Citrus Sinensis ID: 002458

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------92
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKFRPSKIHDI
cHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccHHHHHHccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHcccccEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHEEcccccccccccEEEEEEEccccccHHHHHHHHHHcccccccHHHHHcccccEEEEccEEEEcHHHHHHHHHHHHHccccccccEEcccccHHHHHHHccccccccEEEEEEcccccccccHHHHcccccccEEEEcccccccccccccccccEEEEccccccccccccccccEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccEEcccccccccccEEccccccccccccccccccccccEEEEccccccccccccccccccccEEcccccccEEEcccccccccccEEEEcccccccccccccHHHHHcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccEEEEEccccccccccccccccEEEEccccccccEEccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccEEEEEccccccccEEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEccccccccccEEEEEEEccccccccccccccEEEEEEEEEcccccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccEEccccccccccccccccccEEEEEEcccccccc
cHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHcccHHEHHHHccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHccEEEEcccEEEHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHccccccEEEEEEEccccHHHccHHHHHHHHccEEEEEEccccccccccccHHcEEEEEcccccccccccccHHHHEEEcccccHHHHHHccccccccccEEEcccccccEcccccccccccHEEEccccccHcccccHHHHHHHHHEEcccccccHccccccHccHHHHHEEEcccccHHcccHHHHcccHHHHEEEccccccEcccccHHHccccEEEEcccccccccccccHHcHHHHHEEcccccccccccccccccccccEEEcccccccHHcccccccccccHcEEEccccccccccHHHHHHHHccEEEcccccHHcccccccccccEEEcccccccEEccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHcccccccEEEEEcccccccccEEEEEEEEcccccccccEEEEEEEEEccccEEccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEEccccccEEEEEcEEEEEEEccccccccccccccccccccHHHHHHccccccEEcccccccccccccccHHHEEEEEEcccccccc
mekmngyleaglddvrfigicgmggigkTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVgnhdwfgfgsriiitsrdehvlkshgvtntykvrgLDYVEALQLFHLKvsngkqptdyRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIAcffkgkdedRVRKkldscgfnsdiGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREhhsdkpgkwsrlwLYKDVYHVLSKYMGTDAVEAIIVdvpemteleaKSFSTMSNLRLLEINNlyssgnleylSNNLRYlkwheypfnslpvsfrpeklfkLNLCNSRIKYLWKgikplkelkfmnlshscnlirtpdftgvpnlerlnLEGCTRLLEVHQSVGTLKRLILLNLKdcrnlvsfpknvCLMKSLKILCLcgclkleklpqdlgevecleeldvggtairqippsIVQLVNLKIfslhgckgqppkilssnfflslllpnknsdsmclsfprftglsslqtldlsdcnllegaipsdigslfSLEAIdlsgnnffslPSSINQLLKLKILCLEKCrnlkslpelppeivfvgaedctsLETISAFAklsrspnialnFLNCFKLVEDQVSKDNLAVTLMKQWLlevpncssqfhiflpgneiprwfrfrniggsvtmtaprldnFIGFAVCAVLSLPRCMDRFYSEIQCkllwgeddykfsvaipsfttlesdhlwlaylpretfktqcfrgltkasfnIFYMGEEFRNASVKMCGVVSLYMEVEDTVYmgqqlwppiwnpgpsglrrrgfrnFYTLSWlegnaarslqpsarlgllfkfrpskihdi
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITsrdehvlkshgvtntykvrGLDYVEALQLFHLKvsngkqptdYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNrlqeapnekvlkvLRISydgldrrdKEIFLDIAcffkgkdedrvrkkldscgfnsdigireLLDKSLITIVNNKLWMHDLLQEMGWEIVREHhsdkpgkwsrlWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNaarslqpsarlgllfkfrpskihdi
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSlkilclcgclkleklPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKIlssnfflslllpnknsDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQllklkilclekcRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKFRPSKIHDI
******YLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKF********
*EKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVE**************************************************LLFKFRPSKI***
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKFRPSKIHDI
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTV*********IWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKFRPSKI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTELEAKSFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPRLDNFIGFAVCAVLSLPRCMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVEDTVYMGQQLWPPIWNPGPSGLRRRGFRNFYTLSWLEGNAARSLQPSARLGLLFKFRPSKIHDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query919 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.923 0.742 0.344 1e-124
O825001095 Putative disease resistan no no 0.763 0.641 0.326 3e-98
Q9SZ67 1895 Probable WRKY transcripti no no 0.655 0.317 0.360 3e-83
Q9FL92 1372 Probable WRKY transcripti no no 0.744 0.498 0.321 3e-81
O23530 1301 Protein SUPPRESSOR OF npr no no 0.767 0.541 0.315 5e-79
Q9FH83 1288 Probable WRKY transcripti no no 0.771 0.550 0.315 4e-77
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.758 0.432 0.288 6e-62
Q9LVT1623 Putative disease resistan no no 0.537 0.792 0.252 3e-25
Q9FW44787 Disease resistance protei no no 0.542 0.634 0.268 1e-24
Q9SZA7816 Probable disease resistan no no 0.545 0.613 0.268 9e-24
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  446 bits (1146), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 340/986 (34%), Positives = 508/986 (51%), Gaps = 137/986 (13%)

Query: 1    MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTL------KDQFEASSFLANVRE 54
            +EK+   LE G++ VR +GI GMGG+GKTT+A+ +++TL        QF+ + FL +++E
Sbjct: 195  LEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKE 254

Query: 55   VSVTRGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQ-LQ 113
                RG+  LQ  LLSE+L E+     +   G + +  RL  K+VL++LDD+D  +  L+
Sbjct: 255  NK--RGMHSLQNALLSELLREK-ANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLE 311

Query: 114  ALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTD 173
             L G+ DWFG GSRIIIT+RD+H+++ + +   Y+V  L   E++QLF       + P +
Sbjct: 312  YLAGDLDWFGNGSRIIITTRDKHLIEKNDII--YEVTALPDHESIQLFKQHAFGKEVPNE 369

Query: 174  YRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDG 233
               +LS  VVNYA GLPLA++V GS L    + EWKSA+  ++      ++  L+ISYDG
Sbjct: 370  NFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDG 429

Query: 234  LDRRDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVN-NKLWMHD 292
            L+ + +E+FLDIACF +G+++D + + L+SC   ++ G+R L+DKSL+ I   N++ MHD
Sbjct: 430  LEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHD 489

Query: 293  LLQEMGWEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMT-ELEAK 351
            L+Q+MG  IV  +    PG+ SRLWL K+V  V+S   GT A+EAI V     T     +
Sbjct: 490  LIQDMGKYIV--NFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQ 547

Query: 352  SFSTMSNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSR 411
            +   M  LR+  +    +   ++YL NNLR      YP+ S P +F  + L  L L ++ 
Sbjct: 548  AVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNS 607

Query: 412  IKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKR 471
            +++LW   K L  L+ ++LS S  L RTPDFTG+PNLE +NL  C+ L EVH S+G   +
Sbjct: 608  LRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSK 667

