANIVGCE-----VVSLESYFKS--------------EQV 557
             I+ + G SG+G +++ H    I   E      +  +++ +                  
Sbjct: 4   HPIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRYAAGD 63

Query: 558 KDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFK--------ELEVSED 609
             F +  + + +L  L +   +     + +   +  +    +             +   D
Sbjct: 64  ATFSHFSYEANELKELERVFREYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSD 123

Query: 610 CGVIIFEGVYALHP----EIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMM 665
             ++ +EG++         I    DL I VV  ++   I ++ RD++  G   +   +  
Sbjct: 124 SHLLFYEGLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQKIHRDRATRG--YTTEAVTD 181

Query: 666 TVF---PMFQQHIEPHLVHAHLKIR--------NDFDP--VLSPESSLFVL--KSNKQVA 710
            +      +   I P      +  +        N F    + + + S+ V+  ++ + + 
Sbjct: 182 VILRRMHAYVHCIVPQFSQTDINFQRVPVVDTSNPFIARWIPTADESVVVIRFRNPRGID 241

Query: 711 YQDILKILD 719
           +  +  ++ 
Sbjct: 242 FPYLTSMIH 250
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Length = 174 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query954
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.94
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.94
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.92
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.92
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.89
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.87
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.84
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.76
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.75
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.72
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.7
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.64
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.59
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 99.55
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.53
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.45
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.44
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.39
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.37
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.82
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.81
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.75
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.73
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.71
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.68
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.66
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 98.64
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.63
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.61
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.59
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.59
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.58
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.56
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.55
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.53
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.52
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.52
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.51
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.51
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.5
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.48
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.47
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.46
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.44
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.42
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.42
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.42
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.36
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.35
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.33
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.31
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.31
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.31
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.3
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.29
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.28
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.27
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.23
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.23
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.2
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.17
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.15
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.13
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.12
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.1
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.1
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.06
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.05
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.03
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.01
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.01
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.0
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.99
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.95
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.93
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.86
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.85
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.82
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.81
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.81
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.79
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.77
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.76
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.76
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.74
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.7
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.69
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.68
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.52
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.48
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.46
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.45
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.45
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.43
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.42
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.4
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.39
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.32
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.31
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.31
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.25
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.25
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.2
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.16
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.11
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.09
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.04
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.03
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.01
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.98
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.98
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 96.96
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 96.94
d2qy9a2211 GTPase domain of the signal recognition particle r 96.88
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.84
d1vmaa2213 GTPase domain of the signal recognition particle r 96.84
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.78
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.73
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.68
d1okkd2207 GTPase domain of the signal recognition particle r 96.65
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.64
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.64
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.62
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.59
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.55
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.53
d1vmaa2213 GTPase domain of the signal recognition particle r 96.51
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.48
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.47
d2qy9a2211 GTPase domain of the signal recognition particle r 96.45
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.44
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.42
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.38
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.37
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 96.36
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.36
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.3
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.26
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.23
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.2
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.19
d1okkd2207 GTPase domain of the signal recognition particle r 96.14
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.13
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.11
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.08
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.96
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.9
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.89
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.85
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.84
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.78
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.75
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.71
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.62
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.54
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.43
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.41
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.28
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.28
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.27
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.19
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.13
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.06
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.95
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.81
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.78
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.77
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.76
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.72
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.72
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.71
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.66
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.63
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.58
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.57
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.52
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.51
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.49
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.48
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.48
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.39
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.34
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.34
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.29
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.25
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.25
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.23
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.2
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.17
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.12
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.12
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.11
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.1
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.04
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.01
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.99
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.98
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.96
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.84
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.81
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.78
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.74
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.73
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.72
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.4
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.36
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.29
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.21
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.18
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.17
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.08
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.08
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.03
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.03
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.01
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.01
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.86
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.84
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.8
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.5
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.49
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.49
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.46
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.45
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.36
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.26
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.07
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.03
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.02
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.99
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.9
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.87
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 91.78
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 91.75
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.61
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.55
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.41
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.38
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.35
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.31
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 91.28
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.12
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.01
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.0
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 90.89
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.78
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.68
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.58
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 90.56
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.43
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.4
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.32
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.22
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.16
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.04
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.88
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.74
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 89.72
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.68
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.63
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.6
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.52
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.51
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.23
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.21
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 89.13
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.05
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.99
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.92
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.9
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.86
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.71
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.7
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.68
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.65
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.63
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.47
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.38
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.12
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.03
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.98
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 87.96
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 87.86
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.85
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 87.82
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.74
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.69
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 87.57
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 87.55
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 87.5
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.44
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.39
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.34
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.24
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.2
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 87.11
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 87.06
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.05
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.99
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.93
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.84
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.66
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.59
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.5
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.48
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.39
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.3
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.29
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 86.29
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.27
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 86.26
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.22
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.04
d1nrjb_209 Signal recognition particle receptor beta-subunit 85.97
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 85.96
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 85.92
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.85
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.77
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 85.77
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.71
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.67
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 85.66
d1nrjb_209 Signal recognition particle receptor beta-subunit 85.45
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.42
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.41
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 85.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.32
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 85.27
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.14
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 85.13
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 85.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.09
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 85.05
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.0
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.95
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 84.85
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 84.73
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.72
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.64
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 84.51
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 84.48
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 84.39
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.37
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 84.32
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 84.27
d2fh5b1207 Signal recognition particle receptor beta-subunit 84.16
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.15
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 84.13
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 84.09
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.08
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.04
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 84.02
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.99
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 83.9
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.86
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 83.79
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.78
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.77
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.72
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 83.71
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 83.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.66
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.65
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.63
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.58
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 83.57
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.54
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 83.53
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 83.52
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.52
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.48
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 83.43
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.38
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 83.33
d2fh5b1207 Signal recognition particle receptor beta-subunit 83.28
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.17
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 83.12
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 83.02
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.02
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.81
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 82.79
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 82.77
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.69
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.61
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 82.61
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 82.52
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.29
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.18
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 82.14
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 82.04
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 81.98
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.97
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 81.96
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 81.84
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 81.78
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 81.72
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 81.7
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.45
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 81.43
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.39
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 81.39
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 81.36
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 81.35
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 81.32
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 81.31
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.27
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.21
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 81.18
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 81.18
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 80.68
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 80.64
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 80.44
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.42
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 80.41
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.36
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 80.28
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 80.1
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 80.06
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 80.06
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=7.7e-30  Score=278.33  Aligned_cols=233  Identities=15%  Similarity=0.171  Sum_probs=174.6

Q ss_pred             cccccccceecccCCCcCCCccccCCCcccceecccCCCCccchhh----------hHHHHHHHHHHH---------HcC
Q 002197          454 MEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRG----------LLLSVQAIQALL---------ENK  514 (954)
Q Consensus       454 ~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~e~----------~~~~i~~i~~l~---------~~~  514 (954)
                      ...+.++|+.+..+.+++|++       .+--.+.++.+.++..|.          +.+.+++.+.+.         ...
T Consensus         5 ~~~~~~~w~~l~~~~~~~l~~-------~~~~~~~~~~~~~~~~~v~~iylpl~~l~~~~~~~~~~~~~~~~~fl~~~~~   77 (308)
T d1sq5a_           5 LQFDRNQWAALRDSVPMTLSE-------DEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQ   77 (308)
T ss_dssp             EEEEHHHHHHTCC---C-CCH-------HHHHHHHHHCTTCCHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTCC-C
T ss_pred             ceeCHHHHHhhccCCCCCCCH-------HHHHHHhCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCC
Confidence            346789999888888888887       333334444555544432          222333333332         135


Q ss_pred             CCCEEEeeeCCCCccHHHHHHHHHHHhC-------Cceeccccccchhhh-----ccccCCCCCcccHHHHHHHHHHHHc
Q 002197          515 GLPVIVGIGGPSGSGKTSLAHKMANIVG-------CEVVSLESYFKSEQV-----KDFKYDDFSSLDLSLLSKNISDIRN  582 (954)
Q Consensus       515 ~~p~iIGIsGpsGSGKTTlA~~La~~Lg-------~~vIs~Ddfy~~~~~-----~~~n~d~p~t~D~~lL~~~L~~L~~  582 (954)
                      +.|++|||+|++||||||+|+.|+..|.       +.+||||+||++.+.     ...+++.|+++|+++|.++|..+++
T Consensus        78 k~P~iIGIaG~sgSGKSTla~~L~~lL~~~~~~~~v~~Is~D~F~~~~~~l~~~~~~~~~g~Pes~D~~~L~~~L~~lk~  157 (308)
T d1sq5a_          78 RIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKS  157 (308)
T ss_dssp             CCCEEEEEEECTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHHTCTTCTTSGGGBCHHHHHHHHHHHTT
T ss_pred             CCCEEEEEeCCCCCCCcHHHHHHHHHHhhhcCCCceEEEeeeeeECCchHHHHhcCCccCCchHhhhHHHHHHHHHHHHc
Confidence            6799999999999999999999999873       568999999997432     2357889999999999999999998


Q ss_pred             CC-ceecccccccccccCCccceeeccCccEEEEEeecccch-----------hhhhcCCeEEEEEcChhHHHHHHHhcC
Q 002197          583 GR-RTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHP-----------EIRKSLDLWIAVVGGVHSHLISRVQRD  650 (954)
Q Consensus       583 g~-~v~~P~yD~~~~dr~~~~~~~~~~~~dVVIvEG~~~~~~-----------~l~~~~D~~I~v~~~~d~rl~Rri~RD  650 (954)
                      |+ .+..|.||+.++++.+.. .....+.+||||||++++.+           .+++++|++|||+++.+.++.|++.|+
T Consensus       158 g~~~v~~P~yd~~~~d~~~~~-~~~~~~~dIlIvEGi~vL~~~~~~~~~~~~~~l~d~~D~~Ifvda~~~~~~~r~i~R~  236 (308)
T d1sq5a_         158 GVPNVTAPVYSHLIYDVIPDG-DKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRF  236 (308)
T ss_dssp             TCSCEEECCEETTTTEECTTC-CEEEC-CCEEEEECTTTTCCGGGCTTSCCSSCGGGGCSEEEEEECCHHHHHHHHHHHH
T ss_pred             CCCcceeeccchhhcccCCCC-ceEeCCCCEEEEcchhhccCccccccccccchhhhhhheeeeecCCHHHHHHHHHHHH
Confidence            85 599999999999987643 33455679999999999863           278999999999999999999999999


Q ss_pred             ccccccccch---------------------hhHHhhhcchhhhhcccccCcccEEEcCCCCCCC
Q 002197          651 KSRMGCFMSQ---------------------NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVL  694 (954)
Q Consensus       651 ~~~rg~~~~~---------------------~q~~~~v~p~~~~~Iep~~~~ADivI~n~~~~rl  694 (954)
                      ...+|.+...                     ..|.....|.+.+||.|++.+||+||..+.+..+
T Consensus       237 ~~~r~~a~~d~~~~~~~y~~~~~~ea~~~a~~~w~~i~~~nl~~~I~Ptk~rADlIi~~~~dh~v  301 (308)
T d1sq5a_         237 LKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAV  301 (308)
T ss_dssp             HHHHHTTTTCTTSTTHHHHTSCHHHHHHHHHHHHHHTHHHHHHHTTGGGGGGCSEEEEECGGGCE
T ss_pred             HHHhcccccChHHHHHHHhccCHHHHHHHHHHHHHHcchhhHHHhCccchhcceEEEEcCCCCcE
Confidence            9888865321                     1123345789999999999999999987766543
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure