Citrus Sinensis ID: 002386
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 929 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FNP1 | 1130 | Peroxisome biogenesis pro | yes | no | 0.980 | 0.806 | 0.580 | 0.0 | |
| O43933 | 1283 | Peroxisome biogenesis fac | yes | no | 0.345 | 0.250 | 0.365 | 2e-47 | |
| Q5BL07 | 1284 | Peroxisome biogenesis fac | yes | no | 0.343 | 0.248 | 0.355 | 2e-43 | |
| Q9HPF0 | 742 | Protein CdcH OS=Halobacte | yes | no | 0.342 | 0.428 | 0.332 | 1e-42 | |
| P46463 | 1157 | Peroxisome biosynthesis p | yes | no | 0.345 | 0.277 | 0.303 | 2e-42 | |
| P32794 | 780 | ATPase family gene 2 prot | yes | no | 0.347 | 0.414 | 0.330 | 5e-42 | |
| Q3UMC0 | 893 | Spermatogenesis-associate | no | no | 0.351 | 0.366 | 0.324 | 3e-41 | |
| Q8NB90 | 893 | Spermatogenesis-associate | no | no | 0.354 | 0.368 | 0.320 | 4e-41 | |
| Q54GX5 | 1227 | Peroxisome biogenesis fac | yes | no | 0.356 | 0.269 | 0.323 | 4e-40 | |
| O05209 | 745 | VCP-like ATPase OS=Thermo | yes | no | 0.342 | 0.426 | 0.316 | 2e-39 |
| >sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 996 bits (2576), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 540/930 (58%), Positives = 682/930 (73%), Gaps = 19/930 (2%)
Query: 1 MELE--VRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGA 58
ME E V V GV +CFVSLP +L+ L+ST S+ L +L +ELRS ++RW VAWSG+
Sbjct: 14 METEAVVNTVAGV-DCFVSLPRQLLHALQSTSSSPLP-PLLPVELRS-GDRRWSVAWSGS 70
Query: 59 TSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAE 118
+SSSS IE+AR FAE ISL D T+V+VRV+ NV KATLVT+EP TEDDWEVLELN+E AE
Sbjct: 71 SSSSSAIEIARVFAESISLPDGTVVKVRVLPNVPKATLVTVEPETEDDWEVLELNAELAE 130
Query: 119 AAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVK 178
AAIL+QVRI+HE M+FPLWLH RT+I F VVSTFP K VVQLVPGTEVAVAPKRR N+K
Sbjct: 131 AAILSQVRILHETMKFPLWLHDRTVIRFSVVSTFPSKGVVQLVPGTEVAVAPKRRDRNLK 190
Query: 179 KHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS 238
+ + N KALLRVQ++D H+ +VKG EL VALTS+A+I+PETA+ S
Sbjct: 191 AKKSQEKECNN-----VKALLRVQETDRSAFHEADVKGFELRVALTSIAYIHPETAKKHS 245
Query: 239 LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSV 298
L SL+L+++ PR+ K + ++ A +K++ SK G S+ KKE RQA++ L+FSD
Sbjct: 246 LESLQLISVSPRIPLKGSAKKDEALNMKNSEASKVAENGTSSAKKEPRQAILRLVFSDLA 305
Query: 299 AKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLE 358
AKGH+ + +LRLYL AGLHSWVYL+ C VN KEIP +SLSPC FK+ E +K G +
Sbjct: 306 AKGHLMMVESLRLYLGAGLHSWVYLRGCNVNEDKEIPALSLSPCVFKISENEKVLDKGTD 365
Query: 359 -LDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
L N N K + Y+D D S D ++ ALSSE E +NKKGLE
Sbjct: 366 RLGNNNSVRKSSHPPSGLSTYVDVVDWSVHDKVVTALSSEGLHDEGNHD----KNKKGLE 421
Query: 418 CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKT 477
L W LAQL A+AS G + ++L++ ET HFEV+G +S S N E+
Sbjct: 422 YLTRLWSLAQLDAMASVTGVDVSSLIVGRETFFHFEVRGLESYKSIDGQPSVNDRWESGK 481
Query: 478 KARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSF 537
K + EI V+T S+ESL G K Y+L+L+ R ++++N + + K+N G+ +
Sbjct: 482 KDKHTPLEILYVMTVSDESLLGDKFAGYDLSLD-RSEKSDNVVHIEPVLEKMNLGEPIYL 540
Query: 538 YTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHG 597
+ KE +G ++SSL+WMG SDVI R+ VLLSP +G+WFS + +P PGHILI+G
Sbjct: 541 KSAKETHCNKGVSPDISSLTWMGPIVSDVIKRMTVLLSPAAGMWFSKFKIPSPGHILIYG 600
Query: 598 PPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPS 657
PPGSGKT LA+A AK E KDL+AH++ V CS L+LEK I LS+ I+E L+HAPS
Sbjct: 601 PPGSGKTILARAAAKYFEEQKDLLAHVILVSCSTLALEKVQHIHHVLSSVIAEGLEHAPS 660
Query: 658 IVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ 717
++I D+LDSIISSSSD EG+Q S V LTKFL D++D+YGE R SSCGIGP+AFVAS Q
Sbjct: 661 VIILDDLDSIISSSSDTEGTQASVGVTMLTKFLTDVIDDYGEYRNSSCGIGPLAFVASVQ 720
Query: 718 SLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYD 777
SLE+IPQ+L+SSGRFDFHVQL APA SER AIL+HEIQ+R L+CS++ILL++A+KC+GYD
Sbjct: 721 SLEQIPQTLSSSGRFDFHVQLAAPATSERGAILKHEIQKRLLDCSEDILLNLAAKCEGYD 780
Query: 778 AYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAE 837
AYDLEILVDR VHAA+GR+L +S+ K+ LV++DF++AMH+F+PVAMRDITK+++E
Sbjct: 781 AYDLEILVDRAVHAAIGRHLPLESNISKY---NLVKEDFTRAMHDFVPVAMRDITKSASE 837
Query: 838 GGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGA 897
GGR GW+DVGG+TDI+NAIKEMIELPSKFP IFA++PLRLRSNVLLYGPPGCGKTHIVGA
Sbjct: 838 GGRLGWEDVGGVTDIKNAIKEMIELPSKFPKIFAKSPLRLRSNVLLYGPPGCGKTHIVGA 897
Query: 898 AAAACSLRFISVKGPELLNKYIGASEQAVR 927
AAAACSLRFISVKGPELLNKYIGASEQAVR
Sbjct: 898 AAAACSLRFISVKGPELLNKYIGASEQAVR 927
|
Involved in PTS1- and PTS2-dependent protein import into peroxisomes. May form heteromeric AAA ATPase complexes required for the import of proteins. Arabidopsis thaliana (taxid: 3702) |
| >sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 929 | ||||||
| 225465133 | 1134 | PREDICTED: peroxisome biogenesis protein | 0.995 | 0.815 | 0.686 | 0.0 | |
| 255553055 | 1137 | peroxisome biogenesis factor, putative [ | 0.991 | 0.810 | 0.674 | 0.0 | |
| 302143245 | 1114 | unnamed protein product [Vitis vinifera] | 0.974 | 0.812 | 0.678 | 0.0 | |
| 356521604 | 1130 | PREDICTED: peroxisome biogenesis protein | 0.986 | 0.810 | 0.612 | 0.0 | |
| 449487682 | 1123 | PREDICTED: peroxisome biogenesis protein | 0.968 | 0.801 | 0.573 | 0.0 | |
| 297806891 | 1122 | peroxisome biogenesis protein PEX1 [Arab | 0.983 | 0.814 | 0.586 | 0.0 | |
| 12006272 | 1119 | peroxisome biogenesis protein PEX1 [Arab | 0.980 | 0.814 | 0.580 | 0.0 | |
| 30682405 | 1130 | peroxisome 1 [Arabidopsis thaliana] gi|3 | 0.980 | 0.806 | 0.580 | 0.0 | |
| 9759341 | 1125 | unnamed protein product [Arabidopsis tha | 0.980 | 0.809 | 0.580 | 0.0 | |
| 242081873 | 1094 | hypothetical protein SORBIDRAFT_07g02447 | 0.946 | 0.803 | 0.477 | 0.0 |
| >gi|225465133|ref|XP_002273767.1| PREDICTED: peroxisome biogenesis protein 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1263 bits (3269), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 638/930 (68%), Positives = 752/930 (80%), Gaps = 5/930 (0%)
Query: 1 MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGATS 60
MEL VR VGG+E+CFVSLPL LI+TL+ST S LLP VL+LELRS +N WVVAWSG+ S
Sbjct: 1 MELAVRTVGGIESCFVSLPLPLIQTLQSTSSG-LLPPVLALELRSSNNDVWVVAWSGSAS 59
Query: 61 SSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAA 120
+SS IEVARQFAECISL DHT VQVR V+N+ KATLVTIEP TEDDWEVLELN+EHAEAA
Sbjct: 60 TSSSIEVARQFAECISLPDHTAVQVRAVANLPKATLVTIEPHTEDDWEVLELNAEHAEAA 119
Query: 121 ILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVKKH 180
IL Q+ IVHEAMRFPLWLHGRT ITF VVSTFPKK VVQLVPGTEVAVAPKRRK + H
Sbjct: 120 ILKQIGIVHEAMRFPLWLHGRTTITFLVVSTFPKKAVVQLVPGTEVAVAPKRRKKYLDSH 179
Query: 181 EDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVSLC 240
+++ +Q+ N+ IAKALLRVQDS + L HK VKGVELGV LT+V +I+PETA N S
Sbjct: 180 KNALVQSSNKDHPIAKALLRVQDSGQKLIHKSEVKGVELGVVLTNVVYIHPETARNYSFD 239
Query: 241 SLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSVAK 300
SL+LV ++PR SK N + + R KS T+KE S G + DKKE Q VV LL S+SVAK
Sbjct: 240 SLQLVILVPRSPSKGNYNDTDMFRKKSISTAKEFSDGLA-DKKEPCQVVVRLLISESVAK 298
Query: 301 GHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFG-IGLE- 358
GHV +A++LR YL GLHSWVY+K+C +NLKKEI ++SLSPC FKM EK+KA GLE
Sbjct: 299 GHVMMAQSLRHYLRTGLHSWVYMKRCDINLKKEISLLSLSPCQFKMFEKNKALEENGLEV 358
Query: 359 LDN-KNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
LD+ NHKTK ML +T+S YM+ D S ++ AALS E EDE+ Q ++KGL+
Sbjct: 359 LDSLTNHKTKSMLLETNSDTYMNISDWSTHEEFAAALSFESPGSEDEKTSSQSGSRKGLQ 418
Query: 418 CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALENKT 477
LL W LA L A+ SN G+E ++LV+ NETLLHF V K GT GK AS NG+ +N++
Sbjct: 419 SLLQAWFLAHLDAINSNAGTEIDSLVVGNETLLHFNVTSDKFGTLGKFQASSNGSSKNRS 478
Query: 478 KARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSF 537
+L EI +L SEES H GK NAYEL+ R ++NNN + L G L G+ VSF
Sbjct: 479 SYGDLSVEILYILAISEESQHSGKFNAYELSFPERNKRNNNLGNLELLVGNLRLGEPVSF 538
Query: 538 YTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHG 597
Y +KER S +GF SSLSW+GT ASD+INR+ LLSP SG+WFSTY+LPLPGH+LI+G
Sbjct: 539 YCMKERTSAKGFSLTASSLSWIGTAASDIINRLTTLLSPASGMWFSTYNLPLPGHVLIYG 598
Query: 598 PPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHAPS 657
PPGSGKT LA+ VAK+LE +DL+ HIVFV CS+L+LEK IRQALS+++S+ALDH PS
Sbjct: 599 PPGSGKTLLARTVAKALEEQEDLLTHIVFVSCSQLALEKAVTIRQALSSYLSDALDHVPS 658
Query: 658 IVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVASAQ 717
+VIFD+LD IISSSSD EGSQPSTSV ALT++L DI+DEYGEKRK+SCGIGP+AF+ASAQ
Sbjct: 659 LVIFDDLDLIISSSSDLEGSQPSTSVTALTEYLTDILDEYGEKRKNSCGIGPLAFIASAQ 718
Query: 718 SLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYD 777
SLE +PQSL+SSGRFDFHVQLPAPAA+ER AIL+HEIQ+RSL+C+D+IL DVASKCDGYD
Sbjct: 719 SLENVPQSLSSSGRFDFHVQLPAPAATERMAILKHEIQKRSLQCADDILSDVASKCDGYD 778
Query: 778 AYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAE 837
AYDLEILVDRT+HAA+GR+ S+S+F+K KPTLVRDDFSQAMHEFLPVAMRDITK+++E
Sbjct: 779 AYDLEILVDRTIHAAIGRFFPSNSAFDKSEKPTLVRDDFSQAMHEFLPVAMRDITKSASE 838
Query: 838 GGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGA 897
GGRSGW+DVGGL DI+NAIKEMIELPSKFP+IFAQ+PLRLRSNVLLYGPPGCGKTHIVGA
Sbjct: 839 GGRSGWEDVGGLVDIRNAIKEMIELPSKFPSIFAQSPLRLRSNVLLYGPPGCGKTHIVGA 898
Query: 898 AAAACSLRFISVKGPELLNKYIGASEQAVR 927
AAAACSLRFISVKGPELLNKYIGASEQAVR
Sbjct: 899 AAAACSLRFISVKGPELLNKYIGASEQAVR 928
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255553055|ref|XP_002517570.1| peroxisome biogenesis factor, putative [Ricinus communis] gi|223543202|gb|EEF44734.1| peroxisome biogenesis factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302143245|emb|CBI20540.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356521604|ref|XP_003529444.1| PREDICTED: peroxisome biogenesis protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449487682|ref|XP_004157748.1| PREDICTED: peroxisome biogenesis protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297806891|ref|XP_002871329.1| peroxisome biogenesis protein PEX1 [Arabidopsis lyrata subsp. lyrata] gi|297317166|gb|EFH47588.1| peroxisome biogenesis protein PEX1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|12006272|gb|AAG44817.1| peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30682405|ref|NP_196464.2| peroxisome 1 [Arabidopsis thaliana] gi|322967561|sp|Q9FNP1.2|PEX1_ARATH RecName: Full=Peroxisome biogenesis protein 1; AltName: Full=Peroxin-1; Short=AtPEX1 gi|332003924|gb|AED91307.1| peroxisome 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9759341|dbj|BAB09996.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|242081873|ref|XP_002445705.1| hypothetical protein SORBIDRAFT_07g024470 [Sorghum bicolor] gi|241942055|gb|EES15200.1| hypothetical protein SORBIDRAFT_07g024470 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 929 | ||||||
| TAIR|locus:2159557 | 1130 | PEX1 "peroxisome 1" [Arabidops | 0.978 | 0.804 | 0.567 | 5.5e-267 | |
| DICTYBASE|DDB_G0289867 | 1227 | pex1 "peroxisomal biogenesis f | 0.232 | 0.176 | 0.370 | 1.3e-56 | |
| MGI|MGI:1918632 | 1284 | Pex1 "peroxisomal biogenesis f | 0.388 | 0.281 | 0.329 | 2.2e-56 | |
| UNIPROTKB|O43933 | 1283 | PEX1 "Peroxisome biogenesis fa | 0.346 | 0.250 | 0.358 | 1.5e-55 | |
| RGD|1559939 | 1283 | Pex1 "peroxisomal biogenesis f | 0.346 | 0.250 | 0.341 | 2e-55 | |
| UNIPROTKB|E1BPU3 | 1281 | PEX1 "Uncharacterized protein" | 0.346 | 0.251 | 0.349 | 1e-53 | |
| UNIPROTKB|E1BY08 | 1290 | PEX1 "Uncharacterized protein" | 0.345 | 0.248 | 0.360 | 2.3e-53 | |
| UNIPROTKB|E2RLT2 | 1267 | PEX1 "Uncharacterized protein" | 0.346 | 0.254 | 0.343 | 2.4e-53 | |
| ZFIN|ZDB-GENE-070530-1 | 1237 | pex1 "peroxisome biogenesis fa | 0.340 | 0.255 | 0.354 | 3.9e-53 | |
| UNIPROTKB|E2RCK9 | 1416 | PEX1 "Uncharacterized protein" | 0.346 | 0.227 | 0.343 | 1.3e-51 |
| TAIR|locus:2159557 PEX1 "peroxisome 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2568 (909.0 bits), Expect = 5.5e-267, P = 5.5e-267
Identities = 529/932 (56%), Positives = 671/932 (71%)
Query: 1 MELE--VRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQRWVVAWSGA 58
ME E V V GV+ CFVSLP +L+ L+ST S+ L P +L +ELRS ++RW VAWSG+
Sbjct: 14 METEAVVNTVAGVD-CFVSLPRQLLHALQSTSSSPL-PPLLPVELRS-GDRRWSVAWSGS 70
Query: 59 TSSSSFIEVARQFAECISLADHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAE 118
+SSSS IE+AR FAE ISL D T+V+VRV+ NV KATLVT+EP TEDDWEVLELN+E AE
Sbjct: 71 SSSSSAIEIARVFAESISLPDGTVVKVRVLPNVPKATLVTVEPETEDDWEVLELNAELAE 130
Query: 119 AAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVVQLVPGTEVAVAPKRRKNNVK 178
AAIL+QVRI+HE M+FPLWLH RT+I F VVSTFP K VVQLVPGTEVAVAPKRR N+K
Sbjct: 131 AAILSQVRILHETMKFPLWLHDRTVIRFSVVSTFPSKGVVQLVPGTEVAVAPKRRDRNLK 190
Query: 179 KHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS 238
+ + N KALLRVQ++D H+ +VKG EL VALTS+A+I+PETA+ S
Sbjct: 191 AKKSQEKECNN-----VKALLRVQETDRSAFHEADVKGFELRVALTSIAYIHPETAKKHS 245
Query: 239 LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEISGGASTDKKECRQAVVHLLFSDSV 298
L SL+L+++ PR+ K + ++ A +K++ SK G S+ KKE RQA++ L+FSD
Sbjct: 246 LESLQLISVSPRIPLKGSAKKDEALNMKNSEASKVAENGTSSAKKEPRQAILRLVFSDLA 305
Query: 299 AKGHVKIARALRLYLNAGLHSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLE 358
AKGH+ + +LRLYL AGLHSWVYL+ C VN KEIP +SLSPC FK+ E +K G +
Sbjct: 306 AKGHLMMVESLRLYLGAGLHSWVYLRGCNVNEDKEIPALSLSPCVFKISENEKVLDKGTD 365
Query: 359 -LDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSEPSSKEDEEAVYQFENKKGLE 417
L N N K + Y+D D S D ++ ALSSE E +NKKGLE
Sbjct: 366 RLGNNNSVRKSSHPPSGLSTYVDVVDWSVHDKVVTALSSEGLHDEGNHD----KNKKGLE 421
Query: 418 CLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPA--SCNGALEN 475
L W LAQL A+AS G + ++L++ ET HFEV+G +S Y + S N E+
Sbjct: 422 YLTRLWSLAQLDAMASVTGVDVSSLIVGRETFFHFEVRGLES--YKSIDGQPSVNDRWES 479
Query: 476 KTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSV 535
K + EI V+T S+ESL G K Y+L+L+ R ++++N + + K+N G+ +
Sbjct: 480 GKKDKHTPLEILYVMTVSDESLLGDKFAGYDLSLD-RSEKSDNVVHIEPVLEKMNLGEPI 538
Query: 536 SFYTVKERGSTQGFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILI 595
+ KE +G ++SSL+WMG SDVI R+ VLLSP +G+WFS + +P PGHILI
Sbjct: 539 YLKSAKETHCNKGVSPDISSLTWMGPIVSDVIKRMTVLLSPAAGMWFSKFKIPSPGHILI 598
Query: 596 HGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPIIRQALSNFISEALDHA 655
+GPPGSGKT LA+A AK E KDL+AH++ V CS L+LEK I LS+ I+E L+HA
Sbjct: 599 YGPPGSGKTILARAAAKYFEEQKDLLAHVILVSCSTLALEKVQHIHHVLSSVIAEGLEHA 658
Query: 656 PSIVIFDNLXXXXXXXXXXXXXXXXXXVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVAS 715
PS++I D+L V LTKFL D++D+YGE R SSCGIGP+AFVAS
Sbjct: 659 PSVIILDDLDSIISSSSDTEGTQASVGVTMLTKFLTDVIDDYGEYRNSSCGIGPLAFVAS 718
Query: 716 AQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDG 775
QSLE+IPQ+L+SSGRFDFHVQL APA SER AIL+HEIQ+R L+CS++ILL++A+KC+G
Sbjct: 719 VQSLEQIPQTLSSSGRFDFHVQLAAPATSERGAILKHEIQKRLLDCSEDILLNLAAKCEG 778
Query: 776 YDAYDLEILVDRTVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTS 835
YDAYDLEILVDR VHAA+GR+L +S+ K+ LV++DF++AMH+F+PVAMRDITK++
Sbjct: 779 YDAYDLEILVDRAVHAAIGRHLPLESNISKY---NLVKEDFTRAMHDFVPVAMRDITKSA 835
Query: 836 AEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIV 895
+EGGR GW+DVGG+TDI+NAIKEMIELPSKFP IFA++PLRLRSNVLLYGPPGCGKTHIV
Sbjct: 836 SEGGRLGWEDVGGVTDIKNAIKEMIELPSKFPKIFAKSPLRLRSNVLLYGPPGCGKTHIV 895
Query: 896 GAAAAACSLRFISVKGPELLNKYIGASEQAVR 927
GAAAAACSLRFISVKGPELLNKYIGASEQAVR
Sbjct: 896 GAAAAACSLRFISVKGPELLNKYIGASEQAVR 927
|
|
| DICTYBASE|DDB_G0289867 pex1 "peroxisomal biogenesis factor 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918632 Pex1 "peroxisomal biogenesis factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43933 PEX1 "Peroxisome biogenesis factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1559939 Pex1 "peroxisomal biogenesis factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPU3 PEX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BY08 PEX1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RLT2 PEX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070530-1 pex1 "peroxisome biogenesis factor 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCK9 PEX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FNP1 | PEX1_ARATH | No assigned EC number | 0.5806 | 0.9806 | 0.8061 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00035546001 | SubName- Full=Chromosome undetermined scaffold_79, whole genome shotgun sequence; (1067 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 929 | |||
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 3e-39 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 3e-38 | |
| pfam09262 | 78 | pfam09262, PEX-1N, Peroxisome biogenesis factor 1, | 4e-27 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 6e-21 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 2e-18 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 2e-17 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 2e-17 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 1e-16 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 2e-15 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 5e-15 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 1e-13 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 2e-13 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 3e-12 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 4e-12 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 8e-11 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 5e-10 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 1e-09 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 2e-08 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 4e-08 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 7e-08 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 2e-07 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 5e-07 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 6e-07 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 2e-06 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 2e-06 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 4e-06 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 6e-06 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 1e-05 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 3e-05 | |
| PRK00080 | 328 | PRK00080, ruvB, Holliday junction DNA helicase Ruv | 6e-05 | |
| CHL00195 | 489 | CHL00195, ycf46, Ycf46; Provisional | 7e-05 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 9e-05 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 1e-04 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 1e-04 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 1e-04 | |
| pfam13481 | 154 | pfam13481, AAA_25, AAA domain | 1e-04 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 1e-04 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 2e-04 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 4e-04 | |
| COG2255 | 332 | COG2255, RuvB, Holliday junction resolvasome, heli | 5e-04 | |
| TIGR02928 | 365 | TIGR02928, TIGR02928, orc1/cdc6 family replication | 0.001 | |
| pfam07726 | 131 | pfam07726, AAA_3, ATPase family associated with va | 0.001 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 0.001 | |
| pfam05496 | 231 | pfam05496, RuvB_N, Holliday junction DNA helicase | 0.001 | |
| PRK12402 | 337 | PRK12402, PRK12402, replication factor C small sub | 0.002 | |
| COG0593 | 408 | COG0593, DnaA, ATPase involved in DNA replication | 0.003 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 0.003 | |
| TIGR00635 | 305 | TIGR00635, ruvB, Holliday junction DNA helicase, R | 0.004 | |
| pfam13238 | 128 | pfam13238, AAA_18, AAA domain | 0.004 |
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
Score = 156 bits (395), Expect = 3e-39
Identities = 110/356 (30%), Positives = 173/356 (48%), Gaps = 47/356 (13%)
Query: 590 PGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSLEKGPII--------R 641
P +L++GPPG+GKT LAKAVA A F+ + GP I
Sbjct: 212 PKGVLLYGPPGTGKTLLAKAVANE--------AGAYFISIN------GPEIMSKYYGESE 257
Query: 642 QALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKR 701
+ L EA ++APSI+ D +D+I + G + V+A L+ +MD G K
Sbjct: 258 ERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTG-EVEKRVVAQ---LLTLMD--GLK- 310
Query: 702 KSSCGIGPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLEC 761
G G + + + + + +L GRFD + + P RK IL+ + R++
Sbjct: 311 ----GRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILK--VHTRNMPL 364
Query: 762 SDEILLD-VASKCDGYDAYDLEILVDRTVHAAVGRYLHSDS-SFEKHIKPTLV------- 812
++++ LD +A G+ DL L AA+ R++ +FE P V
Sbjct: 365 AEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPAEVLKELKVT 424
Query: 813 RDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQ 872
DF +A+ P A+R++ E W D+GGL +++ ++E +E P K P IF +
Sbjct: 425 MKDFMEALKMVEPSAIREVL---VEVPNVRWSDIGGLEEVKQELREAVEWPLKHPEIFEK 481
Query: 873 APLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRR 928
+R VLL+GPPG GKT + A A FI+V+GPE+L+K++G SE+A+R
Sbjct: 482 MGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIRE 537
|
This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733 |
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|220158 pfam09262, PEX-1N, Peroxisome biogenesis factor 1, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222165 pfam13481, AAA_25, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|237090 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222000 pfam13238, AAA_18, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 929 | |||
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 100.0 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 100.0 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 100.0 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 100.0 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 100.0 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 100.0 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.98 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.97 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.97 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.97 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.97 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.97 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.97 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.97 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.97 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.97 | |
| PF09262 | 80 | PEX-1N: Peroxisome biogenesis factor 1, N-terminal | 99.96 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.96 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.96 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.96 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.96 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.96 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.96 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.95 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.95 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.95 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.95 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.95 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.95 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.94 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.94 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.94 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.93 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.93 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.92 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.92 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.92 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.91 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.9 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.86 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.86 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.86 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.85 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.8 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.8 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.8 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.77 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.76 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.76 | |
| PF09263 | 87 | PEX-2N: Peroxisome biogenesis factor 1, N-terminal | 99.75 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.74 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.74 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.73 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.72 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 99.71 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.71 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.71 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.7 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.7 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.7 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.66 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.63 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.63 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.62 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.61 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.61 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.61 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.6 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.58 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.58 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.57 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.56 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.55 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.55 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 99.52 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.51 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.49 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.49 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 99.49 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 99.48 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 99.48 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.48 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 99.48 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.47 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.47 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 99.47 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 99.47 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.46 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.46 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 99.46 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 99.45 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.45 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 99.45 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.44 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.44 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 99.44 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 99.44 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 99.43 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.43 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 99.42 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 99.42 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 99.42 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 99.41 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 99.41 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.41 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 99.41 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.4 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.39 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.39 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 99.39 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 99.39 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.39 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 99.39 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 99.39 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 99.39 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 99.39 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.39 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.38 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.38 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 99.38 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.38 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 99.37 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 99.37 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 99.36 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.36 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 99.36 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 99.36 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 99.35 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 99.35 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 99.35 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 99.35 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 99.34 | |
| PRK08727 | 233 | hypothetical protein; Validated | 99.34 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 99.34 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 99.33 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.32 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.32 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 99.31 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 99.31 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 99.3 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.3 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 99.29 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.29 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 99.29 | |
| PRK06620 | 214 | hypothetical protein; Validated | 99.27 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.26 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 99.25 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.25 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 99.25 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.24 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 99.24 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.24 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.23 | |
| PRK09087 | 226 | hypothetical protein; Validated | 99.23 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 99.21 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.21 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.2 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.2 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 99.19 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.18 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 99.18 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.18 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.16 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.16 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.16 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.14 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.13 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.12 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 99.11 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 99.11 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 99.07 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 99.06 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.06 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.05 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 99.05 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 98.98 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 98.98 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 98.97 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 98.97 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 98.96 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.95 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 98.94 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 98.94 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 98.93 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.92 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 98.92 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 98.92 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.91 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.89 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 98.88 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 98.87 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 98.86 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 98.86 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.85 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 98.85 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 98.84 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 98.83 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 98.83 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 98.83 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 98.82 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.82 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 98.81 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 98.81 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 98.79 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 98.78 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 98.77 | |
| PHA02244 | 383 | ATPase-like protein | 98.77 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 98.77 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 98.77 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 98.75 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.74 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.74 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 98.74 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.73 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 98.73 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 98.72 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 98.71 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 98.71 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 98.7 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 98.69 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 98.69 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 98.69 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 98.67 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 98.67 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 98.67 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 98.67 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 98.66 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 98.65 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 98.64 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 98.63 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 98.62 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 98.58 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 98.58 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 98.56 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 98.55 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 98.55 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 98.51 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 98.5 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 98.49 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 98.49 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 98.48 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.47 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 98.47 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 98.46 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 98.46 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 98.45 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.44 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.42 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.41 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 98.4 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 98.4 | |
| KOG2680 | 454 | consensus DNA helicase TIP49, TBP-interacting prot | 98.38 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 98.37 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 98.35 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 98.35 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.35 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 98.34 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 98.33 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.33 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 98.31 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 98.29 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.28 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 98.28 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 98.27 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 98.26 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 98.25 | |
| PF03152 | 176 | UFD1: Ubiquitin fusion degradation protein UFD1; I | 98.24 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 98.21 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 98.19 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 98.18 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.15 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 98.14 | |
| PRK08181 | 269 | transposase; Validated | 98.13 | |
| PRK12377 | 248 | putative replication protein; Provisional | 98.13 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 98.13 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 98.11 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 98.1 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.08 | |
| PRK06526 | 254 | transposase; Provisional | 98.05 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.04 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 98.04 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 98.03 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.03 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 98.03 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 98.02 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.01 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 97.99 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.99 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 97.99 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.98 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.98 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 97.97 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.97 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 97.95 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.95 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.91 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.9 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.89 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.87 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 97.86 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.82 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 97.82 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.81 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 97.8 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.8 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 97.79 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 97.78 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 97.75 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.74 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 97.74 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.74 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.72 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.69 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.69 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 97.68 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 97.68 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.67 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 97.66 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.65 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.65 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.65 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 97.65 | |
| PHA02244 | 383 | ATPase-like protein | 97.65 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 97.64 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 97.63 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.63 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.63 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.63 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.63 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 97.61 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.6 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.59 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.58 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 97.56 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 97.54 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.53 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.53 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.53 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.52 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 97.51 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.51 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.5 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 97.5 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.49 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.48 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.48 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.48 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 97.47 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.47 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 97.47 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.47 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.46 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.46 | |
| KOG1968 | 871 | consensus Replication factor C, subunit RFC1 (larg | 97.45 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.44 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.44 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.43 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.43 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.43 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.42 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.41 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.4 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.4 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.39 | |
| KOG0478 | 804 | consensus DNA replication licensing factor, MCM4 c | 97.39 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.39 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.39 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.38 | |
| KOG3595 | 1395 | consensus Dyneins, heavy chain [Cytoskeleton] | 97.37 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.37 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.36 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 97.36 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 97.35 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.34 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.33 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.33 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.31 | |
| PRK08181 | 269 | transposase; Validated | 97.31 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.31 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 97.29 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.29 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.29 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.28 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 97.28 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.27 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.27 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.27 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.26 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.26 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 97.26 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.24 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.24 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.24 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.24 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.23 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 97.22 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.22 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.21 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.2 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.2 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.19 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.19 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.19 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 97.17 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.16 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.15 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.15 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.15 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 97.15 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 97.13 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.13 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.12 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.12 | |
| PHA02624 | 647 | large T antigen; Provisional | 97.1 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 97.1 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.1 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.1 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.08 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.08 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.08 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 97.06 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.06 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.06 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.05 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.05 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.04 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.04 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 97.03 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 97.03 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.03 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 97.03 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.03 | |
| PRK06526 | 254 | transposase; Provisional | 97.03 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.03 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 97.01 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.0 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.0 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 96.99 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 96.99 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.98 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.98 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 96.98 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.97 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.97 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.97 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.97 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.96 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.96 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 96.95 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 96.95 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 96.94 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.91 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 96.91 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.9 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.9 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 96.9 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.89 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.89 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.88 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.88 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.87 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.87 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 96.86 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 96.85 | |
| KOG1808 | 1856 | consensus AAA ATPase containing von Willebrand fac | 96.85 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 96.85 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.85 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 96.85 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 96.83 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 96.83 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.82 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 96.82 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.82 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 96.81 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 96.81 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.79 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.78 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.78 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 96.78 | |
| KOG0480 | 764 | consensus DNA replication licensing factor, MCM6 c | 96.77 | |
| PHA02624 | 647 | large T antigen; Provisional | 96.76 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 96.75 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.75 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.75 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 96.75 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.75 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.74 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.74 |
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-105 Score=900.91 Aligned_cols=743 Identities=33% Similarity=0.470 Sum_probs=538.8
Q ss_pred CeEEEEEeCCccccceeCCHHHHHHHhhccccCCCCceEEEEEEeCCCC--eEEEEecCCcCCCCeeeecHhHHhhcCCC
Q 002386 1 MELEVRVVGGVENCFVSLPLKLIETLESTRSAHLLPQVLSLELRSRSNQ--RWVVAWSGATSSSSFIEVARQFAECISLA 78 (929)
Q Consensus 1 m~~~v~~~~~~~~~~v~lp~~l~~~l~~~~~~~~~~q~~~~e~~~~~~~--~~~~gw~g~~s~~~~iei~~~~a~~~gl~ 78 (929)
|++.|++.+ +|+||||||..++..+... .|+.+|+..|.+.. .+++-|.|..++.+.||||+++|+.|||.
T Consensus 3 ~a~vV~~~~-~r~cfv~lP~ql~~ai~~~------~~~~av~~v~~~~~~~~s~~~g~~s~~se~~ieIn~~~A~~l~L~ 75 (952)
T KOG0735|consen 3 MACVVNYKS-LRSCFVNLPEQLLEAISEP------VQNYAVQAVVSKNPIKKSWVFGHGSGSSENVIEINRVYAHTLGLA 75 (952)
T ss_pred ceEEEEeee-chhhhhccHHHHHHHHhcc------ccCceeEEEEcCCChhheeecccCCCCccceEEeehhhHhhccCC
Confidence 678899988 9999999999999999863 45688999887643 23333455555668999999999999999
Q ss_pred CCCEEEEEEeecCccceeEEEecCCcchhHHHHhcHHHHHHHHhcccceecCCCeEeEEecCceEEEEEEeccCCCCCeE
Q 002386 79 DHTIVQVRVVSNVLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVSTFPKKPVV 158 (929)
Q Consensus 79 ~~~~v~~~~~~~~~~~~~v~veP~t~dDWEi~el~a~~le~~lL~Q~r~v~~~~~~~~~~~~~~~~~~~v~~~~p~~~~~ 158 (929)
+|+.|.++++.+++.|++|+|||+|+|||||||+||+.+|.+||+|+|||++ ++||+|++++|+|+|+|+++.|++.||
T Consensus 76 e~~~V~l~~~~~v~~~~~V~VeP~TsdDWEIiElnA~~~e~~lL~Q~RIv~~-~~f~iwl~~~t~i~fqv~rl~Ps~~~g 154 (952)
T KOG0735|consen 76 ENQEVKLSIIDHVHEATQVEVEPVTSDDWEIIELNAEWLEENLLVQTRIVTP-EIFIIWLPSGTVIQFQVDRLIPSMLYG 154 (952)
T ss_pred CCCeEEEEEcCCccceeEEEEeeccCccHHHHHhhHHHHhhhhhhheeeccc-ceeEEEEcCccEEEEEEeeeeccccee
Confidence 9999999999999999999999999999999999999999999999999999 999999999999999999999999999
Q ss_pred EecCCCeEEEcccCCCCCCcccccchhhccCCccccccceeeeccCCCCcccccccCCceeeeeccceEEeCCCcccccc
Q 002386 159 QLVPGTEVAVAPKRRKNNVKKHEDSYMQAFNESTSIAKALLRVQDSDEGLSHKCNVKGVELGVALTSVAFINPETAENVS 238 (929)
Q Consensus 159 ~l~~~tev~vaPk~r~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~ 238 (929)
||.++|||+||||+|+...+.+++.....+... +..+|.- .....++|..+.....++||| +++...+
T Consensus 155 Rl~~~Tev~VaPK~~k~~l~~~~~g~~e~n~lk----s~~lr~~------~lrs~v~~~~~p~~n~s~vyi--~~aql~t 222 (952)
T KOG0735|consen 155 RLLRGTEVLVAPKPNKSALNVKENGVIEENTLK----SRSLRKV------QLRSVVEGRLLPDSNSSTVYI--NTAQLVT 222 (952)
T ss_pred eecCCceEEEecCcccchhhhhcccchhhhhhh----hhhhhhh------hhhhheecccccCcccceeee--cccccee
Confidence 999999999999999988654332222211111 0112211 234457788888878889998 3332222
Q ss_pred ccceeEEEeccCCCCCCCCCCCCCcccCCcccccccc-CCCcccccccceeEEEEEeecccccCceeecHHHHHHhcccc
Q 002386 239 LCSLELVAILPRLSSKENNPENNAPRIKSNLTSKEIS-GGASTDKKECRQAVVHLLFSDSVAKGHVKIARALRLYLNAGL 317 (929)
Q Consensus 239 ~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~l~~~l~~~~ 317 (929)
.+....+++...++. .+ +.+ ..+ .|. ...+-+-..++|...+|..|.+++.++|.++.+.+
T Consensus 223 ---~q~~~~~~k~~Lr~s---sr-----~d~---~~~~~g~----~~Skvv~~~~~c~~q~P~~H~ai~~~l~~~~~tpe 284 (952)
T KOG0735|consen 223 ---AQGPALSVKLPLRQS---SR-----SDE---VYNDGGN----LKSKVVEQDVVCPKQIPEFHFAISKSLWLSYSTPE 284 (952)
T ss_pred ---ccCceeeeeccccCC---cc-----chh---HhhccCc----chhhhhcccccCCCCCCcceeeEehhHHHhhcCCc
Confidence 222233334433321 00 000 001 111 11122233367777889999999999999998420
Q ss_pred cceEEEEeccccccCCCCeeeeccceeeeccccccccccccccccccccccccccccCCccccCCCCcchhhHHhhhcCC
Q 002386 318 HSWVYLKKCTVNLKKEIPMVSLSPCHFKMLEKDKAFGIGLELDNKNHKTKKMLEKTSSGIYMDDGDLSAEDDIIAALSSE 397 (929)
Q Consensus 318 ~~~v~~~~~~~~~~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 397 (929)
+ . + +.+.++ ..|..++.+..+++
T Consensus 285 -----------~-----------d--i-------k~~l~~------------------------~iw~~~n~i~~~~~-- 307 (952)
T KOG0735|consen 285 -----------D-----------D--I-------KTGLKF------------------------VIWNLNNPISSSKF-- 307 (952)
T ss_pred -----------c-----------c--h-------hcCcee------------------------eeeccccchhhhhh--
Confidence 0 0 1 111111 11222211111110
Q ss_pred CCCcchhHHH--H-hhhhhhhHHHHHHHHHHHHhhhhhcccCccccccccCCCceeEEEEeccccCcCCCCCCCccccch
Q 002386 398 PSSKEDEEAV--Y-QFENKKGLECLLHTWLLAQLTAVASNIGSEFNTLVLSNETLLHFEVKGYKSGTYGKVPASCNGALE 474 (929)
Q Consensus 398 ~~~~~~~~~~--~-~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 474 (929)
.++.. | .-+.++++. ..|.+. +..+++++.+ ++.+|++....++.....+..++..+.
T Consensus 308 -----i~~l~~vg~p~~tkk~l~--------~eL~A~----~~~ts~li~~--t~k~~~ie~~es~~~l~nq~eV~~~w~ 368 (952)
T KOG0735|consen 308 -----IEELKRVGLPDETKKNLS--------SELVAA----KLKTSYLIDG--TLKLFEIEVLESVSSLSNQEEVVRLWD 368 (952)
T ss_pred -----hHHHHhccCCcccccchh--------Hhhhhh----hhccccccCC--ceEEEEeeccccccccccchHHhhHHH
Confidence 00000 0 001222222 122221 2334566665 778888875332222222223333333
Q ss_pred hhhhhcccccceeeeeccccccccCCCCcchhhhHHhhccCCCchHHHHHHhcccCCCCceeeeeecccCccCCcccccc
Q 002386 475 NKTKARELRTEIFCVLTFSEESLHGGKNNAYELTLEARGQQNNNTEAVRQLFGKLNSGDSVSFYTVKERGSTQGFDSNVS 554 (929)
Q Consensus 475 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~~~~~~s~~~~~~~~~~~~~~~~~~ 554 (929)
+...-+..+.|..+.-.+..+.+.|.|...+.+. ...++..|
T Consensus 369 q~~vt~~~~~ei~~~~~v~~~~~~g~K~~~~~l~---------------------------------~~~~e~d~----- 410 (952)
T KOG0735|consen 369 QLKVTKMPPLEIKITSDVNLPVLAGIKENSPDLV---------------------------------MSPFEHDF----- 410 (952)
T ss_pred hhccccCCchheeeeeeecchhhhcchhcCcccc---------------------------------cCcCCCce-----
Confidence 2221122233333333333332222221111000 00001111
Q ss_pred ccccchhHHHHHHHHHHHhcCCCchhhhhhcCCCCCceEEEECCCCcHHHHHHHHHHHHhccCccceeeEEEEecccccc
Q 002386 555 SLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCCSRLSL 634 (929)
Q Consensus 555 ~l~g~~~~~~~i~~~l~~ll~~~~~~~~~~~~~~~~~~vLL~GppGtGKTtLaralA~~L~~~~~~~~~~~~V~~s~L~~ 634 (929)
.-....+++..+ ..++| +..++++||+||+|||||.|++++++++. ....+|+.+++|+.+.+
T Consensus 411 --i~~~s~kke~~n---~~~sp----------v~~~~~Ill~G~~GsGKT~L~kal~~~~~--k~~~~hv~~v~Cs~l~~ 473 (952)
T KOG0735|consen 411 --IQVPSYKKENAN---QELSP----------VFRHGNILLNGPKGSGKTNLVKALFDYYS--KDLIAHVEIVSCSTLDG 473 (952)
T ss_pred --eecchhhhhhhh---hhccc----------ccccccEEEeCCCCCCHhHHHHHHHHHhc--cccceEEEEEechhccc
Confidence 111112222211 22232 44567899999999999999999999986 33459999999999999
Q ss_pred CchhhHHHHHHHHHHHHHhcCCcEEEEccccccccCCCCCCCCCCchhHHHHHHHHHHHHHHhcccccCccCCCcEEEEE
Q 002386 635 EKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGPIAFVA 714 (929)
Q Consensus 635 ~~~~~~~~~l~~~f~~a~~~~PsVL~LDEiD~L~~~~~~~~~~~~~~~~~~l~~~L~~~ld~~~~~~~~~~~~~~VivIa 714 (929)
...+.+.+.+..+|.+|.|++|+|++|||+|.|++ .++.++++......++..++.+.++.+...+. .+.+||
T Consensus 474 ~~~e~iQk~l~~vfse~~~~~PSiIvLDdld~l~~-~s~~e~~q~~~~~~rla~flnqvi~~y~~~~~------~ia~Ia 546 (952)
T KOG0735|consen 474 SSLEKIQKFLNNVFSEALWYAPSIIVLDDLDCLAS-ASSNENGQDGVVSERLAAFLNQVIKIYLKRNR------KIAVIA 546 (952)
T ss_pred hhHHHHHHHHHHHHHHHHhhCCcEEEEcchhhhhc-cCcccCCcchHHHHHHHHHHHHHHHHHHccCc------EEEEEE
Confidence 99999999999999999999999999999999996 44556667777888899999888888775543 489999
Q ss_pred ecCCCCccccccccCCCcceEeeCCCCcHHHHHHHHHHHHhhcccccCHHHHHHHHhhcCCCChhhHHHHHHHHHHHHhh
Q 002386 715 SAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTVHAAVG 794 (929)
Q Consensus 715 ttn~~~~L~~~L~~~~Rf~~~i~l~~Pd~~eR~~IL~~~l~~~~~~~~d~~l~~LA~~teG~s~~DL~~Lv~~A~~~a~~ 794 (929)
+.+....+++.|.++++|+.++.+++|+..+|.+||+..+++....+..++++.++..|+||.+.||..+++||+|.|+.
T Consensus 547 t~qe~qtl~~~L~s~~~Fq~~~~L~ap~~~~R~~IL~~~~s~~~~~~~~~dLd~ls~~TEGy~~~DL~ifVeRai~~a~l 626 (952)
T KOG0735|consen 547 TGQELQTLNPLLVSPLLFQIVIALPAPAVTRRKEILTTIFSKNLSDITMDDLDFLSVKTEGYLATDLVIFVERAIHEAFL 626 (952)
T ss_pred echhhhhcChhhcCccceEEEEecCCcchhHHHHHHHHHHHhhhhhhhhHHHHHHHHhcCCccchhHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999876666667777899999999999999999999999984
Q ss_pred ccccCCccccccccccccccccccccccccccccccccccccCCCCCccCCCCCchhhHHHHHHHHhcCCCchhhhhhCC
Q 002386 795 RYLHSDSSFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELPSKFPNIFAQAP 874 (929)
Q Consensus 795 r~~~~~~~~~~~~~~~lt~edf~~al~~~~P~slr~v~l~~~~~~~~~w~dIgGL~~vk~~L~e~le~p~k~~~if~~~~ 874 (929)
.... ... ..++.++|.++|++|.|.+||++++.++. +.+|+|||||.++|+.|+|+++||.|||.+|++||
T Consensus 627 eris------~~~-klltke~f~ksL~~F~P~aLR~ik~~k~t--gi~w~digg~~~~k~~l~~~i~~P~kyp~if~~~p 697 (952)
T KOG0735|consen 627 ERIS------NGP-KLLTKELFEKSLKDFVPLALRGIKLVKST--GIRWEDIGGLFEAKKVLEEVIEWPSKYPQIFANCP 697 (952)
T ss_pred HHhc------cCc-ccchHHHHHHHHHhcChHHhhhccccccC--CCCceecccHHHHHHHHHHHHhccccchHHHhhCC
Confidence 4321 112 37999999999999999999999999997 58999999999999999999999999999999999
Q ss_pred CCCCceeEEecCCCCcHHHHHHHHHHHcCCceEEEecccccccccChhhHHHhh
Q 002386 875 LRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRR 928 (929)
Q Consensus 875 lr~~sGiLLyGpPGtGKT~LA~alA~e~glnfIsVkg~ELl~kyIG~SEq~VRd 928 (929)
+|+++|||||||||||||.||+|+|..|+++||+|||||||+||||+|||+|||
T Consensus 698 lr~~~giLLyGppGcGKT~la~a~a~~~~~~fisvKGPElL~KyIGaSEq~vR~ 751 (952)
T KOG0735|consen 698 LRLRTGILLYGPPGCGKTLLASAIASNSNLRFISVKGPELLSKYIGASEQNVRD 751 (952)
T ss_pred cccccceEEECCCCCcHHHHHHHHHhhCCeeEEEecCHHHHHHHhcccHHHHHH
Confidence 999999999999999999999999999999999999999999999999999997
|
|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09262 PEX-1N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015342 This domain adopts a double psi beta-barrel fold, similar in structure to the Cdc48 N-terminal domain | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PF09263 PEX-2N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015343 This domain adopts a Cdc48 domain 2-like fold, with a beta-alpha-beta(3) arrangement | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 929 | ||||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 1e-32 | ||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 1e-13 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 2e-32 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 1e-13 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 3e-18 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 1e-16 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 7e-15 | ||
| 1wlf_A | 179 | Structure Of The N-Terminal Domain Of Pex1 Aaa-Atpa | 1e-14 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-14 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 9e-14 | ||
| 2qp9_X | 355 | Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | 1e-13 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 1e-13 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 1e-13 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 1e-13 | ||
| 3eih_A | 340 | Crystal Structure Of S.Cerevisiae Vps4 In The Prese | 1e-13 | ||
| 3eie_A | 322 | Crystal Structure Of S.Cerevisiae Vps4 In The So4-B | 2e-13 | ||
| 2rko_A | 331 | Crystal Structure Of The Vps4p-Dimer Length = 331 | 2e-13 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 2e-12 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-12 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 5e-12 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 2e-11 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 3e-11 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 7e-11 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-10 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 4e-10 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 5e-10 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 6e-08 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 1e-07 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 6e-08 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 2e-07 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 6e-07 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 2e-06 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 2e-06 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 3e-06 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 3e-06 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 7e-06 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 2e-05 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 3e-05 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 6e-05 |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
|
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|1WLF|A Chain A, Structure Of The N-Terminal Domain Of Pex1 Aaa-Atpase: Characterization Of A Putative Adaptor-Binding Domain Length = 179 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 | Back alignment and structure |
| >pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 | Back alignment and structure |
| >pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Length = 179 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 340 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 323 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 354 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 353 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Length = 350 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 929 | |||
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 100.0 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 100.0 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 100.0 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 100.0 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 100.0 | |
| 1wlf_A | 179 | PEX1, peroxisome biogenesis factor 1; N-terminal d | 100.0 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 100.0 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 100.0 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 100.0 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 100.0 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.97 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.96 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.96 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.95 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.95 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.95 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.95 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.94 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.94 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.94 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.94 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.93 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.92 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.92 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.92 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.91 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.91 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.9 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.9 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.89 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.89 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.88 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.86 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.84 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.83 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.83 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.82 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.82 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.81 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.81 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.73 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.71 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.7 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.69 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.68 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.68 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.67 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.63 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.63 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.63 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.61 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.61 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.61 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.6 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.59 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.58 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.58 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.58 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.58 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.58 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.57 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.55 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.55 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.54 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.53 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.52 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.51 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.51 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.51 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.5 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.5 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.49 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.49 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.48 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.47 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.47 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.47 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.47 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.46 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.46 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.45 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.45 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.45 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.44 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.43 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.42 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.4 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.4 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.4 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.38 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 99.38 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.37 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.36 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.36 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.36 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.36 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.36 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.34 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 99.31 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 99.3 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.28 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.28 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 99.25 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.24 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.23 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.18 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.17 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 99.17 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.17 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.15 | |
| 2yuj_A | 190 | Ubiquitin fusion degradation 1-like; ubiquitin-dep | 99.11 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.08 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.08 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.06 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.02 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 99.01 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.99 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 98.96 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 98.96 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 98.91 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.9 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.77 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.67 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 98.66 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 98.61 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.61 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.58 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 98.57 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.56 | |
| 3tiw_A | 187 | Transitional endoplasmic reticulum ATPase; beta-ba | 98.56 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.55 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.53 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.51 | |
| 1cz4_A | 185 | VCP-like ATPase; double-PSI beta-barrel, beta-CLAM | 98.51 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 98.5 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 98.47 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 98.38 | |
| 3qwz_A | 211 | Transitional endoplasmic reticulum ATPase; UBX, P9 | 98.37 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 98.36 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.34 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.34 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 98.3 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.29 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 98.28 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 98.28 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 98.27 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 98.26 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.24 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.23 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 98.17 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 98.17 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 98.08 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.05 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 98.04 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.04 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.98 | |
| 1zc1_A | 208 | Ubiquitin fusion degradation protein 1; UFD1, doub | 97.98 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.94 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.92 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.9 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.87 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.87 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.85 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.82 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.81 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.8 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.76 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 97.75 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.74 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.73 | |
| 2dzn_B | 82 | 26S protease regulatory subunit 6B homolog; ankyri | 97.71 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.66 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.66 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.66 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.63 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.63 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.6 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.59 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.57 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.56 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.55 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.54 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.53 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.51 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.51 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.5 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.48 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.48 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.43 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.39 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.38 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.35 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.33 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.33 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.3 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.3 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.27 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.27 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.26 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 97.24 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.23 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.23 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.22 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.2 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.19 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.17 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 97.17 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 97.16 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.16 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.16 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 97.14 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.09 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 97.05 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.05 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.02 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 97.01 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.0 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.99 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.96 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.92 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.91 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.9 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.89 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.87 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 96.86 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.86 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.86 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.79 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.79 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.78 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.78 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.78 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.76 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.73 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.73 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.73 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.72 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.69 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.66 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.63 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.62 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.61 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.61 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.57 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.57 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.53 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.53 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.5 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.47 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 96.47 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.46 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.46 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.46 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.45 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.45 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.42 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.42 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.4 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.4 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.4 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.38 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.37 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.34 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.34 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.31 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.3 | |
| 2jv2_A | 83 | Putative uncharacterized protein PH1500; AAA ATPas | 96.23 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.23 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.19 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 96.19 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.15 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.13 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.13 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.12 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 96.11 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.1 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.09 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.08 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.07 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.05 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.04 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.02 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.01 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.01 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.01 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.0 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.97 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.97 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 95.95 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 95.95 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 95.94 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.92 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 95.91 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 95.91 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 95.91 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 95.9 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.88 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 95.87 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 95.85 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.84 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 95.84 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 95.83 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 95.81 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.81 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 95.81 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.79 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 95.79 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.79 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 95.78 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 95.75 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 95.74 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.74 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 95.72 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 95.72 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 95.7 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 95.68 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.67 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.66 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.66 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 95.66 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 95.65 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.65 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 95.64 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 95.64 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.63 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.58 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 95.58 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 95.57 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 95.57 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 95.55 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 95.54 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.53 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 95.5 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 95.5 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 95.47 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 95.47 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 95.47 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 95.45 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.42 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 95.42 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.41 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.4 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.36 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.36 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 95.35 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 95.29 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.27 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.26 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.25 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.23 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 95.23 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 95.22 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.22 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.22 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.2 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.16 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 95.16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 95.15 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.15 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.15 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 95.14 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.12 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.12 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 95.09 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.09 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.07 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.07 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.06 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 95.06 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.05 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.04 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 95.03 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.02 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.02 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 95.02 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 95.0 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.0 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 94.99 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 94.99 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 94.91 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.9 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 94.85 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.82 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.8 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.77 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 94.76 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.76 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.74 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.73 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 94.73 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.72 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 94.69 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.69 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.68 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.67 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.67 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.67 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 94.64 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.64 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 94.61 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 94.61 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.58 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.56 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 94.56 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 94.52 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 94.48 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.47 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.45 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.44 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 94.41 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.38 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 94.37 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.36 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.34 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 94.3 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 94.28 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.28 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.25 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.24 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.24 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 94.24 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.24 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 94.23 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 94.17 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 94.11 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 94.1 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 94.09 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 94.08 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 94.08 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.01 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.0 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 94.0 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 93.98 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 93.95 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 93.94 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 93.92 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 93.91 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 93.89 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 93.89 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 93.88 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.87 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 93.84 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 93.84 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 93.81 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.77 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.76 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.74 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.74 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.74 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 93.69 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 93.66 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 93.64 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.61 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 93.57 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 93.55 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.53 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 93.5 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 93.47 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 93.44 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 93.43 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 93.4 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.35 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 93.35 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.34 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 93.33 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 93.32 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.26 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 93.22 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.16 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.12 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 93.11 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 93.07 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.01 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 92.95 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.93 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 92.92 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 92.91 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 92.9 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 92.89 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 92.86 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 92.81 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.77 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 92.76 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 92.71 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 92.68 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 92.63 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 92.62 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 92.62 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.62 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 92.61 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 92.6 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 92.59 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.53 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.52 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 92.51 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 92.48 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.48 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 92.46 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 92.44 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 92.43 |
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3e-59 Score=567.59 Aligned_cols=356 Identities=28% Similarity=0.462 Sum_probs=314.9
Q ss_pred cccccccccchhHHHHHHHHHHHhcCCCchhhhhhcCCCCCceEEEECCCCcHHHHHHHHHHHHhccCccceeeEEEEec
Q 002386 550 DSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFVCC 629 (929)
Q Consensus 550 ~~~~~~l~g~~~~~~~i~~~l~~ll~~~~~~~~~~~~~~~~~~vLL~GppGtGKTtLaralA~~L~~~~~~~~~~~~V~~ 629 (929)
...+++++|++.+++++.+.+. ++..++++|..++..+|+|||||||||||||++||++|++++ .+++.++|
T Consensus 200 ~v~~~dIgGl~~~~~~l~e~v~--~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg------~~~~~v~~ 271 (806)
T 3cf2_A 200 EVGYDDIGGCRKQLAQIKEMVE--LPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG------AFFFLING 271 (806)
T ss_dssp SCCGGGCCSCCTTHHHHHHHHH--HHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTT------CEEEEEEH
T ss_pred CCChhhhcCHHHHHHHHHHHHH--HHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhC------CeEEEEEh
Confidence 4567899999999999998654 344567899999999999999999999999999999999998 89999999
Q ss_pred cccccCchhhHHHHHHHHHHHHHhcCCcEEEEccccccccCCCCCCCCCCchhHHHHHHHHHHHHHHhcccccCccCCCc
Q 002386 630 SRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGIGP 709 (929)
Q Consensus 630 s~L~~~~~~~~~~~l~~~f~~a~~~~PsVL~LDEiD~L~~~~~~~~~~~~~~~~~~l~~~L~~~ld~~~~~~~~~~~~~~ 709 (929)
.++.+.+.++.++.++.+|..|.+++|+||||||+|.|++.+....+ ....++..+|+..|+++.... +
T Consensus 272 ~~l~sk~~gese~~lr~lF~~A~~~~PsIIfIDEiDal~~~r~~~~~----~~~~riv~~LL~~mdg~~~~~-------~ 340 (806)
T 3cf2_A 272 PEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHG----EVERRIVSQLLTLMDGLKQRA-------H 340 (806)
T ss_dssp HHHHSSCTTHHHHHHHHHHHHHTTSCSEEEEEESGGGTCCTTTTCCC----TTHHHHHHHHHTHHHHCCGGG-------C
T ss_pred HHhhcccchHHHHHHHHHHHHHHHcCCeEEEEehhcccccccCCCCC----hHHHHHHHHHHHHHhcccccC-------C
Confidence 99999999999999999999999999999999999999975543322 234678889999999986543 5
Q ss_pred EEEEEecCCCCccccccccCCCcceEeeCCCCcHHHHHHHHHHHHhhcccccCHHHHHHHHhhcCCCChhhHHHHHHHHH
Q 002386 710 IAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDRTV 789 (929)
Q Consensus 710 VivIattn~~~~L~~~L~~~~Rf~~~i~l~~Pd~~eR~~IL~~~l~~~~~~~~d~~l~~LA~~teG~s~~DL~~Lv~~A~ 789 (929)
|+||++||+++.||++|+|+|||+.+|+++.|+.++|.+||+.++++..+. ++.++..+|..|+||+++||..+|++|.
T Consensus 341 V~VIaaTN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~~-~dvdl~~lA~~T~GfsgaDL~~Lv~eA~ 419 (806)
T 3cf2_A 341 VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLA-DDVDLEQVANETHGHVGADLAALCSEAA 419 (806)
T ss_dssp EEEEEECSSTTTSCTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEEC-TTCCHHHHHHHCCSCCHHHHHHHHHHHH
T ss_pred EEEEEecCChhhcCHHHhCCcccceEEecCCCCHHHHHHHHHHHhcCCCCC-cccCHHHHHHhcCCCCHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999888764432 3446899999999999999999999999
Q ss_pred HHHhhccccCC----c--cccccccccccccccccccccccccccccccccccCCCCCccCCCCCchhhHHHHHHHHhcC
Q 002386 790 HAAVGRYLHSD----S--SFEKHIKPTLVRDDFSQAMHEFLPVAMRDITKTSAEGGRSGWDDVGGLTDIQNAIKEMIELP 863 (929)
Q Consensus 790 ~~a~~r~~~~~----~--~~~~~~~~~lt~edf~~al~~~~P~slr~v~l~~~~~~~~~w~dIgGL~~vk~~L~e~le~p 863 (929)
+.|+.|..... . ..+......++.+||..|+..+.|+.+++.....|. +.|+|||||+++|+.|+++++||
T Consensus 420 ~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~---v~w~diggl~~~k~~l~e~v~~p 496 (806)
T 3cf2_A 420 LQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQ---VTWEDIGGLEDVKRELQELVQYP 496 (806)
T ss_dssp HHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCC---CCSTTCCSCHHHHHHHTTTTTTT
T ss_pred HHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCCCcccccccccCCC---CCHHHhCCHHHHHHHHHHHHHhh
Confidence 99988754110 0 001112356889999999999999999988777664 89999999999999999999999
Q ss_pred CCchhhhhhCCCCCCceeEEecCCCCcHHHHHHHHHHHcCCceEEEecccccccccChhhHHHhh
Q 002386 864 SKFPNIFAQAPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRR 928 (929)
Q Consensus 864 ~k~~~if~~~~lr~~sGiLLyGpPGtGKT~LA~alA~e~glnfIsVkg~ELl~kyIG~SEq~VRd 928 (929)
++||+.|.+.+++++.|+|||||||||||++|+|+|.+++.+|+++++++|++||+|+||++||+
T Consensus 497 ~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~ 561 (806)
T 3cf2_A 497 VEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRE 561 (806)
T ss_dssp TTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHH
T ss_pred hhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999985
|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 929 | ||||
| d1wlfa1 | 80 | d.31.1.1 (A:100-179) Peroxisome biogenesis factor | 2e-30 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 2e-26 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 9e-22 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 8e-25 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 3e-22 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 4e-21 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 5e-15 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 2e-19 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 3e-16 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 7e-14 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 1e-11 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 6e-10 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 4e-05 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 6e-09 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 2e-07 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 5e-08 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 1e-04 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 5e-08 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 4e-07 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 4e-07 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 1e-06 | |
| d1njfa_ | 239 | c.37.1.20 (A:) delta prime subunit of DNA polymera | 4e-07 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 4e-07 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 7e-04 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 2e-06 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 4e-05 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 2e-06 | |
| d1a5ta2 | 207 | c.37.1.20 (A:1-207) delta prime subunit of DNA pol | 5e-06 | |
| d1sxja2 | 253 | c.37.1.20 (A:295-547) Replication factor C1 {Baker | 3e-05 | |
| d1sxja2 | 253 | c.37.1.20 (A:295-547) Replication factor C1 {Baker | 4e-04 | |
| d1w5sa2 | 287 | c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t | 5e-05 | |
| d1g8pa_ | 333 | c.37.1.20 (A:) ATPase subunit of magnesium chelata | 3e-04 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 3e-04 | |
| d2bdta1 | 176 | c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B | 5e-04 | |
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 8e-04 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 8e-04 | |
| d2gnoa2 | 198 | c.37.1.20 (A:11-208) gamma subunit of DNA polymera | 0.001 | |
| d1ckea_ | 225 | c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: | 0.001 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 0.001 | |
| d1sxjd2 | 237 | c.37.1.20 (D:26-262) Replication factor C2 {Baker' | 0.001 | |
| d1sxje2 | 252 | c.37.1.20 (E:4-255) Replication factor C5 {Baker's | 0.002 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 0.002 | |
| d1khta_ | 190 | c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco | 0.002 | |
| d1g41a_ | 443 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 0.002 | |
| d1g41a_ | 443 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 0.004 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 0.003 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 0.003 | |
| d1q3ta_ | 223 | c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae | 0.003 | |
| d1y63a_ | 174 | c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma | 0.003 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 0.003 | |
| d1zaka1 | 189 | c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai | 0.004 | |
| d1m8pa3 | 183 | c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d | 0.004 | |
| d1nksa_ | 194 | c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu | 0.004 |
| >d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cdc48 domain 2-like superfamily: Cdc48 domain 2-like family: Cdc48 domain 2-like domain: Peroxisome biogenesis factor 1 (PEX-1), domain 2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 112 bits (282), Expect = 2e-30
Identities = 28/80 (35%), Positives = 46/80 (57%)
Query: 91 VLKATLVTIEPLTEDDWEVLELNSEHAEAAILNQVRIVHEAMRFPLWLHGRTIITFHVVS 150
V+ V +EPL+ DDWE+LEL++ E +L+Q+RIV P+W+ +T I +V+
Sbjct: 1 VVSCQQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVT 60
Query: 151 TFPKKPVVQLVPGTEVAVAP 170
P P +L T++ + P
Sbjct: 61 LMPAAPYGRLETNTKLLIQP 80
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 929 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 100.0 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 100.0 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 100.0 | |
| d1wlfa1 | 80 | Peroxisome biogenesis factor 1 (PEX-1), domain 2 { | 99.97 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.97 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.82 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.77 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.73 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.73 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.72 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.72 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.7 | |
| d1wlfa2 | 87 | Peroxisome biogenesis factor 1 (PEX-1), N-terminal | 99.69 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.67 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.64 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.64 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.61 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.59 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.55 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.54 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.54 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.5 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.49 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.47 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.43 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 99.43 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.4 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.38 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.36 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.35 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.32 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 99.32 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 99.29 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.28 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.26 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.05 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.99 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 98.98 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.98 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.94 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 98.86 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 98.84 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.8 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.79 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.69 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.56 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 98.48 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 98.24 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.24 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.23 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.23 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.09 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.09 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.01 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.01 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.95 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.94 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.89 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.86 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.79 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.59 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.57 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.55 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.48 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.43 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.42 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.36 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.35 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.26 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.21 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.19 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.15 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.13 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.11 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.1 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.05 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.03 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.0 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.99 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.97 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.97 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.96 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.93 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.93 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.92 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.92 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.88 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.87 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.86 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.85 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.84 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.83 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.81 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.8 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.79 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.76 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.73 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.72 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.7 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.69 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 96.69 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.66 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.65 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.64 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.63 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.63 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.62 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.62 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.61 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.58 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.57 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.55 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.55 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.55 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.54 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.53 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.52 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.49 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.41 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.41 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.39 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.36 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.33 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.29 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.21 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.2 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.16 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.14 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.14 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.11 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.06 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.0 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 95.94 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.94 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.81 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 95.77 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.76 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.71 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 95.62 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 95.54 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.52 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.52 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.34 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 95.32 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.3 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 95.28 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.22 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.2 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.16 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.14 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.07 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.91 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 94.88 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.87 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 94.82 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 94.79 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.69 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.59 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.59 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.55 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.52 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.49 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.36 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.33 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 94.27 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 94.14 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.09 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 94.05 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 93.52 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 93.44 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.41 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 93.31 | |
| d1cz5a2 | 94 | C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm | 93.2 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 93.12 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 93.11 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.08 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.0 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 92.94 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 92.77 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.65 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 92.54 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.49 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.42 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 92.39 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.35 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 92.32 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 92.2 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.09 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.97 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 91.97 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 91.97 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.85 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 91.84 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 91.75 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 91.68 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.65 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 91.62 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 91.61 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 91.52 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 91.51 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 91.41 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.38 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 91.35 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 91.27 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 91.01 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 90.96 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.88 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 90.84 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 90.79 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.77 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 90.76 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 90.73 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 90.73 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 90.68 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.67 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.64 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 90.6 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 90.53 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 90.52 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 90.51 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 90.48 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 90.46 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.42 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 90.16 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.16 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 90.09 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 90.04 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 89.66 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.48 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 89.44 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 89.38 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.34 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 89.32 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 89.26 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 89.26 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 89.13 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 89.03 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 89.01 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 88.96 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 88.77 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 88.75 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.64 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 88.58 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 88.56 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 88.56 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.52 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.5 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.37 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.31 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 88.15 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 88.11 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 88.05 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.99 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 87.95 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 87.93 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 87.93 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 87.89 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 87.84 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 87.84 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 87.77 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.73 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 87.57 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 87.5 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 87.48 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 87.41 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 87.31 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 87.25 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 87.2 | |
| d1e32a1 | 86 | Membrane fusion ATPase p97 N-terminal domain , P97 | 87.17 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 87.17 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 87.09 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.08 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 87.07 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.0 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 86.86 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 86.73 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 86.6 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 86.6 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 86.5 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 86.38 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 86.31 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 86.3 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 86.28 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 86.25 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 86.08 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 86.03 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 85.95 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 85.9 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 85.89 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 85.89 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 85.86 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.83 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 85.81 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 85.77 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.69 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.5 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 85.49 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 85.41 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 85.33 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 85.33 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 85.32 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 85.28 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 85.04 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 84.88 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 84.65 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 84.54 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 84.43 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 84.37 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 84.32 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 84.27 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 84.21 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 84.07 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 83.88 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 83.76 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 83.73 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 83.32 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 83.31 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 83.14 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 83.09 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 83.09 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 83.05 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 82.92 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 82.75 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 82.54 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 82.49 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 82.4 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 82.34 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 82.08 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 81.92 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 81.83 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 81.66 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 81.65 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 81.44 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 81.38 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 81.34 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 81.12 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 80.91 | |
| d1qcsa1 | 86 | N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice | 80.81 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 80.63 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 80.63 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 80.44 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 80.18 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 80.17 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2e-34 Score=306.42 Aligned_cols=247 Identities=21% Similarity=0.279 Sum_probs=206.5
Q ss_pred CccccccccccchhHHHHHHHHHHHhcCCCchhhhhhcCCCCCceEEEECCCCcHHHHHHHHHHHHhccCccceeeEEEE
Q 002386 548 GFDSNVSSLSWMGTTASDVINRIKVLLSPDSGLWFSTYHLPLPGHILIHGPPGSGKTSLAKAVAKSLEHHKDLVAHIVFV 627 (929)
Q Consensus 548 ~~~~~~~~l~g~~~~~~~i~~~l~~ll~~~~~~~~~~~~~~~~~~vLL~GppGtGKTtLaralA~~L~~~~~~~~~~~~V 627 (929)
....++++++|++..++++.+.+..+. +++.+.++|.+.++++|||||||||||++|+++|++++ .+++++
T Consensus 6 ~~~~t~~Di~Gl~~~k~~l~e~v~~~~---~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~------~~~~~i 76 (256)
T d1lv7a_ 6 QIKTTFADVAGCDEAKEEVAELVEYLR---EPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAK------VPFFTI 76 (256)
T ss_dssp SSCCCGGGSCSCHHHHHHTHHHHHHHH---CGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHT------CCEEEE
T ss_pred CCCCCHHHHhchHHHHHHHHHHHHHHH---CHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcC------CCEEEE
Confidence 345678899999999999988655433 46678889999999999999999999999999999998 899999
Q ss_pred eccccccCchhhHHHHHHHHHHHHHhcCCcEEEEccccccccCCCCCCCCCCchhHHHHHHHHHHHHHHhcccccCccCC
Q 002386 628 CCSRLSLEKGPIIRQALSNFISEALDHAPSIVIFDNLDSIISSSSDPEGSQPSTSVIALTKFLVDIMDEYGEKRKSSCGI 707 (929)
Q Consensus 628 ~~s~L~~~~~~~~~~~l~~~f~~a~~~~PsVL~LDEiD~L~~~~~~~~~~~~~~~~~~l~~~L~~~ld~~~~~~~~~~~~ 707 (929)
+++++.+.+.++.++.++.+|..|..++|+||||||+|.+++.+........ ....++...|+..++++....
T Consensus 77 ~~~~l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~-~~~~~~~~~ll~~~d~~~~~~------ 149 (256)
T d1lv7a_ 77 SGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGH-DEREQTLNQMLVEMDGFEGNE------ 149 (256)
T ss_dssp CSCSSTTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTT-CHHHHHHHHHHHHHHTCCSSS------
T ss_pred EhHHhhhcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCc-HHHHHHHHHHHHHhhCCCCCC------
Confidence 9999999999999999999999999999999999999999875544433322 334567778888888765432
Q ss_pred CcEEEEEecCCCCccccccccCCCcceEeeCCCCcHHHHHHHHHHHHhhcccccCHHHHHHHHhhcCCCChhhHHHHHHH
Q 002386 708 GPIAFVASAQSLEKIPQSLTSSGRFDFHVQLPAPAASERKAILEHEIQRRSLECSDEILLDVASKCDGYDAYDLEILVDR 787 (929)
Q Consensus 708 ~~VivIattn~~~~L~~~L~~~~Rf~~~i~l~~Pd~~eR~~IL~~~l~~~~~~~~d~~l~~LA~~teG~s~~DL~~Lv~~ 787 (929)
+|++|+|||.++.+|++++|+|||+..|+|++|+.++|.+|++.++.+..+. .+..+..++..|+||+++||..+|++
T Consensus 150 -~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~-~~~~~~~la~~t~G~s~adi~~l~~~ 227 (256)
T d1lv7a_ 150 -GIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLA-PDIDAAIIARGTPGFSGADLANLVNE 227 (256)
T ss_dssp -CEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBC-TTCCHHHHHHTCTTCCHHHHHHHHHH
T ss_pred -CEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcC-cccCHHHHHHhCCCCCHHHHHHHHHH
Confidence 5999999999999999999999999999999999999999999998776554 45568899999999999999999999
Q ss_pred HHHHHhhccccCCccccccccccccccccccccccc
Q 002386 788 TVHAAVGRYLHSDSSFEKHIKPTLVRDDFSQAMHEF 823 (929)
Q Consensus 788 A~~~a~~r~~~~~~~~~~~~~~~lt~edf~~al~~~ 823 (929)
|...+.++ .+..++.+||.+|+++.
T Consensus 228 A~~~a~~~-----------~~~~i~~~d~~~Al~rv 252 (256)
T d1lv7a_ 228 AALFAARG-----------NKRVVSMVEFEKAKDKI 252 (256)
T ss_dssp HHHHHHHT-----------TCSSBCHHHHHHHHHHH
T ss_pred HHHHHHHc-----------CCCccCHHHHHHHHHHH
Confidence 98888765 33568899999988764
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|