Query: 472  LILLNLKDCRNLVSFPKNVCL-MKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAI 530
            +I L L DC++L  FP   C+ ++SL+ L L  C  LEKLP+  G ++   ++ + G+ I
Sbjct: 668  VIGLYLNDCKSLKRFP---CVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGI 724

Query: 531  RQIPPSIVQ-------------------------LVNLKIFSLHGCKG------------ 553
            R++P SI Q                         L +L   S+ GC              
Sbjct: 725  RELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLD 784

Query: 554  -------------QPPKILSSNFFLSLLLPNKNSDSMCLSFPRFT-GLSSLQTLDLSDCN 599
                         +PP  +     L +L+     D +   FP    GL SL+ L+LS CN
Sbjct: 785  NLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCN 844

Query: 600  LLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPEI 659
            L++G +P +IGSL SL+ +DLS NNF  LPSSI QL  L+ L L+ C+ L  LPELPPE+
Sbjct: 845  LIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPEL 904

Query: 660  VFVGAEDCTSLETISAF---------AKLSRSPNIALN-------FLNCFKLVEDQVSKD 703
              +  +   +L+ I             KL  + N  +        F N   +  D  + D
Sbjct: 905  NELHVDCHMALKFIHYLVTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASD 964

Query: 704  NLAVTLMKQWLLEVPNCSSQFHIFLPGNEIPRWFRFRNIGGSVTMTAPR----LDNFIGF 759
            +L++T+           + Q +      +IP WF  +    SV++  P      D F+GF
Sbjct: 965  SLSLTVF----------TGQPY----PEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLGF 1010

Query: 760  AVCAVLSL--------PRCMDRFYSEIQCKLLWGEDDYK---FSVAIPSFTTLESDHLWL 808
            AVC   SL        P C D+  S +  KL   E D +   +S     F  +    LW 
Sbjct: 1011 AVCYSRSLIDTTAHLIPVCDDKM-SRMTQKLALSECDTESSNYSEWDIHFFFVPFAGLWD 1069

Query: 809  AYLPRETFKTQCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYM---EVEDTVYMGQQL 865
                +   KT    G+ + SF+    GEE      KM G+  LY    EV   + M +  
Sbjct: 1070 T--SKANGKTPNDYGIIRLSFS----GEE------KMYGLRLLYKEGPEVNALLQMRENS 1117

Query: 866  WPPIWNPGPSGLRRRGFRN---FYTL 888
              P      +G+RR  + N   FY L
Sbjct: 1118 NEP--TEHSTGIRRTQYNNRTSFYEL 1141
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query919
255582274943 leucine-rich repeat-containing protein, 0.879 0.856 0.475 0.0
224130518 1121 tir-nbs-lrr resistance protein [Populus 0.882 0.723 0.471 0.0
296090597 1201 unnamed protein product [Vitis vinifera] 0.915 0.700 0.421 1e-178
359493489 1092 PREDICTED: TMV resistance protein N-like 0.923 0.777 0.432 1e-178
225460354 1174 PREDICTED: TMV resistance protein N-like 0.874 0.684 0.443 1e-176
105922482 1121 TIR-NBS-LRR type disease resistance prot 0.854 0.700 0.448 1e-174
147768286 1206 hypothetical protein VITISV_033530 [Viti 0.874 0.666 0.425 1e-173
359496034 1132 PREDICTED: TMV resistance protein N-like 0.904 0.734 0.422 1e-173
399920215 1083 TIR-NBS-LRR [Rosa rugosa] 0.918 0.779 0.424 1e-172
224116202 1098 tir-nbs-lrr resistance protein [Populus 0.918 0.768 0.409 1e-172
>gi|255582274|ref|XP_002531928.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223528407|gb|EEF30442.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/846 (47%), Positives = 561/846 (66%), Gaps = 38/846 (4%)

Query: 1   MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVTRG 60
           +E+++ ++  G +DVR IGICGMGGIGKTT+A   YN +  QFE  +FLANVREVS    
Sbjct: 20  LEELHSHVGIGQNDVRIIGICGMGGIGKTTIATAYYNWMSIQFEGRAFLANVREVSSKGR 79

Query: 61  LVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHD 120
           L+ LQEQLLSE+LM + + IW+V+ G ++I+ RL  KRVLV++DDV+QL QLQ L G  D
Sbjct: 80  LLSLQEQLLSEILMGKKVKIWNVYNGTDMIKSRLRYKRVLVVIDDVNQLSQLQNLAGKSD 139

Query: 121 WFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVELSK 180
           WFG GSR+IIT+RDEH+L SHGV   YKV+GL+  EALQLF LK      P    + LS 
Sbjct: 140 WFGPGSRVIITTRDEHLLISHGVDEIYKVKGLNKSEALQLFSLKAFRNNHPQKDYMTLST 199

Query: 181 YVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRDKE 240
            +V YA GLPLA+EVLGSFL  R++EE ++AL+R++E P +++L  L+IS+DGL+  +K+
Sbjct: 200 DIVYYANGLPLALEVLGSFLFNRTLEESRNALDRIKEIPKDEILDALQISFDGLEEMEKQ 259

Query: 241 IFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWE 300
           IFLDIACFFKGK+ D + K LD CGF  DIGIR L++KSLITIV  +LWMHDLLQEMGW+
Sbjct: 260 IFLDIACFFKGKNIDHITKILDGCGFYPDIGIRVLIEKSLITIVGERLWMHDLLQEMGWK 319

Query: 301 IVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVPEMTE--LEAKSFSTMSN 358
           +V++   ++PG+ SRLWLYKD++HVL+K  GT  VE +++D+PE  E  LEA++F  +  
Sbjct: 320 LVQQESPEEPGRRSRLWLYKDIFHVLTKNTGTADVEGMVLDLPEAEEIQLEAQAFRKLKK 379

Query: 359 LRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKG 418
           +RLL+  N+Y S +LEYLSN LRYLKW+ YPF +LP +F+  +L +LN+  S+++ +W+G
Sbjct: 380 IRLLKFRNVYFSQSLEYLSNELRYLKWYGYPFRNLPCTFQSNELLELNMSYSQVEQIWEG 439

Query: 419 IKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTLKRLILLNLK 478
            K   +LK M LSHS NL++TPDF GVP+LE+L LEGC  L E+ QS+G L+RL LLNLK
Sbjct: 440 TKQFNKLKIMKLSHSKNLVKTPDFRGVPSLEKLVLEGCLELQEIDQSIGILERLALLNLK 499

Query: 479 DCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPSIV 538
           DC+ L   P+++  +K+LKI+ L GC  L+ + ++LG+++ LEELDV GT ++Q   S  
Sbjct: 500 DCKKLSILPESIYGLKALKIVNLSGCSILDYMLEELGDIKSLEELDVSGTTVKQPFSSFS 559

Query: 539 QLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFPRFTGLSSLQTLDLSDC 598
              NLKI SL GC  QPP I + +     LLP K S++M         L SL  LDL +C
Sbjct: 560 HFKNLKILSLRGCSEQPPAIWNPHLS---LLPGKGSNAM--------DLYSLMVLDLGNC 608

Query: 599 NLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELPPE 658
           NL E  IP+D+  L SL+   LSGNNF SLP+S+ +L KL+ L L+ CRNL+S+  +P  
Sbjct: 609 NLQEETIPTDLSCLSSLKEFCLSGNNFISLPASVCRLSKLEHLYLDNCRNLQSMQAVPSS 668

Query: 659 IVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVP 718
           +  + A+ C++LET+     LS   +   NF NCFKLVE+Q   +N+   +++ +L  + 
Sbjct: 669 VKLLSAQACSALETLPETLDLSGLQSPRFNFTNCFKLVENQ-GCNNIGFMMLRNYLQGLS 727

Query: 719 NCSSQFHIFLPGNEIPRWFRFRNIGG-SVTMTAPRL---DNFIGFAVCAVLSLPR----- 769
           N    F I +PG+EIP W   +++G  S+++  P +     ++GFA+CAV  + +     
Sbjct: 728 NPKPGFDIIIPGSEIPDWLSHQSLGDCSISIELPPVWCDSKWMGFALCAVYVIYQEPALN 787

Query: 770 -------CMDRFYSEIQCKLLWGEDDYKFSVAIPSFTTLESDHLWLAYLPRETFKTQCFR 822
                  C  +      C     E DY F+        + SD +WL +L R  F     +
Sbjct: 788 FIDMDLTCFIKIKGHTWCH----ELDYSFA----EMELVGSDQVWLFFLSRYEFLGIDCQ 839

Query: 823 GLTKAS 828
           G+ K S
Sbjct: 840 GVAKTS 845

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224130518|ref|XP_002328629.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222838611|gb|EEE76976.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493489|ref|XP_002264004.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|105922482|gb|ABF81419.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147768286|emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496034|ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|399920215|gb|AFP55562.1| TIR-NBS-LRR [Rosa rugosa] Back     alignment and taxonomy information
>gi|224116202|ref|XP_002331986.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832110|gb|EEE70587.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query919
TAIR|locus:21674571191 AT5G36930 [Arabidopsis thalian 0.801 0.618 0.371 1.6e-116
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.751 0.534 0.366 9.8e-103
TAIR|locus:21361081095 AT4G11170 [Arabidopsis thalian 0.651 0.547 0.347 7.9e-93
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.646 0.519 0.370 9e-93
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.732 0.566 0.330 2.2e-88
TAIR|locus:2146243900 AT5G18360 [Arabidopsis thalian 0.724 0.74 0.340 4.1e-88
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.783 0.606 0.306 4.7e-87
TAIR|locus:21565791190 AT5G48770 [Arabidopsis thalian 0.523 0.404 0.361 1.8e-84
TAIR|locus:21750751068 AT5G41750 [Arabidopsis thalian 0.573 0.493 0.350 2.7e-83
TAIR|locus:2161513780 AT5G17970 [Arabidopsis thalian 0.584 0.688 0.369 3.2e-81
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1148 (409.2 bits), Expect = 1.6e-116, P = 1.6e-116
 Identities = 292/785 (37%), Positives = 410/785 (52%)

Query:     1 MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANVREVSVT-R 59
             ++ ++  L  G D VR I I GMGGIGKTTLAKV +N     FE SSFL N RE S    
Sbjct:   198 LQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPE 257

Query:    60 GLVPLQEQLLSEVLMERDLIIWDVHKGIN-LIRWRLCRKRVLVILDDVDQLEQLQALVGN 118
             G   LQ QLLS++L   D+      KG++  ++ R   KRVL+++DDVD + QL +   +
Sbjct:   258 GRTHLQHQLLSDILRRNDIEF----KGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAID 313

Query:   119 HDWFGFGSRIIITSRDEHVLKSHGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVEL 178
              D FG GSRIIIT+R+ H+LK      +Y  + LD  E+L+LF        +P    ++ 
Sbjct:   314 RDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQH 373

Query:   179 SKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLDRRD 238
             S+ VV Y  GLPLA+EVLG+FL  RS+ EW+S L  L+  PN+ +   L+IS++ L    
Sbjct:   374 SEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNIQAKLQISFNALTIEQ 433

Query:   239 KEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMG 298
             K++FLDIACFF G D   V   LD C    DI +  L+++ LITI  N + MHDLL++MG
Sbjct:   434 KDVFLDIACFFIGVDSYYVACILDGCNLYPDIVLSLLMERCLITISGNNIMMHDLLRDMG 493

Query:   299 WEIVREHHSDKPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIV--DVPEMTELEAKSFSTM 356
              +IVRE    K G+ SRLW + DV  VL K  GT+A+E + +  DV +    E ++F+ M
Sbjct:   494 RQIVREISPKKCGERSRLWSHNDVVGVLKKKSGTNAIEGLSLKADVMDFQYFEVEAFAKM 553

Query:   357 SNLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLW 416
               LRLLE+  +  +G+ E+   +LR+L WH +     P++   E L  L+L  S +K  W
Sbjct:   554 QELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFW 613

Query:   417 KGI---KPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGCTRLLEVHQSVGTL-KRL 472
             K     +P   +K+++LSHS  L  TPDF+  PN+E+L L  C  L+ VH+S+G L K+L
Sbjct:   614 KAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKL 673

Query:   473 ILLNLKDCRNLVSFPKNVCLMKSXXXXXXXXXXXXXXXPQDLGEVECLEELDVGGTAIRQ 532
             +LLNL  C  L   P+ +  +KS                  LGE+E L  L    TA+R+
Sbjct:   674 VLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALRE 733

Query:   533 IPPSIVQLVNLKIFSLHGCKGQPPKIXXXXXXXXXXXXXXXXDSMCLSFP-RFTGLSSLQ 591
             IP +I QL  LK  SL+GCKG                      S+ L  P   +GL+ ++
Sbjct:   734 IPSTINQLKKLKRLSLNGCKG-------LLSDDIDNLYSEKSHSVSLLRPVSLSGLTYMR 786

Query:   592 TLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQXXXXXXXXXXXXRNLKS 651
              L L  CNL +  IP DIGSL  L  +DL GN+F +LP+                  L+S
Sbjct:   787 ILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQS 846

Query:   652 LPELPPEIVFVGAEDCTSLETISAFAKLSRSPNIALNFLNCFKLVE-------------- 697
             +  LP  ++F+    C  L+     +K S    + LN  +C  L E              
Sbjct:   847 ILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLN--DCISLFEIPGIHNHEYLSFIV 904

Query:   698 -DQ---VSKDNLAVTLMKQWLLEVPNCSSQFHIFLP---GNEIPRWFRFRNIGGSVTMTA 750
              D     S D    T+++ WL     C     I++P    N IP W  F     S ++T 
Sbjct:   905 LDGCKLASTDTTINTMLENWLKRNHEC-----IYIPVDRPNVIPNWVYFEEEKRSFSITV 959

Query:   751 PRLDN 755
             P  DN
Sbjct:   960 PETDN 964
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156579 AT5G48770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161513 AT5G17970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.1LOW CONFIDENCE prediction!
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query919
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-34
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  132 bits (335), Expect = 2e-34
 Identities = 85/282 (30%), Positives = 144/282 (51%), Gaps = 23/282 (8%)

Query: 1   MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYN--TLKDQFEASSFLANVREVSVT 58
           +E +   L    D++  +GI GMGG+GKTTLAK +YN  ++   F++ +++   +  +  
Sbjct: 5   IEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEF 64

Query: 59  RGLVPLQEQLLSEVLMERDLIIWDVHKGINLIRWRLC----RKRVLVILDDVDQLEQLQA 114
           R    LQ+ +L E+ ++       V K  + +  ++     RKR L++LDDV +      
Sbjct: 65  R----LQKDILQELGLDDSDW---VEKNESELAVKIKEALLRKRFLLVLDDVWEKNDWDK 117

Query: 115 LVGNHDWFGFGSRIIITSRDEHVLKSHGVTNT-YKVRGLDYVEALQLFHLKVSNGKQPTD 173
           +         GSR+I+T+R E V    G T+  ++V  L+  E+ +LF  KV   + P  
Sbjct: 118 IGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPC 177

Query: 174 -YRVELSKYVVNYAGGLPLAIEVLGSFLCGRS-VEEWKSALNRLQEAPNE-----KVLKV 226
               E++K +V    GLPLA++VLG  L  +S V+EW+  L +L           +VL +
Sbjct: 178 PELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSI 237

Query: 227 LRISYDGLDRRDKEIFLDIACFFKGKD--EDRVRKKLDSCGF 266
           L +SYD L    K  FL +A F +  +  ++++ K   + GF
Sbjct: 238 LSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 919
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
KOG4237498 consensus Extracellular matrix protein slit, conta 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG4237498 consensus Extracellular matrix protein slit, conta 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
PRK04841903 transcriptional regulator MalT; Provisional 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
PF05729166 NACHT: NACHT domain 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.9
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.9
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.87
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.71
COG3903414 Predicted ATPase [General function prediction only 98.66
PRK06893229 DNA replication initiation factor; Validated 98.64
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.63
COG3899849 Predicted ATPase [General function prediction only 98.62
PLN03150623 hypothetical protein; Provisional 98.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.56
PLN03150623 hypothetical protein; Provisional 98.54
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.52
PF13173128 AAA_14: AAA domain 98.51
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.46
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.44
PRK13342413 recombination factor protein RarA; Reviewed 98.43
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
PRK15386426 type III secretion protein GogB; Provisional 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
PRK15386426 type III secretion protein GogB; Provisional 98.26
PRK08727233 hypothetical protein; Validated 98.26
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.24
PRK12402337 replication factor C small subunit 2; Reviewed 98.22
PRK09087226 hypothetical protein; Validated 98.21
PLN03025319 replication factor C subunit; Provisional 98.21
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.2
PTZ001121164 origin recognition complex 1 protein; Provisional 98.19
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.19
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.19
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 98.17
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK08084235 DNA replication initiation factor; Provisional 98.16
PRK05642234 DNA replication initiation factor; Validated 98.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.13
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 98.13
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 98.13
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG2028554 consensus ATPase related to the helicase subunit o 98.11
PRK05564313 DNA polymerase III subunit delta'; Validated 98.09
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.09
PRK04195482 replication factor C large subunit; Provisional 98.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
PRK14087450 dnaA chromosomal replication initiation protein; P 98.04
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.03
PRK13341725 recombination factor protein RarA/unknown domain f 98.03
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.02
PRK09376416 rho transcription termination factor Rho; Provisio 98.0
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK00440319 rfc replication factor C small subunit; Reviewed 97.99
cd01128249 rho_factor Transcription termination factor rho is 97.98
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.94
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.93
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.91
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.91
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.9
PRK07940394 DNA polymerase III subunit delta'; Validated 97.9
PRK03992389 proteasome-activating nucleotidase; Provisional 97.9
PRK00149450 dnaA chromosomal replication initiation protein; R 97.89
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.88
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.86
PRK07471365 DNA polymerase III subunit delta'; Validated 97.86
PRK14088440 dnaA chromosomal replication initiation protein; P 97.83
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.82
PRK06620214 hypothetical protein; Validated 97.81
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.81
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.8
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.8
PRK12422445 chromosomal replication initiation protein; Provis 97.79
PRK09112351 DNA polymerase III subunit delta'; Validated 97.76
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.75
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.75
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.74
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
TIGR00767415 rho transcription termination factor Rho. Members 97.71
PF14516331 AAA_35: AAA-like domain 97.71
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.7
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.7
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.69
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.69
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.68
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.68
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.66
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.66
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.66
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.66
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.66
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.64
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.64
PRK05707328 DNA polymerase III subunit delta'; Validated 97.63
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.62
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.61
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.61
PRK14086617 dnaA chromosomal replication initiation protein; P 97.6
PHA02544316 44 clamp loader, small subunit; Provisional 97.59
PF00004132 AAA: ATPase family associated with various cellula 97.59
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.58
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.58
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.56
PRK08116268 hypothetical protein; Validated 97.56
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.53
smart00382148 AAA ATPases associated with a variety of cellular 97.52
COG0593408 DnaA ATPase involved in DNA replication initiation 97.49
CHL00176638 ftsH cell division protein; Validated 97.49
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.47
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.47
CHL00181287 cbbX CbbX; Provisional 97.47
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.42
KOG4341483 consensus F-box protein containing LRR [General fu 97.42
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.41
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.39
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.37
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.36
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.33
CHL00195489 ycf46 Ycf46; Provisional 97.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.26
PRK08181269 transposase; Validated 97.2
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.18
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.17
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.17
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 97.16
PRK07399314 DNA polymerase III subunit delta'; Validated 97.15
PRK09183259 transposase/IS protein; Provisional 97.15
PRK12377248 putative replication protein; Provisional 97.15
PRK06921266 hypothetical protein; Provisional 97.15
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.14
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.14
PRK07952244 DNA replication protein DnaC; Validated 97.13
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.11
PRK08769319 DNA polymerase III subunit delta'; Validated 97.07
PRK06090319 DNA polymerase III subunit delta'; Validated 97.07
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.06
PRK06835329 DNA replication protein DnaC; Validated 97.05
PRK06526254 transposase; Provisional 97.04
PRK08058329 DNA polymerase III subunit delta'; Validated 97.02
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.02
PRK04296190 thymidine kinase; Provisional 97.01
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.99
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.99
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.98
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 96.98
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.97
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.96
PTZ00202550 tuzin; Provisional 96.95
cd01394218 radB RadB. The archaeal protein radB shares simila 96.93
PRK08118167 topology modulation protein; Reviewed 96.92
PRK06871325 DNA polymerase III subunit delta'; Validated 96.91
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.91
CHL00095821 clpC Clp protease ATP binding subunit 96.85
PRK04132846 replication factor C small subunit; Provisional 96.85
PRK07993334 DNA polymerase III subunit delta'; Validated 96.85
PRK06964342 DNA polymerase III subunit delta'; Validated 96.84
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.83
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.81
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.8
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.77
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.76
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.75
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.74
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.71
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.7
PRK05541176 adenylylsulfate kinase; Provisional 96.67
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.64
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.63
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.63
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.61
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.58
PRK10865857 protein disaggregation chaperone; Provisional 96.56
PRK10536262 hypothetical protein; Provisional 96.56
PRK12608380 transcription termination factor Rho; Provisional 96.54
KOG0731774 consensus AAA+-type ATPase containing the peptidas 96.53
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.53
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.53
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.52
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.51
PRK07667193 uridine kinase; Provisional 96.47
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.45
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.45
PRK07261171 topology modulation protein; Provisional 96.44
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.42
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.42
PRK06762166 hypothetical protein; Provisional 96.41
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.38
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.37
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.35
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.32
PHA00729226 NTP-binding motif containing protein 96.32
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 96.3
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.3
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.27
PRK08699325 DNA polymerase III subunit delta'; Validated 96.26
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 96.26
PRK06067234 flagellar accessory protein FlaH; Validated 96.26
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.25
PRK08233182 hypothetical protein; Provisional 96.19
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 96.18
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.18
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.17
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.16
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.15
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.14
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.11
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.05
PRK08939306 primosomal protein DnaI; Reviewed 96.05
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.05
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.04
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.03
TIGR00763775 lon ATP-dependent protease La. This protein is ind 96.02
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.0
PRK06696223 uridine kinase; Validated 95.99
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.99
PRK10865857 protein disaggregation chaperone; Provisional 95.98
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.95
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.95
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.92
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 95.92
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.92
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.89
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.87
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.86
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.84
PRK00771437 signal recognition particle protein Srp54; Provisi 95.83
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.83
PRK04040188 adenylate kinase; Provisional 95.8
TIGR00064272 ftsY signal recognition particle-docking protein F 95.79
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.78
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.76
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.76
PRK09354349 recA recombinase A; Provisional 95.75
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.75
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.75
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.74
PF07726131 AAA_3: ATPase family associated with various cellu 95.74
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.71
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.7
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.69
cd03246173 ABCC_Protease_Secretion This family represents the 95.69
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.69
PRK08356195 hypothetical protein; Provisional 95.69
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 95.66
cd03115173 SRP The signal recognition particle (SRP) mediates 95.65
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.65
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 95.61
PRK11823446 DNA repair protein RadA; Provisional 95.58
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.57
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.54
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.54
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 95.53
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.52
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.52
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.51
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 95.5
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.5
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.47
PRK14974336 cell division protein FtsY; Provisional 95.47
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.45
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.45
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.44
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.44
PRK04328249 hypothetical protein; Provisional 95.44
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.42
PRK05480209 uridine/cytidine kinase; Provisional 95.42
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.41
PRK03839180 putative kinase; Provisional 95.41
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.39
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.37
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.35
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.35
PRK13695174 putative NTPase; Provisional 95.34
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.33
PTZ00301210 uridine kinase; Provisional 95.33
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.32
PRK10867433 signal recognition particle protein; Provisional 95.32
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.29
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.29
PTZ00088229 adenylate kinase 1; Provisional 95.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.28
PRK07132299 DNA polymerase III subunit delta'; Validated 95.27
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 95.27
PRK00625173 shikimate kinase; Provisional 95.26
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.25
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.25
COG0003322 ArsA Predicted ATPase involved in chromosome parti 95.23
KOG0736953 consensus Peroxisome assembly factor 2 containing 95.22
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.21
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.2
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.2
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 95.19
CHL002062281 ycf2 Ycf2; Provisional 95.19
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.18
PRK06217183 hypothetical protein; Validated 95.15
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.12
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.07
COG5635824 Predicted NTPase (NACHT family) [Signal transducti 95.03
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.99
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.98
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.98
PRK00131175 aroK shikimate kinase; Reviewed 94.97
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 94.97
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.97
PRK06547172 hypothetical protein; Provisional 94.97
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.93
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.92
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.91
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.91
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.9
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.89
PRK13947171 shikimate kinase; Provisional 94.88
CHL00095821 clpC Clp protease ATP binding subunit 94.87
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.86
TIGR00959428 ffh signal recognition particle protein. This mode 94.86
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.85
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 94.85
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 94.84
KOG1969877 consensus DNA replication checkpoint protein CHL12 94.84
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.84
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 94.84
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 94.77
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.76
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.75
PRK00889175 adenylylsulfate kinase; Provisional 94.75
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.73
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.72
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.7
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.69
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 94.69
TIGR02236310 recomb_radA DNA repair and recombination protein R 94.69
PTZ00035337 Rad51 protein; Provisional 94.64
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.63
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.62
PRK03846198 adenylylsulfate kinase; Provisional 94.58
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 94.57
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.56
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 94.54
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.51
PF00154322 RecA: recA bacterial DNA recombination protein; In 94.51
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.5
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 94.5
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.5
COG0488530 Uup ATPase components of ABC transporters with dup 94.5
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.49
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 94.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.48
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.47
PRK10416318 signal recognition particle-docking protein FtsY; 94.45
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 94.44
PRK00279215 adk adenylate kinase; Reviewed 94.44
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.43
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 94.43
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.42
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.42
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.39
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 94.35
TIGR01287275 nifH nitrogenase iron protein. This model describe 94.35
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 94.34
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.33
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 94.33
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 94.32
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.32
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 94.31
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.3
KOG3928461 consensus Mitochondrial ribosome small subunit com 94.3
PLN03186342 DNA repair protein RAD51 homolog; Provisional 94.29
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.28
PRK13949169 shikimate kinase; Provisional 94.27
COG2884223 FtsE Predicted ATPase involved in cell division [C 94.26
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.26
PRK09435332 membrane ATPase/protein kinase; Provisional 94.26
PRK09580248 sufC cysteine desulfurase ATPase component; Review 94.26
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.25
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.24
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.24
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.23
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.22
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.22
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.21
PRK13946184 shikimate kinase; Provisional 94.2
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.2
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 94.19
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 94.17
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 94.15
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.13
PRK14526211 adenylate kinase; Provisional 94.13
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.12
KOG1514767 consensus Origin recognition complex, subunit 1, a 94.12
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.1
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.09
PRK13948182 shikimate kinase; Provisional 94.09
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.08
PRK14528186 adenylate kinase; Provisional 94.08
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 94.07
COG0703172 AroK Shikimate kinase [Amino acid transport and me 94.07
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.06
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.05
PRK13768253 GTPase; Provisional 94.04
PRK14531183 adenylate kinase; Provisional 94.03
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 94.0
PRK14529223 adenylate kinase; Provisional 93.98
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 93.97
PRK01184184 hypothetical protein; Provisional 93.96
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 93.89
PRK13230279 nitrogenase reductase-like protein; Reviewed 93.88
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 93.87
PRK09280463 F0F1 ATP synthase subunit beta; Validated 93.85
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 93.85
cd02117212 NifH_like This family contains the NifH (iron prot 93.84
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 93.83
KOG0927614 consensus Predicted transporter (ABC superfamily) 93.81
PRK05057172 aroK shikimate kinase I; Reviewed 93.81
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.8
PRK13975196 thymidylate kinase; Provisional 93.79
COG0488530 Uup ATPase components of ABC transporters with dup 93.78
PRK00409782 recombination and DNA strand exchange inhibitor pr 93.77
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.75
PLN02459261 probable adenylate kinase 93.74
COG3910233 Predicted ATPase [General function prediction only 93.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.68
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 93.68
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 93.68
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 93.68
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 93.67
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 93.66
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.66
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.6
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.58
PF1324576 AAA_19: Part of AAA domain 93.58
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.53
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 93.52
cd02034116 CooC The accessory protein CooC, which contains a 93.52
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.51
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 93.51
PRK14738206 gmk guanylate kinase; Provisional 93.5
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 93.5
COG4618580 ArpD ABC-type protease/lipase transport system, AT 93.5
PLN02318656 phosphoribulokinase/uridine kinase 93.5
PRK15453290 phosphoribulokinase; Provisional 93.49
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 93.47
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 93.47
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 93.47
PRK05439311 pantothenate kinase; Provisional 93.45
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.43
PRK14530215 adenylate kinase; Provisional 93.42
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=8.7e-98  Score=938.73  Aligned_cols=818  Identities=31%  Similarity=0.521  Sum_probs=655.9

Q ss_pred             ChHHHHhHhcCCCCeEEEEEEcCCcchHHHHHHHHHHHHhCCCCeeEEEEec--hh---hhcc------CChHHHHHHHH
Q 002458            1 MEKMNGYLEAGLDDVRFIGICGMGGIGKTTLAKVLYNTLKDQFEASSFLANV--RE---VSVT------RGLVPLQEQLL   69 (919)
Q Consensus         1 l~~l~~~L~~~~~~~~vv~I~G~gGiGKTtLA~~v~~~~~~~f~~~~~~~~~--~~---~s~~------~~l~~l~~~ll   69 (919)
                      +++|.++|..+.+++++||||||||+||||||+++|+++..+|++.+|+.+.  +.   ....      .....++++++
T Consensus       193 l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l  272 (1153)
T PLN03210        193 IAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFL  272 (1153)
T ss_pred             HHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHH
Confidence            3678888888888999999999999999999999999999999999998642  11   1110      11345677888


Q ss_pred             HHHhcccCccccchhhhHHHHHHHHcCCcEEEEEeCCCCHHHHHHHhcCCCCCCCCcEEEEEeCChhhHhhhCCCceEEc
Q 002458           70 SEVLMERDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVTNTYKV  149 (919)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~i~~~L~~kk~LlVlDdv~~~~~l~~l~~~~~~~~~gsrIIiTTR~~~~~~~~~~~~~~~v  149 (919)
                      .+++...+.....    ...++++++++|+||||||||+.++|+.+.+...|+++|||||||||+++++..++++++|+|
T Consensus       273 ~~il~~~~~~~~~----~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v  348 (1153)
T PLN03210        273 SEILDKKDIKIYH----LGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEV  348 (1153)
T ss_pred             HHHhCCCCcccCC----HHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEe
Confidence            8776655443322    356788999999999999999999999999988999999999999999999988888899999


Q ss_pred             CCCCHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHhCCchhHHHHHHhhccCCCHHHHHHHHHHHhcCCChhHHHHHHh
Q 002458          150 RGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRI  229 (919)
Q Consensus       150 ~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~i~~~~~GlPLal~~l~~~L~~~~~~~w~~~l~~l~~~~~~~i~~~l~~  229 (919)
                      +.++++||++||+++||++..+++++.+++++|+++|+|+||||+++|++|++++.++|+++++++++..+.+|..+|++
T Consensus       349 ~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~  428 (1153)
T PLN03210        349 CLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRV  428 (1153)
T ss_pred             cCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHH
Confidence            99999999999999999988888889999999999999999999999999999999999999999999888999999999


Q ss_pred             hhccCCh-hhHHHhhhhccccCCCCHHHHHHHHhhcCCCchhhHHHHhhcCCeEEeCCEEeehHHHHHHhHhhhhccCCC
Q 002458          230 SYDGLDR-RDKEIFLDIACFFKGKDEDRVRKKLDSCGFNSDIGIRELLDKSLITIVNNKLWMHDLLQEMGWEIVREHHSD  308 (919)
Q Consensus       230 sy~~L~~-~~k~~fl~~a~f~~~~~~~~l~~~~~~~g~~~~~~l~~L~~~sLi~~~~~~~~mHdli~~~~~~i~~~e~~~  308 (919)
                      ||++|++ .+|.||+++||||.+.+.+.+..++..+++.++.+++.|++++||++..+++.|||++|+||++++++++ .
T Consensus       429 SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~  507 (1153)
T PLN03210        429 SYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-N  507 (1153)
T ss_pred             hhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-C
Confidence            9999986 5899999999999999999999999999999999999999999999998999999999999999999998 7


Q ss_pred             CCCCeeeccCchhHHHHHhcCcCCCcEEEEEeeCC--CccccChhhhcCCCCCcEEEecCc----------ccCCCcccc
Q 002458          309 KPGKWSRLWLYKDVYHVLSKYMGTDAVEAIIVDVP--EMTELEAKSFSTMSNLRLLEINNL----------YSSGNLEYL  376 (919)
Q Consensus       309 ~p~~~~rl~~~~d~~~vl~~~~~~~~v~~l~l~~~--~~~~~~~~~f~~l~~L~~L~l~~~----------~l~~~~~~~  376 (919)
                      +|++|+|+|.++|+++++.+++|++.+++|.++.+  ....+...+|.+|++|+.|.+..+          ++++.+...
T Consensus       508 ~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~l  587 (1153)
T PLN03210        508 EPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL  587 (1153)
T ss_pred             CCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhc
Confidence            89999999999999999999999999999999987  456688899999999999999654          244556667


Q ss_pred             CCCcceEEeeCCCCCCCCCCCCCCCcEEEEccCCCCccccccccCCCCCcEEecCCCCCCCcCCCCCCCCccceeeccCc
Q 002458          377 SNNLRYLKWHEYPFNSLPVSFRPEKLFKLNLCNSRIKYLWKGIKPLKELKFMNLSHSCNLIRTPDFTGVPNLERLNLEGC  456 (919)
Q Consensus       377 ~~~L~~L~~~~~~~~~lp~~~~~~~L~~L~L~~n~i~~l~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~L~~L~L~~~  456 (919)
                      +.+|+.|+|.+++++.+|..|.+.+|++|+|++|+++.+|.++..+++|+.|+|++|..+..+|+++.+++|++|+|++|
T Consensus       588 p~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c  667 (1153)
T PLN03210        588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDC  667 (1153)
T ss_pred             CcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCC
Confidence            78999999999999999999999999999999999999999999999999999999988899999999999999999999


Q ss_pred             cccccccccccCccccceecccccccccccCccccCCCCCcEEEecCcCCCCcCcccccCCCCCcEeecCCCcccccCcc
Q 002458          457 TRLLEVHQSVGTLKRLILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVECLEELDVGGTAIRQIPPS  536 (919)
Q Consensus       457 ~~~~~~p~~l~~l~~L~~L~L~~n~~~~~lp~~i~~l~~L~~L~Ls~~~~~~~lp~~l~~l~~L~~L~L~~n~i~~lp~~  536 (919)
                      ..+..+|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..++.+|..   .++|+.|++++|.++.+|..
T Consensus       668 ~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~  743 (1153)
T PLN03210        668 SSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSN  743 (1153)
T ss_pred             CCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCcccccccc
Confidence            9999999999999999999999999999999877 8999999999999988888864   45789999999999988875


Q ss_pred             ccCCCCCcEE-------------------------------EeCCCCCCCCCCCcchhhcccccCC-CCCCCccccCCCC
Q 002458          537 IVQLVNLKIF-------------------------------SLHGCKGQPPKILSSNFFLSLLLPN-KNSDSMCLSFPRF  584 (919)
Q Consensus       537 l~~l~~L~~L-------------------------------~L~~~~~~~~~~~~~~~~~~l~~~~-~~~~~~~~~~~~l  584 (919)
                      + .+++|+.|                               ++++|......+.+...+..+..+. .++... ..+|..
T Consensus       744 ~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L-~~LP~~  821 (1153)
T PLN03210        744 L-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINL-ETLPTG  821 (1153)
T ss_pred             c-cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCc-CeeCCC
Confidence            4 34444444                               4444432222222222222221111 111111 223443


Q ss_pred             CCCCCCcEEecCCCCCCCCCCCcccCCCCCCCeeeCCCCCCccCcHhhhccCCCcEEecCcCccCCcCCCCC---CcccE
Q 002458          585 TGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFFSLPSSINQLLKLKILCLEKCRNLKSLPELP---PEIVF  661 (919)
Q Consensus       585 ~~l~~L~~L~Ls~n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~lp---~~L~~  661 (919)
                      .++++|+.|+|++|..+. .+|.   ...+|+.|+|++|.++.+|.++..+++|+.|+|++|+.++.+|..+   ++|+.
T Consensus       822 ~~L~sL~~L~Ls~c~~L~-~~p~---~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~  897 (1153)
T PLN03210        822 INLESLESLDLSGCSRLR-TFPD---ISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLET  897 (1153)
T ss_pred             CCccccCEEECCCCCccc-cccc---cccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCe
Confidence            356666666666665332 2333   2357889999999999999999999999999999999999988654   56778


Q ss_pred             eeccCCCccceeccccccc------------CCCCceeEecccccchhhhhhhhHHHHHHHHHHhhcCCCCCCceEEecC
Q 002458          662 VGAEDCTSLETISAFAKLS------------RSPNIALNFLNCFKLVEDQVSKDNLAVTLMKQWLLEVPNCSSQFHIFLP  729 (919)
Q Consensus       662 L~~~~c~~L~~l~~~~n~~------------~~~~~~~~~~~~~~L~~l~ls~N~l~~~~~~~~~~~~~~~~~~~~~~l~  729 (919)
                      +++++|++|+.+++.....            ........|.+|.+|..--+             .   ........+.+|
T Consensus       898 L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~-------------l---~~~~~~~~~~l~  961 (1153)
T PLN03210        898 VDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL-------------L---QQQSIFKQLILS  961 (1153)
T ss_pred             eecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhh-------------h---cccccceEEECC
Confidence            8999999999876643210            11123456788888742111             0   111224467899


Q ss_pred             CCCCCCccccccCCceEE-EEcCC---CCCeeeEEEEEEEecCCCCC-CcccceEEEEEeCCCcceeeEeeCCCccccCC
Q 002458          730 GNEIPRWFRFRNIGGSVT-MTAPR---LDNFIGFAVCAVLSLPRCMD-RFYSEIQCKLLWGEDDYKFSVAIPSFTTLESD  804 (919)
Q Consensus       730 g~~iP~wf~~~~~g~sv~-~~lp~---~~~~~g~~~c~v~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  804 (919)
                      |.++|+||.||+.|++++ |.+|+   ...|.||++|+|+++..... .....+.|.|.+.+..- ...     ....++
T Consensus       962 g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~-~~~-----~~~~~~ 1035 (1153)
T PLN03210        962 GEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLG-NHF-----DSPYQP 1035 (1153)
T ss_pred             CccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCC-Ccc-----ccCCCc
Confidence            999999999999999998 99987   45799999999998766432 22346677777765210 000     011355


Q ss_pred             cEEEEEeCccchh----------h---hhcCCCceEEEEEEEecccCCccEEEEeeEEEEEeccc
Q 002458          805 HLWLAYLPRETFK----------T---QCFRGLTKASFNIFYMGEEFRNASVKMCGVVSLYMEVE  856 (919)
Q Consensus       805 h~~~~~~~~~~~~----------~---~~~~~~~~~~~~~~~~~~~~~~~~vk~cGv~l~~~~~e  856 (919)
                      |+|+.|....++.          +   ....++++++++|.++... ..++||+|||+++|+++.
T Consensus      1036 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~-~~~~~~~cg~~~~~~~~~ 1099 (1153)
T PLN03210       1036 HVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKN-SQLKLKGCGIRLSEDDSS 1099 (1153)
T ss_pred             eeEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCC-CCeEEEeeeEEEeccCCC
Confidence            5555554432211          1   1122456677888665422 347999999999996643

syringae 6; Provisional
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query919
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-43
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-33
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-40
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 6e-40
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  162 bits (412), Expect = 2e-44
 Identities = 62/313 (19%), Positives = 107/313 (34%), Gaps = 43/313 (13%)

Query: 358 NLRLLEINNLYSSGNLEYLSNNLRYLKWHEYPFNSLPVSF-RPEKLFKLNLCNSRIKYLW 416
           +    E      S  L    + L   + H     +   S  R        +     + L 
Sbjct: 10  HSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALK 69

Query: 417 KGIKPLKELKFMNLSH---SCNLIRT--PDFTGVPNLERLNLEGCTRLLEVHQSVGTLKR 471
                L++               +         + +L+ + ++    L+E+  ++     
Sbjct: 70  ATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQFAG 128

Query: 472 LILLNLKDCRNLVSFPKNVCLMKSLKILCLCGCLKLEKLPQDLGEVE---------CLEE 522
           L  L L     L + P ++  +  L+ L +  C +L +LP+ L   +          L+ 
Sbjct: 129 LETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQS 187

Query: 523 LDVGGTAIRQIPPSIVQLVNLKIFSLHGCKGQPPKILSSNFFLSLLLPNKNSDSMCLSFP 582
           L +  T IR +P SI  L NLK   +          LS+       L      ++     
Sbjct: 188 LRLEWTGIRSLPASIANLQNLKSLKIRNSP------LSA-------LG----PAIH---- 226

Query: 583 RFTGLSSLQTLDLSDCNLLEGAIPSDIGSLFSLEAIDLSGNNFF-SLPSSINQLLKLKIL 641
               L  L+ LDL  C  L    P   G    L+ + L   +   +LP  I++L +L+ L
Sbjct: 227 ---HLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL 282

Query: 642 CLEKCRNLKSLPE 654
            L  C NL  LP 
Sbjct: 283 DLRGCVNLSRLPS 295
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 919
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 8e-41
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  149 bits (377), Expect = 8e-41
 Identities = 34/238 (14%), Positives = 73/238 (30%), Gaps = 17/238 (7%)

Query: 8   LEAGLDDVRFIGICGMGGIGKTTLAKVLYN----TLKDQFEASSFLANVREVSVTRGLVP 63
            E    D  F+ + G  G GK+ +A    +     +   +++  +L +      +   + 
Sbjct: 37  DEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLF 96

Query: 64  LQEQLLSEVLME-----RDLIIWDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGN 118
               L+ +   +         +  V     +    + R   L + DDV Q E        
Sbjct: 97  TDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEET------I 150

Query: 119 HDWFGFGSRIIITSRDEHVLKS-HGVTNTYKVRGLDYVEALQLFHLKVSNGKQPTDYRVE 177
                   R ++T+RD  +  +        +V  L+  E                    +
Sbjct: 151 RWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEE-D 209

Query: 178 LSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLRISYDGLD 235
           +    +  + G P  + +       ++ E+     N+L+      V  +   SY  L 
Sbjct: 210 VLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLA 267
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query919
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.76
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.32
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.98
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.88
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.86
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.85
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.84
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.81
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.79
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.76
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.72
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.65
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.62
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.61
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.61
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.53
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.51
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.47
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.43
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.4
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.25
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.25
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d2qy9a2211 GTPase domain of the signal recognition particle r 97.58
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.57
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.41
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.41
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.39
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.35
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.34
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.34
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.34
d1vmaa2213 GTPase domain of the signal recognition particle r 97.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.3
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.3
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.29
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.28
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.25
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.24
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.23
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 97.2
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.17
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.16
d1okkd2207 GTPase domain of the signal recognition particle r 97.15
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.13
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 97.11
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.09
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.06
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.04
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.02
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 97.02
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.01
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.0
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.0
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.0
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.99
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.98
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.97
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.96
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 96.95
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.93
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.92
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.9
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.88
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.87
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.82
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.82
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.76
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.74
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.74
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.7
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.67
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.67
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.64
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.64
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.62
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.62
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.61
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.58
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.57
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.57
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.56
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.54
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.51
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.51
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.48
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.46
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.43
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.4
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.38
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.32
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.29
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.24
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 96.2
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.2
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.17
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.13
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.11
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.09
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.03
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.99
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.97
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.94
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.88
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.87
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.86
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.56
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.54
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.54
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.54
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.52
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 95.51
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.49
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.45
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.44
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.44
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.33
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.11
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.08
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.0
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.88
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.84
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 94.74
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.72
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.7
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.65
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.65
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.57
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.45
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.36
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.31
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.25
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.21
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.16
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.13
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.12
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.01
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.99
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 93.98
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.97
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.89
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.89
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.7
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.55
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.33
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.27
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.27
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.15
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.04
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.04
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.03
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.89
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.85
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.85
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.82
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.78
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.76
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.72
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.72
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.68
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.67
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.64
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.57
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.48
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.48
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.48
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.42
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.41
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.4
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.32
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.32
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.32
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.27
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.26
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.21
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 92.21
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 92.2
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.2
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 92.2
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.16
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.15
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.14
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.11
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.1
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.07
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.06
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.02
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.98
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.96
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.94
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.94
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.93
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.8
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.78
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.66
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.53
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.49
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.45
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.41
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.36
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.33
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 91.32
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.3
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.23
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.2
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.2
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.01
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.01
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.9
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.88
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.81
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.8
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.57
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.57
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.5
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 90.47
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.44
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 90.28
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.99
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.8
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.73
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.56
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.37
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.94
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.94
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.66
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.96
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.92
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 86.83
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.24
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 85.9
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 84.46
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.47
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 83.3
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 82.43
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 81.0
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 80.31
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=1.4e-43  Score=275.54  Aligned_cols=237  Identities=16%  Similarity=0.129  Sum_probs=186.2

Q ss_pred             CHHHHHHHHC-CCCCEEEEEEECCCCCHHHHHHHHHHHH----HHCCCCEEEEEEECHHHHCCCCHHHHHHHHHHHHHCC
Q ss_conf             9577895705-9998299999927951399999999999----8278980599884312330279599999999978335
Q 002458            1 MEKMNGYLEA-GLDDVRFIGICGMGGIGKTTLAKVLYNT----LKDQFEASSFLANVREVSVTRGLVPLQEQLLSEVLME   75 (919)
Q Consensus         1 l~~l~~lL~~-~~~~~~vv~I~G~gGiGKTtLA~~~~~~----~~~~f~~~~~~~~~~~~~~~~~l~~l~~~ll~~~~~~   75 (919)
                      +++|.++|.. .+.+.++|+|+|||||||||||+++|++    ....|++++|+...+..+ ...+......++......
T Consensus        29 ~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~-~~~l~~~~~~~~~~~~~~  107 (277)
T d2a5yb3          29 VDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP-KSTFDLFTDILLMLKSED  107 (277)
T ss_dssp             HHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST-THHHHHHHHHHHHHTTTS
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCC-HHHHHHHHHHHHHHHCCH
T ss_conf             9999999873468784089997799788899999999855655401276489999368777-778999999999872202


Q ss_pred             CCCCC------CCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHCCCCCCCCCCEEEEEECCHHHHHHHCCC-CEEE
Q ss_conf             68632------4413239999999759919999908999798999843988889993999991884567650978-4698
Q 002458           76 RDLII------WDVHKGINLIRWRLCRKRVLVILDDVDQLEQLQALVGNHDWFGFGSRIIITSRDEHVLKSHGVT-NTYK  148 (919)
Q Consensus        76 ~~~~~------~~~~~~~~~i~~~l~~~k~LiVlDdv~~~~~l~~l~~~~~~~~~gs~IiiTTR~~~~~~~~~~~-~~~~  148 (919)
                      .....      .+.......+.+.+.++|+|+|+||||+.++++.+..      .||+||||||++.++...... +.|+
T Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~  181 (277)
T d2a5yb3         108 DLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIE  181 (277)
T ss_dssp             CCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEE
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHCC------CCCEEEEEEEHHHHHHHCCCCCCEEE
T ss_conf             202786321233699999999998446881675250667766555204------57559999644899986378871687


Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             18999799999999873189999926999999999992992469999972306889789999998873499835998998
Q 002458          149 VRGLDYVEALQLFHLKVSNGKQPTDYRVELSKYVVNYAGGLPLAIEVLGSFLCGRSVEEWKSALNRLQEAPNEKVLKVLR  228 (919)
Q Consensus       149 l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~i~~~~~G~PLal~~l~~~L~~~~~~~w~~~l~~l~~~~~~~i~~~l~  228 (919)
                      +++|+.+||++||++++|....+. ...+++++|+++|+|+|||++++|+.++.++.+.|....+++.......+..++.
T Consensus       182 l~~L~~~ea~~Lf~~~~~~~~~~~-~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~  260 (277)
T d2a5yb3         182 VTSLEIDECYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITP  260 (277)
T ss_dssp             CCCCCHHHHHHHHHHTSCCCC--C-HHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSS
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCH-HHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             788997999999999847766742-5679999999995899899999999865598999999999973486788999999


Q ss_pred             HHHCCCCHHHHHHHHHH
Q ss_conf             61305872457776431
Q 002458          229 ISYDGLDRRDKEIFLDI  245 (919)
Q Consensus       229 ~sy~~L~~~~k~~fl~~  245 (919)
                      .||+.|+++.|.||-.+
T Consensus       261 ~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         261 YSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             SSSSSHHHHHHHHHHTS
T ss_pred             HHHHCCCHHHHHHHHHC
T ss_conf             98851269999999739
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure