Citrus Sinensis ID: 002234


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------95
MADADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
cccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHccccEEEEEEEcccccEEEEEcccHHHHHHHHcccccccccccccEEEEcccccccccccccccccccccccccccEEEEEEEEcccEEEcccccccccccccccccEEcccccccEEEEEEccccEEEEEccccEEEEEccccccEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccEEEEcccccEEEEEcccEEEEEEccccEEEEEcccccEEEEEccccccccccccEEEEEEEccccEEEEEEccccEEEEEEccccccEEEccccccEEEEEEcccEEEEEcccccEEEEEcccccEEccccccccccEEEEEEcccccEEEEEcccccEEEEccc
ccccccccccccccccccccccccHHHccccEEEEccccccHHHHHHHHHcccccccccccEcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHEHccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHEEcccccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHcHHccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccEEEEEccccccEEEEEEEEccEEEEEcccccEEEEEccccEEEEEEEHHcccccEEEEEEccccccccccccccEEEEEEEccccEEEEEEEEcccHHHHEEEcccEEEEEEcccEEEEEEccccEEEEccccEEEEEEEEccEEEEEcccccEEEEEEccccEEEEEccccEEEcccccEEEEEEEccEEEEccccccccEEEEEEcccccEEEEccccccEEEEEEEccEEEEEccccEEEEEEccccEEEEEEEccccEEEEEEEEEccccEEEEEccccEEEEEEcc
madadnppgigkhtppkdfvcpitthifddpvtletgqTYERRAIQEWIErgnsscpitrqklsstklpktNYVLKRLIASWqeqnpggldlshsepmsksivpsnspnsvisqaTIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSElgsrdksvIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMqedgkcrnsiadkaelapVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLdllaeprkmsIYREEAIDTLISclrnsdypAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAgvgksyknltrteqignicgedddtseeEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALnsfaqdpqglrdINIHMKDIMKGLRELRKYSPLAFEMVKVLsnghdssadfwnhrelvhvdssengkvlSIACFRdkifsghsdgtikvwtGRGSILHLIQQIREHTKAVTGLailqsgemlysgsldktaRVWSIGNEEIHCVQVHDIKDQIQNLAVSNSilcfipqgagikvhlrngktkllnsskypkclalvqgkvycgcqdgaIQEIDLATGTFATIQTGHrkllgkanpvhalqVHNGLVYTASTSLDGAAVKMWStsnynmvgslptLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETlqtgtsgkvqcmalddneeflvigtsdgriqawgls
madadnppgigkhtppkdfVCPITTHIFDDPVTLETGQTYERRAIQEWiergnsscpitrqklsstklpkTNYVLKRLIASWQEQNPGGLDLSHSEPMSKsivpsnspnsVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLlselgsrdksvihtltrvesdvERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIikdegtysSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQgrfttsgksltrAMLLKragvgksyknltrteqignicgedddtsEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSfaqdpqglrDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGtveiwdqkrQIRIEtlqtgtsgkvQCMALDDNEEFlvigtsdgriqawgls
MADADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGlllqldllAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEKAADDWERKMALVLVSHDfgllfealeeglNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
*****************DFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPIT********LPKTNYVLKRLIASW*******************************QATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNIC***************WERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAW***
*****************DFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQ*************************************ITELKHAITSLC************LQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLR******AQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICG*************DWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
********GIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGE***********DDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
***********KHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLD**************************DGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICG*DDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query949 2.2.26 [Sep-21-2011]
C6L7U11485 Putative E3 ubiquitin-pro N/A no 0.978 0.625 0.432 0.0
D1FP531488 Putative E3 ubiquitin-pro N/A no 0.978 0.624 0.431 0.0
D1FP571485 Putative E3 ubiquitin-pro N/A no 0.978 0.625 0.427 0.0
Q0IMG9694 E3 ubiquitin-protein liga no no 0.107 0.146 0.421 4e-16
A2ZLU6694 Protein spotted leaf 11 O N/A no 0.107 0.146 0.421 4e-16
Q9SNC6660 U-box domain-containing p no no 0.083 0.119 0.5 5e-16
Q9C9A6628 U-box domain-containing p no no 0.079 0.119 0.5 5e-15
Q5VRH9611 U-box domain-containing p no no 0.195 0.304 0.319 5e-15
Q8GUG9612 U-box domain-containing p no no 0.081 0.125 0.5 2e-14
O48700771 U-box domain-containing p no no 0.096 0.119 0.423 3e-14
>sp|C6L7U1|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2 Back     alignment and function desciption
 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/979 (43%), Positives = 601/979 (61%), Gaps = 50/979 (5%)

Query: 15   PPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYV 74
            PPKDFVCPIT  IF DPVTLETGQTYER+AIQEW+  GN++CPITRQ LS++ LPKTNYV
Sbjct: 511  PPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSASILPKTNYV 570

Query: 75   LKRLIASWQEQNPG-GLDLSH-SEPMSKSIVPS--------------------------- 105
            LKRLI SW+EQNP    + S+ + P   S  PS                           
Sbjct: 571  LKRLITSWKEQNPELAQEFSNVNTPRGSSCSPSAKDIPMLSTRQRTTDSPNHKNKDYARQ 630

Query: 106  -----------NSPNSVISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEA 154
                        SP SV+SQA ++  +  LK  I+SLC SE L E E AVL+I R   ++
Sbjct: 631  RSNRFMPAAITTSPTSVLSQAAVETIVNSLKPYISSLCTSENLPECEEAVLKIARLLKDS 690

Query: 155  SMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDV 214
                 I   LSKP +ING VEIL  S +  VL  +I++LSEL   D SV  TL  V+SD 
Sbjct: 691  KTNPQIHSYLSKPTIINGLVEILSASRNREVLRTSIYILSELIFTDDSVAETLNSVDSDF 750

Query: 215  ERIVALFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEE--DFLKMCLKPKSV 272
            + +  L K GL EA +LI  LRP    L   +++ SL+ VI+ K E  D  ++ + PK  
Sbjct: 751  DCLATLLKNGLAEAALLIYQLRPVFAQLSAHELIPSLVDVIQNKNEELDDFQLVIDPKDA 810

Query: 273  SVLLLGQMIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDG 332
            ++ +L Q +   +E   S  A++++S+    +++  LE    E R + V +LL CMQ + 
Sbjct: 811  AIAILEQTLMGGDEYSRSLNASSVISANGIPTLVKYLER--MEGRRSVVSVLLCCMQAEK 868

Query: 333  KCRNSIADKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYS 392
             C+N IA++ EL+PV+E F + +D  R   V FLSELV+LNRRT   QILH IKDEG +S
Sbjct: 869  SCKNLIANRIELSPVLELFHSGNDSVRGTCVEFLSELVQLNRRTSCNQILHTIKDEGAFS 928

Query: 393  SMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQ 452
            +MHT LVYLQ A  +    VA LLLQLDLLAEPRKMSIYREEA++TLI  L   D+   Q
Sbjct: 929  TMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPRKMSIYREEAVETLIEALWQKDFSNTQ 988

Query: 453  LAAAKTIVSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEK 512
            + A   ++ L G  ++SGKS T A LLK AG  + Y  L + EQ+G    +  +T E+EK
Sbjct: 989  MKALDALLFLIGHISSSGKSYTEAWLLKIAGFDQPYNALMKVEQLGQHDNDLIETMEDEK 1048

Query: 513  AA-DDWERKMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGI 571
             A + W++++A VL +H+ G +F+ALEE L S   ++  +C   ATWL +ML  LPDTG+
Sbjct: 1049 NALNSWQKRIASVLCNHENGSIFKALEECLKSNSLKMAKSCLVLATWLTHMLYTLPDTGV 1108

Query: 572  FGAARVSLLKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELR 631
               AR SLL+  I+  +S+ +++++ L+ LAL +F  DP     + ++ K I + LR L+
Sbjct: 1109 RDVARKSLLEEVINVLQSSKNLEEKILATLALKTFISDPSTHEALRVYAKSIYRTLRRLK 1168

Query: 632  KYSPLAFEMVKVLSNGHD-SSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTI 690
            KYS +A +++KV+ N       + W+ +E+V +D S NG+VLS+     ++ SGH+DGTI
Sbjct: 1169 KYSVVAVDIMKVILNLKSVDVTELWSCKEVVELDLSSNGEVLSMVYLNGQVLSGHTDGTI 1228

Query: 691  KVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVH 750
            KVW  R  I  +IQ+  EHTKAVT L    SG+ LYSGSLDKT RVW+I ++ I C+ V+
Sbjct: 1229 KVWDARKRIPRVIQETHEHTKAVTSLC--SSGDRLYSGSLDKTIRVWTIKSDGIKCIDVY 1286

Query: 751  DIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDG 810
            DIK+ +  LA ++ + C++ QG G+KV   +   KL+N SKY K LA+   K+YCGC   
Sbjct: 1287 DIKEAVHELAANDKLACYVSQGTGVKVFNWSEAPKLINFSKYVKSLAVAGDKLYCGCSGY 1346

Query: 811  AIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYN 870
            +IQE+DL+T T  +  TG RKLLGK   +H+LQ+H+  ++   +S+D  A K++S S   
Sbjct: 1347 SIQEVDLSTYTSNSFFTGTRKLLGKQT-IHSLQIHDDYLFACGSSVDATAGKIFSLSQKM 1405

Query: 871  MVGSLPTLSEVRAMVVSSELVYLGCKGGTVEIWDQKRQIRIETLQ-TGTSGKVQCMALDD 929
            +VGSL T  ++  + ++S+ ++ G K GT+E+W + +  R+ +++  G   K+  +  D 
Sbjct: 1406 VVGSLSTGLDIHRIAINSDFIFAGTKFGTIEVWLKDKFTRVASIKMAGGHTKITSLVSDV 1465

Query: 930  NEEFLVIGTSDGRIQAWGL 948
            +   L +G+SDG+IQ W L
Sbjct: 1466 DGMMLFVGSSDGKIQVWAL 1484




Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules.
Lotus japonicus (taxid: 34305)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D1FP53|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1 Back     alignment and function description
>sp|D1FP57|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabidopsis thaliana GN=PUB6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query949
297738795 1154 unnamed protein product [Vitis vinifera] 0.998 0.821 0.739 0.0
147852653 1618 hypothetical protein VITISV_002973 [Viti 0.998 0.585 0.737 0.0
356511369 1421 PREDICTED: uncharacterized protein LOC10 0.998 0.667 0.651 0.0
356527773 1492 PREDICTED: uncharacterized protein LOC10 0.994 0.632 0.644 0.0
357520957 1068 U-box domain-containing protein [Medicag 0.955 0.849 0.644 0.0
449449627 1336 PREDICTED: putative E3 ubiquitin-protein 0.993 0.705 0.607 0.0
326507154 1375 predicted protein [Hordeum vulgare subsp 0.985 0.68 0.536 0.0
357127715 1418 PREDICTED: uncharacterized protein LOC10 0.979 0.655 0.517 0.0
242051493 1404 hypothetical protein SORBIDRAFT_03g00087 0.990 0.669 0.503 0.0
414875638 1398 TPA: hypothetical protein ZEAMMB73_57674 0.978 0.664 0.492 0.0
>gi|297738795|emb|CBI28040.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1442 bits (3733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/958 (73%), Positives = 827/958 (86%), Gaps = 10/958 (1%)

Query: 2    ADADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQ 61
            AD+D+PPG GK TPPKDF+CPIT+HIFDDPVTLETGQTYER+AIQEWI+RGNS+CPITRQ
Sbjct: 197  ADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWIDRGNSTCPITRQ 256

Query: 62   KLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKS---------IVPSNSPNSVI 112
            KL ST+LPKTNYVLKRLIASWQEQNPG + +    P  ++         ++PS SPNSVI
Sbjct: 257  KLHSTQLPKTNYVLKRLIASWQEQNPGFISIHSDNPDPETDPIFNSTLPVLPSTSPNSVI 316

Query: 113  -SQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVIN 171
             SQAT+DGTI EL+ AIT LCMSEIL ESE AVL+IER W E +M L+IQ MLSKPAVIN
Sbjct: 317  ISQATMDGTICELRLAITKLCMSEILRESEKAVLRIERFWQEMNMGLEIQTMLSKPAVIN 376

Query: 172  GFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVALFKKGLLEAVVL 231
            GFVEILFNSVDPRVL AT+FLL ELGSRDK+VI TLTRV+SDVE IVALFK GLLEAVVL
Sbjct: 377  GFVEILFNSVDPRVLRATVFLLCELGSRDKTVIQTLTRVDSDVECIVALFKNGLLEAVVL 436

Query: 232  IDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQMIGDSEESIVSS 291
            I LLRPST +LIEMDM+ESL+ VIKKK++ FL+MCLKPK+ S+LLLGQ++G SE +IV+S
Sbjct: 437  IHLLRPSTISLIEMDMVESLLVVIKKKQDGFLEMCLKPKTASILLLGQILGSSEGNIVTS 496

Query: 292  IANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESF 351
            IA T+VS+K  +S++ SLEAEWAEERIAAVGILLRCMQEDGKCR++IADKAELAPV+ESF
Sbjct: 497  IAKTVVSAKAIKSIVESLEAEWAEERIAAVGILLRCMQEDGKCRHTIADKAELAPVLESF 556

Query: 352  MAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPV 411
            M ASDGERFEI+ F SELVKLNRRTFNEQ+LHIIKDEG +S+MHTLL+YLQTA  DQCPV
Sbjct: 557  MGASDGERFEIINFFSELVKLNRRTFNEQVLHIIKDEGAFSTMHTLLIYLQTALQDQCPV 616

Query: 412  VAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTIVSLQGRFTTSGK 471
            VAGLLLQLDLL EPRKMSIYREEA+DTLISCLRNSD+PAAQ+AAA+TIVSLQGRF++SGK
Sbjct: 617  VAGLLLQLDLLVEPRKMSIYREEAMDTLISCLRNSDFPAAQIAAAETIVSLQGRFSSSGK 676

Query: 472  SLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFG 531
            SLTRA LLKRAG+ KSY+ L + +Q+ N  GE ++  EEE+AAD+WERKMA VLVSH+FG
Sbjct: 677  SLTRASLLKRAGLDKSYRTLMQVDQLSNSSGESEENLEEEQAADEWERKMAFVLVSHEFG 736

Query: 532  LLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSLLKRFISAFKSAN 591
            LLFEAL EGL SR  EL+S+CF SATWLI+ML  LPDTGI GAARV LLK FIS FKSA 
Sbjct: 737  LLFEALAEGLRSRNQELFSSCFLSATWLIHMLTVLPDTGIRGAARVCLLKHFISMFKSAK 796

Query: 592  DIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFEMVKVLSNGHDSS 651
              +++ALS+LAL+SF  DP+GL D+  HMKDI+KGLR+L+K   LA +M+KV S G++SS
Sbjct: 797  GTEEKALSMLALSSFIHDPEGLNDLTSHMKDILKGLRQLKKSCILAVDMLKVFSEGNNSS 856

Query: 652  ADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSILHLIQQIREHTK 711
             D WNH+ELV VD S NG+VLSI CFRDKIFSGHSDGTIKVWTGRGSILHLI + REHTK
Sbjct: 857  IDLWNHKELVQVDCSANGEVLSIVCFRDKIFSGHSDGTIKVWTGRGSILHLIHETREHTK 916

Query: 712  AVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQ 771
            AVT LAIL+SGE LYSGSLD+TAR+WSIG+E I+CVQ+HD+KDQ+ NL V+NSI CFIPQ
Sbjct: 917  AVTSLAILESGERLYSGSLDRTARIWSIGSEAIYCVQIHDMKDQVNNLVVANSIACFIPQ 976

Query: 772  GAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRK 831
            GAG+KVH  NGK+KLLN +K  KCL LV GK+YCGC D +IQEIDLATGT ++IQ+G RK
Sbjct: 977  GAGVKVHSWNGKSKLLNPNKNVKCLTLVHGKLYCGCHDNSIQEIDLATGTLSSIQSGTRK 1036

Query: 832  LLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLPTLSEVRAMVVSSELV 891
            LLGK+NPVHALQVH+G++Y++S SLDGAAVK+WS +NY+MVGSL +  EVR + VSSEL+
Sbjct: 1037 LLGKSNPVHALQVHDGMIYSSSFSLDGAAVKIWSATNYSMVGSLASTMEVRTLAVSSELI 1096

Query: 892  YLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWGLS 949
            YLG K GTVEIW +K+ IR+ETLQTGT+GKVQCMA+D +EE LV+GTSDGRIQAW LS
Sbjct: 1097 YLGSKSGTVEIWCRKKLIRVETLQTGTNGKVQCMAVDGDEEVLVVGTSDGRIQAWELS 1154




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147852653|emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511369|ref|XP_003524399.1| PREDICTED: uncharacterized protein LOC100787950 [Glycine max] Back     alignment and taxonomy information
>gi|356527773|ref|XP_003532482.1| PREDICTED: uncharacterized protein LOC100808867 [Glycine max] Back     alignment and taxonomy information
>gi|357520957|ref|XP_003630767.1| U-box domain-containing protein [Medicago truncatula] gi|355524789|gb|AET05243.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449449627|ref|XP_004142566.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|326507154|dbj|BAJ95654.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357127715|ref|XP_003565524.1| PREDICTED: uncharacterized protein LOC100836629 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242051493|ref|XP_002454892.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor] gi|241926867|gb|EES00012.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|414875638|tpg|DAA52769.1| TPA: hypothetical protein ZEAMMB73_576745 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query949
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.314 0.474 0.270 8.2e-15
UNIPROTKB|Q0IMG9694 SPL11 "E3 ubiquitin-protein li 0.107 0.146 0.421 9e-14
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.189 0.284 0.308 7.5e-13
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.087 0.125 0.494 1.7e-12
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.368 0.571 0.254 1.9e-12
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.090 0.140 0.445 5.2e-12
TAIR|locus:2032472771 AT1G24330 [Arabidopsis thalian 0.096 0.119 0.432 6.9e-12
TAIR|locus:2010424768 PUB45 "plant U-box 45" [Arabid 0.175 0.217 0.311 9.7e-12
TAIR|locus:2014584811 PUB43 "plant U-box 43" [Arabid 0.315 0.368 0.236 4.7e-11
TAIR|locus:2012136421 PUB26 "plant U-box 26" [Arabid 0.218 0.491 0.292 5e-11
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 8.2e-15, Sum P(2) = 8.2e-15
 Identities = 92/340 (27%), Positives = 156/340 (45%)

Query:    14 TPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNY 73
             T P+DF+CPI+  +  DP  + TGQTYER  IQ WI+ GN SCP T+QKL +  L   NY
Sbjct:   242 TIPEDFLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTP-NY 300

Query:    74 VLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCM 133
             VL+ LI+ W  +        H+       +   + NS  S   + G ++ ++  +  L  
Sbjct:   301 VLRSLISQWCTK--------HNIEQPGGYMNGRTKNSDGSFRDLSGDMSAIRALVCKLS- 351

Query:   134 SEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLL 193
             S+ + +   AV +I      +    D +I++++   I   V++L +  D    E  +  +
Sbjct:   352 SQSIEDRRTAVSEIRSL---SKRSTDNRILIAEAGAIPVLVKLLTSDGDTETQENAVTCI 408

Query:   194 SELGSRDKSVIHTLTRVESDVERIVALFKKGLLEA-----VVLIDL-LRPSTRTLIE--- 244
               L   + +    L  +   V  IV + + G +EA       L  L L    + +I    
Sbjct:   409 LNLSIYEHN--KELIMLAGAVTSIVLVLRAGSMEARENAAATLFSLSLADENKIIIGASG 466

Query:   245 --MDMMESLM--TVIKKKEED--FLKMCL----KPKSVS---VLLLGQMIGDSEESIVSS 291
               M +++ L   +V  KK+       +C+    K ++V    V  L +M+ DS    ++ 
Sbjct:   467 AIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAVRAGIVKPLVKMLTDSSSERMAD 526

Query:   292 IANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQED 331
              A TI+S      + S+  A+ A  R  A+  L+ C+Q+D
Sbjct:   527 EALTILSV-----LASNQVAKTAILRANAIPPLIDCLQKD 561


GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005871 "kinesin complex" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0019894 "kinesin binding" evidence=IEA
UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2032472 AT1G24330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010424 PUB45 "plant U-box 45" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014584 PUB43 "plant U-box 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012136 PUB26 "plant U-box 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query949
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-25
smart0050463 smart00504, Ubox, Modified RING finger domain 3e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-16
pfam0456473 pfam04564, U-box, U-box domain 1e-15
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-12
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-10
smart0032040 smart00320, WD40, WD40 repeats 6e-06
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 1e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-05
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 2e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  105 bits (263), Expect = 8e-25
 Identities = 73/313 (23%), Positives = 121/313 (38%), Gaps = 55/313 (17%)

Query: 642 KVLSNGHDSSADFWN--HRELVHVDSSENGKVLSIACFRD--KIFSGHSDGTIKVWTGRG 697
            + +   D +   W+    EL+       G V  +A   D   + SG SD TI++W    
Sbjct: 23  LLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLET 82

Query: 698 SILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQV-HDIKDQI 756
                ++ +  HT  V+ +A    G +L S S DKT +VW +   +  C+       D +
Sbjct: 83  G--ECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGK--CLTTLRGHTDWV 138

Query: 757 QNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEID 816
            ++A S                                        V    QDG I+  D
Sbjct: 139 NSVAFS--------------------PDGTF---------------VASSSQDGTIKLWD 163

Query: 817 LATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLP 876
           L TG      TGH         V+++          S+S DG  +K+W  S    +G+L 
Sbjct: 164 LRTGKCVATLTGHT------GEVNSVAFSPDGEKLLSSSSDGT-IKLWDLSTGKCLGTLR 216

Query: 877 T-LSEVRAMVVS--SELVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEF 933
              + V ++  S    L+  G + GT+ +WD +    ++TL  G +  V  +A   + + 
Sbjct: 217 GHENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLS-GHTNSVTSLAWSPDGKR 275

Query: 934 LVIGTSDGRIQAW 946
           L  G++DG I+ W
Sbjct: 276 LASGSADGTIRIW 288


Length = 289

>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 949
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0289506 consensus mRNA splicing factor [General function p 99.96
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.95
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.95
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.94
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.94
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.94
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.93
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.93
PTZ00421 493 coronin; Provisional 99.93
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
PTZ00420 568 coronin; Provisional 99.93
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.93
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.93
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.92
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.92
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.92
KOG1539 910 consensus WD repeat protein [General function pred 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.92
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG0283712 consensus WD40 repeat-containing protein [Function 99.92
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.91
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.91
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.91
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.91
KOG0294362 consensus WD40 repeat-containing protein [Function 99.91
PTZ00421 493 coronin; Provisional 99.91
PTZ00420 568 coronin; Provisional 99.91
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.9
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.9
KOG0300481 consensus WD40 repeat-containing protein [Function 99.9
KOG0293519 consensus WD40 repeat-containing protein [Function 99.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.9
KOG0641350 consensus WD40 repeat protein [General function pr 99.9
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.89
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.89
KOG0289506 consensus mRNA splicing factor [General function p 99.89
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.89
KOG2096420 consensus WD40 repeat protein [General function pr 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.88
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.88
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.88
KOG1539 910 consensus WD repeat protein [General function pred 99.88
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.87
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.87
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.87
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.87
KOG4283397 consensus Transcription-coupled repair protein CSA 99.87
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.87
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.86
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.86
KOG0646 476 consensus WD40 repeat protein [General function pr 99.86
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.86
KOG0643327 consensus Translation initiation factor 3, subunit 99.86
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.85
KOG2055514 consensus WD40 repeat protein [General function pr 99.85
KOG0270463 consensus WD40 repeat-containing protein [Function 99.85
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.85
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.84
KOG0300481 consensus WD40 repeat-containing protein [Function 99.84
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.84
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.84
KOG2048 691 consensus WD40 repeat protein [General function pr 99.84
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.84
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.84
KOG0267 825 consensus Microtubule severing protein katanin p80 99.83
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.83
KOG0639705 consensus Transducin-like enhancer of split protei 99.83
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.83
KOG4328498 consensus WD40 protein [Function unknown] 99.83
KOG1274 933 consensus WD40 repeat protein [General function pr 99.83
KOG1274 933 consensus WD40 repeat protein [General function pr 99.83
KOG0267 825 consensus Microtubule severing protein katanin p80 99.82
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.82
KOG1273405 consensus WD40 repeat protein [General function pr 99.81
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.81
KOG0639705 consensus Transducin-like enhancer of split protei 99.81
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.81
KOG0641350 consensus WD40 repeat protein [General function pr 99.81
KOG4283 397 consensus Transcription-coupled repair protein CSA 99.8
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.79
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.79
KOG2048 691 consensus WD40 repeat protein [General function pr 99.79
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.79
KOG2096 420 consensus WD40 repeat protein [General function pr 99.79
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.79
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.78
KOG0646476 consensus WD40 repeat protein [General function pr 99.78
KOG0302440 consensus Ribosome Assembly protein [General funct 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
KOG0302440 consensus Ribosome Assembly protein [General funct 99.77
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.76
KOG0270463 consensus WD40 repeat-containing protein [Function 99.76
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.75
KOG1188376 consensus WD40 repeat protein [General function pr 99.74
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.74
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.74
KOG2055514 consensus WD40 repeat protein [General function pr 99.73
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.73
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.72
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.72
KOG0649325 consensus WD40 repeat protein [General function pr 99.72
KOG1273405 consensus WD40 repeat protein [General function pr 99.71
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.71
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.7
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.7
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.7
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.69
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.69
KOG4227 609 consensus WD40 repeat protein [General function pr 99.69
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.69
COG2319466 FOG: WD40 repeat [General function prediction only 99.68
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.68
PRK11028330 6-phosphogluconolactonase; Provisional 99.68
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.66
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.65
COG2319 466 FOG: WD40 repeat [General function prediction only 99.65
KOG1963 792 consensus WD40 repeat protein [General function pr 99.65
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.65
KOG4328498 consensus WD40 protein [Function unknown] 99.63
KOG0649325 consensus WD40 repeat protein [General function pr 99.63
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.63
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.62
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.62
KOG0303472 consensus Actin-binding protein Coronin, contains 99.61
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.59
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.59
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.56
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.55
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.55
KOG0771398 consensus Prolactin regulatory element-binding pro 99.55
PRK01742429 tolB translocation protein TolB; Provisional 99.54
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.54
PRK11028330 6-phosphogluconolactonase; Provisional 99.53
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.52
KOG1334559 consensus WD40 repeat protein [General function pr 99.52
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.52
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.51
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.51
KOG0771398 consensus Prolactin regulatory element-binding pro 99.51
KOG1188376 consensus WD40 repeat protein [General function pr 99.5
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.5
PRK01742429 tolB translocation protein TolB; Provisional 99.49
KOG1963 792 consensus WD40 repeat protein [General function pr 99.48
KOG2110391 consensus Uncharacterized conserved protein, conta 99.47
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.46
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.45
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.43
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.42
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.41
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.38
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.37
KOG4227 609 consensus WD40 repeat protein [General function pr 99.36
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.36
PRK05137435 tolB translocation protein TolB; Provisional 99.36
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.35
PRK04922433 tolB translocation protein TolB; Provisional 99.35
PRK03629429 tolB translocation protein TolB; Provisional 99.35
PRK03629429 tolB translocation protein TolB; Provisional 99.35
KOG2139445 consensus WD40 repeat protein [General function pr 99.34
KOG1310 758 consensus WD40 repeat protein [General function pr 99.34
PRK04922433 tolB translocation protein TolB; Provisional 99.32
KOG2111346 consensus Uncharacterized conserved protein, conta 99.3
KOG2111346 consensus Uncharacterized conserved protein, conta 99.3
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.28
PRK05137435 tolB translocation protein TolB; Provisional 99.28
KOG2321 703 consensus WD40 repeat protein [General function pr 99.27
PRK02889427 tolB translocation protein TolB; Provisional 99.27
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.27
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.27
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.26
KOG2321 703 consensus WD40 repeat protein [General function pr 99.24
PRK02889427 tolB translocation protein TolB; Provisional 99.23
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 99.23
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.22
KOG2139 445 consensus WD40 repeat protein [General function pr 99.21
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.21
KOG1334 559 consensus WD40 repeat protein [General function pr 99.2
KOG1310 758 consensus WD40 repeat protein [General function pr 99.19
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.18
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.18
KOG1409404 consensus Uncharacterized conserved protein, conta 99.16
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.15
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.12
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.12
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.12
KOG2315 566 consensus Predicted translation initiation factor 99.09
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.09
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.08
PRK00178430 tolB translocation protein TolB; Provisional 99.07
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.07
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.06
KOG0287442 consensus Postreplication repair protein RAD18 [Re 99.06
PRK04792448 tolB translocation protein TolB; Provisional 99.05
PRK04792448 tolB translocation protein TolB; Provisional 99.04
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.04
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.04
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.04
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.01
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.01
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.01
KOG4547 541 consensus WD40 repeat-containing protein [General 99.01
PRK00178430 tolB translocation protein TolB; Provisional 99.0
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 99.0
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.97
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.97
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.94
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.93
KOG4547 541 consensus WD40 repeat-containing protein [General 98.93
PRK01029428 tolB translocation protein TolB; Provisional 98.92
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.9
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.9
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.89
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.88
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.88
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.87
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.87
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.87
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.86
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.85
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.85
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.84
KOG1409 404 consensus Uncharacterized conserved protein, conta 98.84
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.83
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.83
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
PF05804708 KAP: Kinesin-associated protein (KAP) 98.81
PRK01029428 tolB translocation protein TolB; Provisional 98.8
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.79
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.78
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.77
PHA02929238 N1R/p28-like protein; Provisional 98.73
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.72
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.71
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.7
KOG2314 698 consensus Translation initiation factor 3, subunit 98.68
COG4946668 Uncharacterized protein related to the periplasmic 98.66
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.65
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.64
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.64
COG4946 668 Uncharacterized protein related to the periplasmic 98.64
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.62
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.6
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.59
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.58
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.58
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.56
KOG2315 566 consensus Predicted translation initiation factor 98.55
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.55
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.54
PHA02926242 zinc finger-like protein; Provisional 98.53
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.52
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.52
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.51
PF1463444 zf-RING_5: zinc-RING finger domain 98.44
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.43
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.42
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.41
PRK04043419 tolB translocation protein TolB; Provisional 98.4
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.4
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.39
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.39
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.38
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.37
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.36
KOG2314 698 consensus Translation initiation factor 3, subunit 98.35
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.35
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.33
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.33
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.33
PF05804708 KAP: Kinesin-associated protein (KAP) 98.31
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.29
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.28
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.28
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.25
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.23
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.21
KOG2695425 consensus WD40 repeat protein [General function pr 98.21
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.21
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
COG5222427 Uncharacterized conserved protein, contains RING Z 98.18
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.17
PRK04043419 tolB translocation protein TolB; Provisional 98.17
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.17
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.16
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.15
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.12
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.11
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.1
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.03
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.03
KOG2660331 consensus Locus-specific chromosome binding protei 98.01
KOG0297391 consensus TNF receptor-associated factor [Signal t 98.0
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.0
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.98
KOG2695425 consensus WD40 repeat protein [General function pr 97.98
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.95
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.93
COG5152259 Uncharacterized conserved protein, contains RING a 97.92
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.91
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.91
KOG3621 726 consensus WD40 repeat-containing protein [General 97.9
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.82
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.82
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.82
KOG3621 726 consensus WD40 repeat-containing protein [General 97.8
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.8
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.76
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.71
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.7
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.7
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.69
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.68
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.65
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.64
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.52
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.52
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.51
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.47
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.46
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.45
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 97.44
PRK02888 635 nitrous-oxide reductase; Validated 97.38
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.37
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.32
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.29
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.29
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.26
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.25
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.25
KOG4367699 consensus Predicted Zn-finger protein [Function un 97.18
PRK02888 635 nitrous-oxide reductase; Validated 97.14
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.14
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.12
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.05
PRK09687280 putative lyase; Provisional 97.04
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.0
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.97
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.96
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.96
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.94
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.86
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.82
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.82
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.81
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.79
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.78
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.78
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.77
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.75
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.74
COG3391381 Uncharacterized conserved protein [Function unknow 96.73
PF04641260 Rtf2: Rtf2 RING-finger 96.71
KOG4199461 consensus Uncharacterized conserved protein [Funct 96.67
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 96.66
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.66
KOG2395 644 consensus Protein involved in vacuole import and d 96.58
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.57
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.54
PRK09687280 putative lyase; Provisional 96.52
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.5
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.48
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.4
PHA02713557 hypothetical protein; Provisional 96.4
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.4
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.39
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.39
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.34
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.33
COG5276370 Uncharacterized conserved protein [Function unknow 96.29
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.23
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.16
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.13
KOG4199461 consensus Uncharacterized conserved protein [Funct 96.07
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.07
COG3391381 Uncharacterized conserved protein [Function unknow 96.05
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.0
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.93
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 95.87
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.84
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.83
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.82
PHA02713557 hypothetical protein; Provisional 95.8
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.77
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.62
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.59
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 95.5
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.5
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.32
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.22
KOG2444238 consensus WD40 repeat protein [General function pr 95.21
KOG08251134 consensus PHD Zn-finger protein [General function 95.17
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 95.15
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.13
KOG2395644 consensus Protein involved in vacuole import and d 95.12
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.1
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.09
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 95.02
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.99
PRK13616591 lipoprotein LpqB; Provisional 94.98
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.98
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.95
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 94.89
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.85
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.79
KOG3113293 consensus Uncharacterized conserved protein [Funct 94.79
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 94.74
PRK13616591 lipoprotein LpqB; Provisional 94.69
KOG1048717 consensus Neural adherens junction protein Plakoph 94.65
PHA03098534 kelch-like protein; Provisional 94.65
KOG2444238 consensus WD40 repeat protein [General function pr 94.64
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 94.62
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.61
KOG1222791 consensus Kinesin associated protein KAP [Intracel 94.59
KOG1001674 consensus Helicase-like transcription factor HLTF/ 94.56
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.53
KOG18971096 consensus Damage-specific DNA binding complex, sub 94.47
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.43
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.41
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.32
KOG2979262 consensus Protein involved in DNA repair [General 94.32
KOG1048717 consensus Neural adherens junction protein Plakoph 94.17
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 94.11
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 94.11
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 94.02
COG5175480 MOT2 Transcriptional repressor [Transcription] 93.99
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.94
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 93.77
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 93.69
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.57
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 93.49
PHA03098534 kelch-like protein; Provisional 93.47
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 93.45
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.38
PHA02790480 Kelch-like protein; Provisional 93.31
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=8.8e-42  Score=347.95  Aligned_cols=305  Identities=20%  Similarity=0.303  Sum_probs=268.3

Q ss_pred             HhhHhhhccccccccccEEEEecCCCCeEEEecC--CceeeecCCCCceEEEEEeCC--EEEEEeCCCcEEEEecCCCce
Q 002234          625 KGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHR--ELVHVDSSENGKVLSIACFRD--KIFSGHSDGTIKVWTGRGSIL  700 (949)
Q Consensus       625 ~~~~~~~~~~~~~~~~~~l~s~s~dg~I~vWd~~--~~~~~~~~h~~~V~~l~~s~d--~lasgs~Dg~I~vWd~~t~~~  700 (949)
                      .+|.+.+-...|+++|.+|++|+.|.++|+||+.  +...+..+|...|.|++|+||  .||||+.||+|++||..+|+ 
T Consensus       112 ~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~-  190 (480)
T KOG0271|consen  112 AGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQ-  190 (480)
T ss_pred             CCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCC-
Confidence            4455666677888899999999999999999987  578889999999999999998  99999999999999999985 


Q ss_pred             eeeEEecccCCCEEEEEEec-----CCCEEEEEeCCCcEEEEECCCCeeEEEEeecCCCceeeeeeccceEEEEeCCCEE
Q 002234          701 HLIQQIREHTKAVTGLAILQ-----SGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGI  775 (949)
Q Consensus       701 ~~i~~l~~H~~~V~~v~fsp-----dg~~L~Sgs~Dg~I~vWd~~~~~~~~~~~~~~~~~v~~l~~~~~~~~fsp~g~~l  775 (949)
                      +....+.+|...|++++|.|     ..++|+|+|.||+|+|||+..+. .......|..+|+++.       |--+ .++
T Consensus       191 ~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~-~~~~lsgHT~~VTCvr-------wGG~-gli  261 (480)
T KOG0271|consen  191 QIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGT-CVRTLSGHTASVTCVR-------WGGE-GLI  261 (480)
T ss_pred             cccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCce-EEEEeccCccceEEEE-------EcCC-ceE
Confidence            56788999999999999976     46799999999999999999884 4455567788999987       3322 367


Q ss_pred             EEEEecCeEEEecC------------CCCceEEEEe-------------C-------------------------CEEEE
Q 002234          776 KVHLRNGKTKLLNS------------SKYPKCLALV-------------Q-------------------------GKVYC  805 (949)
Q Consensus       776 ~~~~~~g~i~~~~~------------~~~v~~v~~~-------------~-------------------------~~l~s  805 (949)
                      .+++.|+++++|+.            ...|+.++.+             +                         .++++
T Consensus       262 ySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVS  341 (480)
T KOG0271|consen  262 YSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVS  341 (480)
T ss_pred             EecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEE
Confidence            78888999999973            3456666654             1                         24999


Q ss_pred             EECCCcEEEEECCCCc-eeeeecccccccCCCCCEEEEEEeCCceEEEEEECCCCEEEEEECCCCeeEEeec-CCCcEEE
Q 002234          806 GCQDGAIQEIDLATGT-FATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGAAVKMWSTSNYNMVGSLP-TLSEVRA  883 (949)
Q Consensus       806 gs~Dg~I~iwd~~~~~-~~~~~~~~~~~~~h~~~V~~l~~~~~~~~l~s~s~Dg~~I~iwd~~~~~~~~~~~-~~~~v~~  883 (949)
                      |++|+++.+|+....+ ++      .++.+|..-|+.+.|+||+.|++++|.|. .|++||.++|+.+.+|. |-..|+.
T Consensus       342 gsDd~tlflW~p~~~kkpi------~rmtgHq~lVn~V~fSPd~r~IASaSFDk-SVkLW~g~tGk~lasfRGHv~~VYq  414 (480)
T KOG0271|consen  342 GSDDFTLFLWNPFKSKKPI------TRMTGHQALVNHVSFSPDGRYIASASFDK-SVKLWDGRTGKFLASFRGHVAAVYQ  414 (480)
T ss_pred             ecCCceEEEecccccccch------hhhhchhhheeeEEECCCccEEEEeeccc-ceeeeeCCCcchhhhhhhccceeEE
Confidence            9999999999987655 33      67889999999999999999999999995 99999999999999999 7899999


Q ss_pred             EEEcCC--EEEEEECCCeEEEEECCCCcEEEEeccccccceeEEEEeCCCCEEEEEeCCCcEEEEe
Q 002234          884 MVVSSE--LVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIGTSDGRIQAWG  947 (949)
Q Consensus       884 l~~s~d--~l~sgs~dg~I~vwd~~~~~~~~~l~~~h~~~I~~l~~spdg~~L~sgs~Dg~I~iWd  947 (949)
                      ++|+.|  .+++|+.|.+++|||+++.+....+ .||.+.|.++.|+|||..+++|+.|..+++|.
T Consensus       415 vawsaDsRLlVS~SkDsTLKvw~V~tkKl~~DL-pGh~DEVf~vDwspDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  415 VAWSADSRLLVSGSKDSTLKVWDVRTKKLKQDL-PGHADEVFAVDWSPDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             EEeccCccEEEEcCCCceEEEEEeeeeeecccC-CCCCceEEEEEecCCCceeecCCCceEEEeec
Confidence            999999  8999999999999999999999999 59999999999999999999999999999995



>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query949
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 4e-13
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 4e-08
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 5e-08
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 5e-06
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 5e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 5e-04
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure

Iteration: 1

Score = 73.9 bits (180), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Query: 16 PKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNYVL 75 P+ F CPI+ + DPV + TGQTYER +IQ+W++ G+ +CP +++ L L NYVL Sbjct: 6 PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-TPNYVL 64 Query: 76 KRLIASWQEQN 86 K LIA W E N Sbjct: 65 KSLIALWCESN 75
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query949
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.98
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.98
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.98
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.98
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.98
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.98
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.98
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.98
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.98
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.97
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.96
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.96
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.96
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.95
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.94
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.94
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.94
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.93
3jro_A 753 Fusion protein of protein transport protein SEC13 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.87
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.86
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.83
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.82
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.82
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.82
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.82
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.82
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.81
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.81
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.81
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.78
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.77
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.77
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.76
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.76
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.76
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.76
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.76
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.75
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.75
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.74
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.73
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.72
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.72
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.7
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.7
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.7
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.7
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.69
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.68
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.67
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.66
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.64
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.63
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.61
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.6
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.6
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.59
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.58
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.56
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.55
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.53
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.52
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.51
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.51
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.51
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.5
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.5
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.5
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.49
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.49
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.48
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.48
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.48
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.48
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.48
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.47
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.46
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.46
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.45
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.45
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.44
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.44
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.44
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.44
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.43
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.43
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.43
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.43
3nmz_A458 APC variant protein; protein-protein complex, arma 99.43
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.42
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.41
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.41
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.4
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.4
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.39
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.39
3nmz_A458 APC variant protein; protein-protein complex, arma 99.38
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.38
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.37
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.37
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.36
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.36
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.35
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.34
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.34
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.34
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.33
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.33
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.33
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.33
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.33
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.32
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.32
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.31
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.31
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.31
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.29
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.29
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.29
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.29
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.27
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.27
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.27
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.27
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.26
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.25
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.25
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.24
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.24
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.24
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.24
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.21
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.2
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.2
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.2
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.19
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.19
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.18
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.18
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.17
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.16
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.16
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.15
2ect_A78 Ring finger protein 126; metal binding protein, st 99.13
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.12
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.12
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.12
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.11
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.11
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.11
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.1
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.1
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.09
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.08
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.04
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.04
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.04
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.02
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.02
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.02
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.01
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.0
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.0
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.0
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.0
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.99
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.99
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.96
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.96
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.96
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.93
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.93
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.93
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.92
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.89
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.88
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.87
2qe8_A343 Uncharacterized protein; structural genomics, join 98.87
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.87
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.86
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.85
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.85
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.84
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.83
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.82
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.81
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.81
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.78
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.78
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.78
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.73
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.71
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.71
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.7
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.68
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.67
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.66
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.65
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.64
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.61
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.57
2ea5_A68 Cell growth regulator with ring finger domain prot 98.57
2qe8_A343 Uncharacterized protein; structural genomics, join 98.56
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.49
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.48
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.47
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.47
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.47
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.45
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.43
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.42
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.41
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.39
2ece_A462 462AA long hypothetical selenium-binding protein; 98.37
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.36
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.3
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.29
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.28
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.27
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.26
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.24
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.24
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.17
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.17
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.16
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.16
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.13
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.13
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.08
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.08
3grl_A651 General vesicular transport factor P115; vesicle t 98.07
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.04
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.02
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.0
3v65_B386 Low-density lipoprotein receptor-related protein; 97.97
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.9
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.83
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.79
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.74
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.73
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.71
3v65_B386 Low-density lipoprotein receptor-related protein; 97.68
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.65
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.61
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.61
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.51
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.5
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.45
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.36
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.32
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.28
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.28
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.27
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.26
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.24
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.23
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.18
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.16
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.12
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.07
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.06
3kya_A496 Putative phosphatase; structural genomics, joint c 97.0
3grl_A651 General vesicular transport factor P115; vesicle t 96.93
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.92
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.88
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.82
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.73
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.72
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.69
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.66
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.66
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.63
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.63
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.63
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.61
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.59
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.58
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.56
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.54
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.53
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.5
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.49
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.49
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.35
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.3
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.2
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.13
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.98
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.83
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 95.83
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.82
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 95.79
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.78
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.73
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 95.69
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.42
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.29
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.29
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.27
3ott_A 758 Two-component system sensor histidine kinase; beta 95.23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.16
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 94.95
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 94.95
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.33
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 94.21
3kya_A 496 Putative phosphatase; structural genomics, joint c 94.02
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 93.94
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 93.91
3ott_A 758 Two-component system sensor histidine kinase; beta 93.73
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.47
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.46
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.24
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.06
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 92.97
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 92.72
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 92.42
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 91.15
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 91.12
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 91.01
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 90.94
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 90.81
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 90.35
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 90.33
3nw0_A238 Non-structural maintenance of chromosomes element 89.69
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 89.69
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 89.36
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.36
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 88.73
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 88.36
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 88.18
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 87.91
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 85.88
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 85.59
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 85.2
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 83.47
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.28
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 83.1
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 82.63
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 82.46
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 82.45
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 80.62
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 80.19
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-37  Score=357.13  Aligned_cols=276  Identities=19%  Similarity=0.281  Sum_probs=244.9

Q ss_pred             hHhhhccccccccccEEEEecCCCCeEEEecC--CceeeecCCCCceEEEEEeCC--EEEEEeCCCcEEEEecCCCceee
Q 002234          627 LRELRKYSPLAFEMVKVLSNGHDSSADFWNHR--ELVHVDSSENGKVLSIACFRD--KIFSGHSDGTIKVWTGRGSILHL  702 (949)
Q Consensus       627 ~~~~~~~~~~~~~~~~l~s~s~dg~I~vWd~~--~~~~~~~~h~~~V~~l~~s~d--~lasgs~Dg~I~vWd~~t~~~~~  702 (949)
                      |...+....+.+++.++++|+.||+|++||..  .....+.+|.+.|++++|+|+  +|++|+.||+|++||+.++  ++
T Consensus       107 h~~~V~~~~~~p~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~~l~sgs~D~~i~iwd~~~~--~~  184 (410)
T 1vyh_C          107 HRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGF--EC  184 (410)
T ss_dssp             CSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETTSS--CE
T ss_pred             cCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCCEEEEEeCCCeEEEEeCCCC--ce
Confidence            44445566677889999999999999999987  467788999999999999996  9999999999999999998  78


Q ss_pred             eEEecccCCCEEEEEEecCCCEEEEEeCCCcEEEEECCCCeeEEEEeecCCCceeeeeeccceEEEEeCCCEEEEEEecC
Q 002234          703 IQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNG  782 (949)
Q Consensus       703 i~~l~~H~~~V~~v~fspdg~~L~Sgs~Dg~I~vWd~~~~~~~~~~~~~~~~~v~~l~~~~~~~~fsp~g~~l~~~~~~g  782 (949)
                      +.++.+|...|++++|+|++++|++|+.|++|++||+.++.. ......|...|.++.       |+|+|..        
T Consensus       185 ~~~~~~h~~~V~~v~~~p~~~~l~s~s~D~~i~~wd~~~~~~-~~~~~~h~~~v~~~~-------~~~~g~~--------  248 (410)
T 1vyh_C          185 IRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYC-VKTFTGHREWVRMVR-------PNQDGTL--------  248 (410)
T ss_dssp             EECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCE-EEEEECCSSCEEEEE-------ECTTSSE--------
T ss_pred             eEEEcCCCCCEEEEEEeCCCCEEEEEeCCCeEEEEECCCCcE-EEEEeCCCccEEEEE-------ECCCCCE--------
Confidence            999999999999999999999999999999999999999852 222335566677666       6777664        


Q ss_pred             eEEEecCCCCceEEEEeCCEEEEEECCCcEEEEECCCCceeeeecccccccCCCCCEEEEEEeCC---------------
Q 002234          783 KTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNG---------------  847 (949)
Q Consensus       783 ~i~~~~~~~~v~~v~~~~~~l~sgs~Dg~I~iwd~~~~~~~~~~~~~~~~~~h~~~V~~l~~~~~---------------  847 (949)
                                          +++|+.||+|++||+.++...      ..+.+|...|.+++|+|+               
T Consensus       249 --------------------l~s~s~D~~v~vwd~~~~~~~------~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~  302 (410)
T 1vyh_C          249 --------------------IASCSNDQTVRVWVVATKECK------AELREHRHVVECISWAPESSYSSISEATGSETK  302 (410)
T ss_dssp             --------------------EEEEETTSCEEEEETTTCCEE------EEECCCSSCEEEEEECCSCGGGGGGGCCSCC--
T ss_pred             --------------------EEEEcCCCeEEEEECCCCcee------eEecCCCceEEEEEEcCcccccchhhhcccccc
Confidence                                889999999999999999877      456778999999999986               


Q ss_pred             -----ceEEEEEECCCCEEEEEECCCCeeEEeec-CCCcEEEEEEcCC--EEEEEECCCeEEEEECCCCcEEEEeccccc
Q 002234          848 -----LVYTASTSLDGAAVKMWSTSNYNMVGSLP-TLSEVRAMVVSSE--LVYLGCKGGTVEIWDQKRQIRIETLQTGTS  919 (949)
Q Consensus       848 -----~~~l~s~s~Dg~~I~iwd~~~~~~~~~~~-~~~~v~~l~~s~d--~l~sgs~dg~I~vwd~~~~~~~~~l~~~h~  919 (949)
                           +.++++++.|+ +|++||++++.++..+. |...|.+++|+|+  ++++|+.||+|++||+.+++++.++ .+|.
T Consensus       303 ~~~~~g~~l~sgs~D~-~i~iwd~~~~~~~~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~~~~~~-~~h~  380 (410)
T 1vyh_C          303 KSGKPGPFLLSGSRDK-TIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTL-NAHE  380 (410)
T ss_dssp             -----CCEEEEEETTS-EEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEE-ECCS
T ss_pred             ccCCCCCEEEEEeCCC-eEEEEECCCCceEEEEECCCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCceEEEE-cCCC
Confidence                 66899999997 99999999999998887 7788999999998  8999999999999999999999999 4899


Q ss_pred             cceeEEEEeCCCCEEEEEeCCCcEEEEeC
Q 002234          920 GKVQCMALDDNEEFLVIGTSDGRIQAWGL  948 (949)
Q Consensus       920 ~~I~~l~~spdg~~L~sgs~Dg~I~iWdl  948 (949)
                      +.|++++|+|++++|++|+.||+|++|++
T Consensus       381 ~~v~~l~~~~~~~~l~sgs~D~~i~vW~~  409 (410)
T 1vyh_C          381 HFVTSLDFHKTAPYVVTGSVDQTVKVWEC  409 (410)
T ss_dssp             SCEEEEEECSSSSCEEEEETTSEEEEEC-
T ss_pred             CcEEEEEEcCCCCEEEEEeCCCcEEEEeC
Confidence            99999999999999999999999999996



>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 949
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 3e-18
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-13
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-13
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-12
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-07
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 6e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 9e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-04
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-08
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 9e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-06
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 3e-08
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 2e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.002
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.004
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.004
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 77.8 bits (191), Expect = 3e-18
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 11 GKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPK 70
          G    P+ F CPI+  +  DPV + TGQTYER +IQ+W++ G+ +CP +++ L    L  
Sbjct: 1  GSPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-T 59

Query: 71 TNYVLKRLIASWQEQN 86
           NYVLK LIA W E N
Sbjct: 60 PNYVLKSLIALWCESN 75


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query949
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.85
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.81
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.78
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.78
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.75
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.74
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.73
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.72
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.71
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.65
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.63
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.63
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.6
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.59
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.53
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.49
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.48
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.47
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.42
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.31
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.21
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.2
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.19
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.14
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.08
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.05
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.99
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.94
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.88
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.86
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.68
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.68
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.67
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.62
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.59
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.58
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.57
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.56
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.52
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.47
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.43
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.42
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.42
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.4
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.34
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.33
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.12
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.05
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.02
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.96
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.95
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.84
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.84
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.81
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.72
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.72
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.33
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.29
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.23
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.04
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.88
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.77
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.76
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.38
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 95.48
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 95.47
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.47
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.35
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.62
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.6
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.4
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.95
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 93.64
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 93.27
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 92.05
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.76
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.36
d1b3ua_588 Constant regulatory domain of protein phosphatase 90.94
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 90.82
d1b3ua_588 Constant regulatory domain of protein phosphatase 90.78
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 90.41
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 88.98
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.43
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 88.22
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 87.51
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.68
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 82.91
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 82.48
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.1e-34  Score=314.16  Aligned_cols=273  Identities=14%  Similarity=0.191  Sum_probs=235.6

Q ss_pred             hhhccccccccccEEEEecCCCCeEEEecCC-------ceeeecCCCCceEEEEEeCC--EEEEEeCCCcEEEEecCCCc
Q 002234          629 ELRKYSPLAFEMVKVLSNGHDSSADFWNHRE-------LVHVDSSENGKVLSIACFRD--KIFSGHSDGTIKVWTGRGSI  699 (949)
Q Consensus       629 ~~~~~~~~~~~~~~l~s~s~dg~I~vWd~~~-------~~~~~~~h~~~V~~l~~s~d--~lasgs~Dg~I~vWd~~t~~  699 (949)
                      ..+....+++++.+|++|+ ||.|+|||+.+       ......+|.+.|.+++|+|+  +|++|+.||+|++||+....
T Consensus        52 ~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~~~  130 (337)
T d1gxra_          52 EVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPT  130 (337)
T ss_dssp             SCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC-
T ss_pred             CcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecccccccccccccc
Confidence            3455667888999999987 89999999862       12234579999999999997  99999999999999998665


Q ss_pred             eeeeEEecccCCCEEEEEEecCCCEEEEEeCCCcEEEEECCCCeeEEEEeecCCCceeeeeeccceEEEEeCCCEEEEEE
Q 002234          700 LHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSIGNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHL  779 (949)
Q Consensus       700 ~~~i~~l~~H~~~V~~v~fspdg~~L~Sgs~Dg~I~vWd~~~~~~~~~~~~~~~~~v~~l~~~~~~~~fsp~g~~l~~~~  779 (949)
                      ......+.+|...|.++.|+|++.++++++.|+.|++||+.+++. ......+...+.++.       |++++..     
T Consensus       131 ~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~-~~~~~~~~~~v~~l~-------~s~~~~~-----  197 (337)
T d1gxra_         131 PRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTL-VRQFQGHTDGASCID-------ISNDGTK-----  197 (337)
T ss_dssp             -EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEE-EEEECCCSSCEEEEE-------ECTTSSE-----
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccc-------ccccccc-----
Confidence            567788889999999999999999999999999999999999853 233344566777766       6676654     


Q ss_pred             ecCeEEEecCCCCceEEEEeCCEEEEEECCCcEEEEECCCCceeeeecccccccCCCCCEEEEEEeCCceEEEEEECCCC
Q 002234          780 RNGKTKLLNSSKYPKCLALVQGKVYCGCQDGAIQEIDLATGTFATIQTGHRKLLGKANPVHALQVHNGLVYTASTSLDGA  859 (949)
Q Consensus       780 ~~g~i~~~~~~~~v~~v~~~~~~l~sgs~Dg~I~iwd~~~~~~~~~~~~~~~~~~h~~~V~~l~~~~~~~~l~s~s~Dg~  859 (949)
                                             +++|+.||.|++||+++++.+..       ..|..+|.+++|+|++.++++++.|+ 
T Consensus       198 -----------------------~~~~~~d~~v~i~d~~~~~~~~~-------~~~~~~i~~l~~~~~~~~l~~~~~d~-  246 (337)
T d1gxra_         198 -----------------------LWTGGLDNTVRSWDLREGRQLQQ-------HDFTSQIFSLGYCPTGEWLAVGMESS-  246 (337)
T ss_dssp             -----------------------EEEEETTSEEEEEETTTTEEEEE-------EECSSCEEEEEECTTSSEEEEEETTS-
T ss_pred             -----------------------cccccccccccccccccceeecc-------cccccceEEEEEcccccccceecccc-
Confidence                                   78899999999999999887643       24678999999999999999999986 


Q ss_pred             EEEEEECCCCeeEEeecCCCcEEEEEEcCC--EEEEEECCCeEEEEECCCCcEEEEeccccccceeEEEEeCCCCEEEEE
Q 002234          860 AVKMWSTSNYNMVGSLPTLSEVRAMVVSSE--LVYLGCKGGTVEIWDQKRQIRIETLQTGTSGKVQCMALDDNEEFLVIG  937 (949)
Q Consensus       860 ~I~iwd~~~~~~~~~~~~~~~v~~l~~s~d--~l~sgs~dg~I~vwd~~~~~~~~~l~~~h~~~I~~l~~spdg~~L~sg  937 (949)
                      .+++||++++.......|...|.+++|+|+  ++++|+.||.|++||..+++.+..+  +|.+.|++++|+||+++|++|
T Consensus       247 ~i~i~d~~~~~~~~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~--~~~~~v~~~~~s~d~~~l~t~  324 (337)
T d1gxra_         247 NVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQS--KESSSVLSCDISVDDKYIVTG  324 (337)
T ss_dssp             CEEEEETTSSCEEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEE--ECSSCEEEEEECTTSCEEEEE
T ss_pred             ccccccccccccccccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEc--cCCCCEEEEEEeCCCCEEEEE
Confidence            999999999998887789999999999998  8999999999999999999998887  478899999999999999999


Q ss_pred             eCCCcEEEEeC
Q 002234          938 TSDGRIQAWGL  948 (949)
Q Consensus       938 s~Dg~I~iWdl  948 (949)
                      +.||+|+||||
T Consensus       325 s~D~~I~vWdl  335 (337)
T d1gxra_         325 SGDKKATVYEV  335 (337)
T ss_dssp             ETTSCEEEEEE
T ss_pred             eCCCeEEEEEE
Confidence            99999999997



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure