Citrus Sinensis ID: 002559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------91
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccccccccccccccccEEEccEEccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccccccEEEEEcccHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccHHHccccccHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHcccccccHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccHHccccEEEEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccccEEEEEEccHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHccEEEccccccEEEEHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHcccccEEEEEEEEEEEEcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHcc
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHayklhnpqldHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKvkaeqgypissKSKFLRKLLEQEETHQVILIVGLSGIGKSCLarqvasdpperfvggavelgfgqwcsraacngskSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLErcghhpltVAVMGKALRKELRSEKWEKAITDLstfatcapgpvsyvnekeaentltifgsfefsleamprDSRRLFIALAAlswaepvpEACLEAIWSILVQKSLFSLAVCKLVegsllmkddtdplyqvHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRIcfsgilgpriadlisrdsqslTVVSAEAITNIfskgdycsyipslettGAVDKLAGLlqksedpmiqTDILTVLTKlaefgtpetvdkvlqsipfdklaTLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYElagspanaslrpanlnllPWQVRLRLERFIisdrtvppspksqtFEDVIHRLLdgdnkqvqgATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQyahpeqnsvrsESAFLLTKLAcaggepcikkfLEYDIIPELVKMMQCCvpeiqdsayaapdVLQQWWTTCLG
MDALQVVSAATQIVTSMVGAVHALEQAsrnldeapkrIRSLEDFVCDLENLMRRIKQKHayklhnpqldhQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTaqevptrlkvkaeqgypissKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAklydndckylVTTRneavyeiteaekvelskddIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIisdrtvppspksqTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHsllaeeelpaaaeslleRCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAeekvelslsvseeklvIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
******VSAATQIVTSMVGAVHAL*************IRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDR**********FEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHP****VRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCL*
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRK***************VVWTSMA**********INDD************************************YPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLV****************YLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLI**************FLIFGK*N***IA*EKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLEN*SEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIIS*********SQTFEDVIHRLLDGDNKQVQGATQDLIPFLE*****KIRDMIIKSPLIAKLSELL**************AFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
********AATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
MDALQVVSAA*QIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAHPEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query908 2.2.26 [Sep-21-2011]
Q9LQ54870 Probable disease resistan no no 0.265 0.277 0.244 9e-09
Q9I9H8 1261 Apoptotic protease-activa yes no 0.349 0.251 0.242 3e-08
Q8W3K0 1138 Probable disease resistan no no 0.265 0.211 0.261 7e-08
O04093727 Putative inactive disease no no 0.253 0.316 0.229 8e-08
A7XGN8910 Disease susceptibility pr no no 0.251 0.250 0.231 1e-07
A9QGV6910 Inactive disease suscepti no no 0.251 0.250 0.227 1e-07
Q9FJB5901 Disease resistance RPP8-l no no 0.268 0.270 0.244 2e-07
Q42484909 Disease resistance protei no no 0.287 0.287 0.241 3e-07
P60838894 Probable disease resistan no no 0.227 0.231 0.240 4e-07
O64789925 Probable disease resistan no no 0.253 0.248 0.230 5e-07
>sp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g59620 OS=Arabidopsis thaliana GN=At1g59620 PE=2 SV=3 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 128/290 (44%), Gaps = 49/290 (16%)

Query: 168 KFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQ--WCSRAA 225
           K +  L+E E++ QV+ I G+ GIGK+ LARQV       F    V+  F Q  W     
Sbjct: 148 KLVGHLVEVEDSSQVVSITGMGGIGKTTLARQV-------FNHETVKSHFAQLAW----V 196

Query: 226 CNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALY----GKSILILL 281
           C          ++++ ++  V     +K+  E   LE     LQE L+     +  LI+L
Sbjct: 197 C----------VSQQFTRKYVWQTILRKVGPEYIKLEMTEDELQEKLFRLLGTRKALIVL 246

Query: 282 DDVWEQ---DIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLY 338
           DD+W +   D++E    L     K L+T+RNE V  +       + K D +   +S  ++
Sbjct: 247 DDIWREEDWDMIEPIFPL-GKGWKVLLTSRNEGV-ALRANPNGFIFKPDCLTPEESWTIF 304

Query: 339 HSLL----------AEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDL 388
             ++           +E++    + +++ CG  PL + V+G  L      ++W++   ++
Sbjct: 305 RRIVFPGENTTEYKVDEKMEELGKQMIKHCGGLPLALKVLGGLLVVHFTLDEWKRIYGNI 364

Query: 389 STFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAAL 438
            +      G  S+ N+K   N  +++     S E +P   +  F+ LA  
Sbjct: 365 KSHIV---GGTSF-NDK---NMSSVYHILHLSFEELPIYLKHCFLYLAQF 407
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K0|DRL9_ARATH Probable disease resistance protein At1g58602 OS=Arabidopsis thaliana GN=At1g58602 PE=2 SV=1 Back     alignment and function description
>sp|O04093|LOV1A_ARATH Putative inactive disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=5 SV=3 Back     alignment and function description
>sp|A7XGN8|LOV1B_ARATH Disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=1 SV=1 Back     alignment and function description
>sp|A9QGV6|LOV1C_ARATH Inactive disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=3 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query908
359482679 1046 PREDICTED: uncharacterized protein LOC10 0.985 0.855 0.755 0.0
224058687 1043 NBS resistance protein [Populus trichoca 0.985 0.858 0.749 0.0
147862186 1076 hypothetical protein VITISV_020212 [Viti 0.980 0.827 0.756 0.0
224073738 1047 NBS resistance protein [Populus trichoca 0.985 0.854 0.739 0.0
357139876 1042 PREDICTED: uncharacterized protein LOC10 0.984 0.857 0.566 0.0
297598787 1078 Os02g0203500 [Oryza sativa Japonica Grou 0.984 0.829 0.570 0.0
46390095 1040 hypothetical protein [Oryza sativa Japon 0.984 0.859 0.570 0.0
413926182 1041 hypothetical protein ZEAMMB73_778765 [Ze 0.984 0.858 0.564 0.0
242064446 1017 hypothetical protein SORBIDRAFT_04g00710 0.952 0.850 0.532 0.0
125538532 1036 hypothetical protein OsI_06295 [Oryza sa 0.895 0.784 0.572 0.0
>gi|359482679|ref|XP_003632806.1| PREDICTED: uncharacterized protein LOC100261821 [Vitis vinifera] gi|297743414|emb|CBI36281.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1405 bits (3637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/896 (75%), Positives = 778/896 (86%), Gaps = 1/896 (0%)

Query: 1   MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHA 60
           MDALQV+++ATQIV+ MVGA+ ALEQASRNLDEAPKR+RSLEDFVCDLENL +RIKQKHA
Sbjct: 1   MDALQVIASATQIVSGMVGAISALEQASRNLDEAPKRVRSLEDFVCDLENLTQRIKQKHA 60

Query: 61  YKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNS 120
           YKLHNPQL++Q++SLNSLIERLHP IRKARR+VSKS+ KNLA VVWTS+AGDPL KL+NS
Sbjct: 61  YKLHNPQLEYQIQSLNSLIERLHPNIRKARRIVSKSRAKNLAKVVWTSVAGDPLEKLVNS 120

Query: 121 INDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETH 180
           I DDLNWWLESQ LA +VEKVIE TA+ +P RLK+K EQGYPISSK  F+R LLEQ+ +H
Sbjct: 121 IRDDLNWWLESQRLAGSVEKVIESTARTIPVRLKIKPEQGYPISSKCNFVRTLLEQDSSH 180

Query: 181 QVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARK 240
           +VILIVGLSGIGK CLARQVA+DPP +FV GAVELGFGQWCSRAACN SK  YQ+RLARK
Sbjct: 181 RVILIVGLSGIGKLCLARQVAADPPMKFVDGAVELGFGQWCSRAACNESKDKYQRRLARK 240

Query: 241 ISKFLVQIGFWKKIKDENS-DLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN 299
           I KFLVQIGFWKKI+DENS DLEY+CCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN
Sbjct: 241 ICKFLVQIGFWKKIRDENSGDLEYMCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN 300

Query: 300 DCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCG 359
           +C YLVTTRNEAVYEITEA+KVEL+KDDI EISK+ILLYHS L+EEE+P  AESLLERCG
Sbjct: 301 NCSYLVTTRNEAVYEITEAQKVELNKDDIKEISKAILLYHSHLSEEEVPGVAESLLERCG 360

Query: 360 HHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEF 419
           HHPLTVAVMGKALRKE+R+EKWEKAI +LST+ATCAPGP+SYVNEKEAENTLTIF SFEF
Sbjct: 361 HHPLTVAVMGKALRKEIRAEKWEKAIINLSTYATCAPGPISYVNEKEAENTLTIFRSFEF 420

Query: 420 SLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDD 479
           SLEAMP DSRRLFIALAALSWAEPVPEACLE++WS++ Q +LF L VCKLVEGSLLMK D
Sbjct: 421 SLEAMPEDSRRLFIALAALSWAEPVPEACLESVWSVVGQDNLFPLVVCKLVEGSLLMKTD 480

Query: 480 TDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVEL 539
           + PLYQVHDMVSLYLD +T+DS+++L++    E IAFI PW L FGKE +K IAE++ E 
Sbjct: 481 SFPLYQVHDMVSLYLDCRTHDSVKILLSESSPERIAFISPWLLTFGKETVKQIAEQRTEF 540

Query: 540 SLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVS 599
            LS  EEK   IT+EAI+QALMAS+SISELE SR  FS ILGPRI +LIS +SQ L  V+
Sbjct: 541 CLSGLEEKQAAITLEAIIQALMASESISELEASRASFSSILGPRIENLISSNSQDLIAVT 600

Query: 600 AEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPET 659
           AEA+T IFSK DY  Y PSLETTGAV+KLA +L+  ED MIQT+I  VL KLAEFG+ +T
Sbjct: 601 AEAVTIIFSKSDYQKYFPSLETTGAVEKLASILENCEDLMIQTNISIVLAKLAEFGSLDT 660

Query: 660 VDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLL 719
           VDKVLQSI  ++LA LLS + +EWHE++FT LMSL K GK  A+E+M+A EIDK+LIKLL
Sbjct: 661 VDKVLQSILINQLADLLSPNNEEWHESVFTTLMSLIKAGKLNAIERMYALEIDKSLIKLL 720

Query: 720 ENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSP 779
           E+GSEV QHHAIVTLKAFYE+ G PAN SL+P NLNLLPWQ RL LERF++SD ++P +P
Sbjct: 721 ESGSEVAQHHAIVTLKAFYEVGGPPANGSLQPGNLNLLPWQARLSLERFVLSDISIPLAP 780

Query: 780 KSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGELKIRDMIIKSPLIAKLSELLQYAH 839
           K QTFE +IH+LLD D KQV  A QDLIP +EKAG+ +IR MI++SPLI +LSELLQY H
Sbjct: 781 KPQTFEYLIHKLLDHDIKQVLEAMQDLIPIVEKAGDSRIRKMILQSPLIKRLSELLQYGH 840

Query: 840 PEQNSVRSESAFLLTKLACAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAA 895
            EQN++RSESAFLLTKLAC+GGEPCIKKFLE+DIIPELVK+M C  PE+QDS+Y A
Sbjct: 841 SEQNTIRSESAFLLTKLACSGGEPCIKKFLEHDIIPELVKLMHCNAPELQDSSYTA 896

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224058687|ref|XP_002299603.1| NBS resistance protein [Populus trichocarpa] gi|222846861|gb|EEE84408.1| NBS resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147862186|emb|CAN82596.1| hypothetical protein VITISV_020212 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224073738|ref|XP_002304149.1| NBS resistance protein [Populus trichocarpa] gi|222841581|gb|EEE79128.1| NBS resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357139876|ref|XP_003571502.1| PREDICTED: uncharacterized protein LOC100841952 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297598787|ref|NP_001046239.2| Os02g0203500 [Oryza sativa Japonica Group] gi|255670696|dbj|BAF08153.2| Os02g0203500 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|46390095|dbj|BAD15512.1| hypothetical protein [Oryza sativa Japonica Group] gi|46390511|dbj|BAD15999.1| hypothetical protein [Oryza sativa Japonica Group] gi|125581217|gb|EAZ22148.1| hypothetical protein OsJ_05811 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|413926182|gb|AFW66114.1| hypothetical protein ZEAMMB73_778765 [Zea mays] Back     alignment and taxonomy information
>gi|242064446|ref|XP_002453512.1| hypothetical protein SORBIDRAFT_04g007100 [Sorghum bicolor] gi|241933343|gb|EES06488.1| hypothetical protein SORBIDRAFT_04g007100 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|125538532|gb|EAY84927.1| hypothetical protein OsI_06295 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query908
ZFIN|ZDB-GENE-000616-4 1264 apaf1 "apoptotic protease acti 0.346 0.249 0.232 4.9e-08
UNIPROTKB|J9NS21 1250 APAF1 "Apoptotic protease-acti 0.333 0.242 0.229 1.8e-05
UNIPROTKB|F1MUW4 1251 APAF1 "Uncharacterized protein 0.333 0.242 0.217 4.9e-05
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.252 0.236 0.237 6.1e-05
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.223 0.239 0.276 6.4e-05
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.270 0.273 0.244 6.6e-05
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.238 0.284 0.236 0.00019
RGD|620575 1249 Apaf1 "apoptotic peptidase act 0.359 0.261 0.208 0.00022
TAIR|locus:2175070 1114 AT5G41740 [Arabidopsis thalian 0.262 0.213 0.25 0.00029
UNIPROTKB|F1SQT5 1249 APAF1 "Uncharacterized protein 0.330 0.240 0.215 0.00036
ZFIN|ZDB-GENE-000616-4 apaf1 "apoptotic protease activating factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 4.9e-08, P = 4.9e-08
 Identities = 80/344 (23%), Positives = 148/344 (43%)

Query:   170 LRKLLEQ-EETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAA 225
             +R++L +  +T   + + G++G GKS +A +V  D     E F  G   L  GQ C RA 
Sbjct:   137 IREMLYRLRDTPGWVTVFGMAGSGKSVMAAEVVRDRSLIKECFPDGVHWLSVGQ-CERAD 195

Query:   226 CNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVW 285
                       RL +  S    Q      +++    L +L  +L+   + +S+LIL DDVW
Sbjct:   196 LLVRMQSLCFRLEQCQSSDTSQRPP-STVEEAKERLRFL--MLRR--FPRSLLIL-DDVW 249

Query:   286 EQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKS--ILLYHXXXX 343
             +   +  F    D  C+ L+TTRN A+ +     + E+  ++ ++  K+  IL  +    
Sbjct:   250 DSSSLRSF----DIQCRVLLTTRNRALTDSVSGVRYEVPVENGLDEEKALEILALYVNGK 305

Query:   344 XXXXXXXXXXXXXRCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVN 403
                           C   PL V+++G AL +E   ++W   +  L             + 
Sbjct:   306 MHKLPEQARSIVSECKGSPLVVSLIG-ALLREF-PDRWSYYLRQLQQ------KQFKRIR 357

Query:   404 EKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFS 463
             +  + +   +  + + SL+ +  + + L+  L+ +     VP   L  +W + +++    
Sbjct:   358 KSSSYDYEALDQAMDASLQVLEAEHQELYRDLSVMQKDIKVPAKVLSVLWGLELEEVEDV 417

Query:   464 LAVCKLVEGSLLMKD-DTDPL-YQVHDMVSLYLDSKTNDSIQML 505
             L   + V  SLL +D +  P  Y +HD+   +L  +  D I  L
Sbjct:   418 LQ--EFVNKSLLFRDCNQRPYRYYLHDLQLDFLAEQNRDQIAEL 459
GO:0042981 "regulation of apoptotic process" evidence=IEA
GO:0006952 "defense response" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006915 "apoptotic process" evidence=IEA
UNIPROTKB|J9NS21 APAF1 "Apoptotic protease-activating factor 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUW4 APAF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|620575 Apaf1 "apoptotic peptidase activating factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2175070 AT5G41740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQT5 APAF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_I000446
NBS resistance protein (1043 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query908
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-23
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  102 bits (255), Expect = 1e-23
 Identities = 71/283 (25%), Positives = 125/283 (44%), Gaps = 34/283 (12%)

Query: 164 SSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSR 223
                 + KLLE  +   V+ IVG+ G+GK+ LA+Q+ +D        +V   F    S 
Sbjct: 3   DMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-------SVGGHFD---SV 52

Query: 224 AACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDD 283
           A    SK+  + RL + I + L         K+E+     +     EAL  K  L++LDD
Sbjct: 53  AWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIK----EALLRKRFLLVLDD 108

Query: 284 VWEQDIVERFAKLY---DNDCKYLVTTRNEAV----YEITEAEKVE-LSKDDIMEISKSI 335
           VWE++  ++    +   +N  + +VTTR+E+V       ++  +VE L  ++  E+  + 
Sbjct: 109 VWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNK 168

Query: 336 LLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCA 395
           +    L    EL   A+ ++E+C   PL + V+G  L  +   ++WE  +  L+      
Sbjct: 169 VFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNE---- 224

Query: 396 PGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAAL 438
                 +NE        +      S + +P   +R F+ LA  
Sbjct: 225 LAGRDGLNE--------VLSILSLSYDNLPMHLKRCFLYLALF 259

Length = 285
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 908
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.47
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.24
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.87
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.84
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.83
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.82
PF05729166 NACHT: NACHT domain 98.65
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.6
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.45
COG3903414 Predicted ATPase [General function prediction only 98.43
PRK13342413 recombination factor protein RarA; Reviewed 98.33
PRK06893229 DNA replication initiation factor; Validated 98.3
COG3899849 Predicted ATPase [General function prediction only 98.23
PF13173128 AAA_14: AAA domain 98.13
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.12
PTZ001121164 origin recognition complex 1 protein; Provisional 98.11
PRK12402337 replication factor C small subunit 2; Reviewed 98.06
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 98.05
PRK13341725 recombination factor protein RarA/unknown domain f 98.04
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.98
PRK09087226 hypothetical protein; Validated 97.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.93
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 97.91
PLN03025319 replication factor C subunit; Provisional 97.91
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.9
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.89
PRK04195482 replication factor C large subunit; Provisional 97.86
KOG2028554 consensus ATPase related to the helicase subunit o 97.86
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.85
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.85
PRK08727233 hypothetical protein; Validated 97.84
PRK08084235 DNA replication initiation factor; Provisional 97.83
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.81
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.78
PRK05564313 DNA polymerase III subunit delta'; Validated 97.77
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 97.76
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.74
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.74
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.73
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.72
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.66
PRK00440319 rfc replication factor C small subunit; Reviewed 97.63
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.62
PRK14088440 dnaA chromosomal replication initiation protein; P 97.62
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.59
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.58
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.58
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.56
PRK09112351 DNA polymerase III subunit delta'; Validated 97.56
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.55
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.55
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.55
PF14516331 AAA_35: AAA-like domain 97.55
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.55
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.52
PRK05642234 DNA replication initiation factor; Validated 97.52
PHA02544316 44 clamp loader, small subunit; Provisional 97.49
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.48
PTZ00202550 tuzin; Provisional 97.48
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.46
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.45
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.44
smart00382148 AAA ATPases associated with a variety of cellular 97.43
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.42
PRK00149450 dnaA chromosomal replication initiation protein; R 97.41
PRK07940394 DNA polymerase III subunit delta'; Validated 97.4
PRK07471365 DNA polymerase III subunit delta'; Validated 97.39
PRK06620214 hypothetical protein; Validated 97.38
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.34
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.33
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.32
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.32
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.3
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.3
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.28
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.27
PRK08116268 hypothetical protein; Validated 97.25
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.24
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.23
PRK14087450 dnaA chromosomal replication initiation protein; P 97.23
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.22
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.21
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.19
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.15
PRK03992389 proteasome-activating nucleotidase; Provisional 97.15
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 97.14
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.13
cd01128249 rho_factor Transcription termination factor rho is 97.13
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.1
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.1
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.06
CHL00095821 clpC Clp protease ATP binding subunit 97.03
PRK05707328 DNA polymerase III subunit delta'; Validated 97.0
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 96.95
PF00004132 AAA: ATPase family associated with various cellula 96.94
PRK09376416 rho transcription termination factor Rho; Provisio 96.94
PRK14086617 dnaA chromosomal replication initiation protein; P 96.93
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 96.92
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.9
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.88
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 96.86
PRK12422445 chromosomal replication initiation protein; Provis 96.84
PRK10865857 protein disaggregation chaperone; Provisional 96.84
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.83
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.79
TIGR00763775 lon ATP-dependent protease La. This protein is ind 96.79
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.79
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.79
PRK10865857 protein disaggregation chaperone; Provisional 96.73
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.68
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.67
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.66
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.66
PRK06921266 hypothetical protein; Provisional 96.65
CHL00181287 cbbX CbbX; Provisional 96.62
PRK10536262 hypothetical protein; Provisional 96.6
PRK08181269 transposase; Validated 96.59
CHL00176638 ftsH cell division protein; Validated 96.55
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.51
TIGR00767415 rho transcription termination factor Rho. Members 96.5
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 96.49
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.49
COG0593408 DnaA ATPase involved in DNA replication initiation 96.48
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.47
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.46
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 96.44
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.38
PRK07261171 topology modulation protein; Provisional 96.33
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 96.32
PRK06835329 DNA replication protein DnaC; Validated 96.3
PRK06526254 transposase; Provisional 96.3
PRK12377248 putative replication protein; Provisional 96.29
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.27
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.26
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.26
PRK09183259 transposase/IS protein; Provisional 96.22
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 96.21
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.19
PRK07399314 DNA polymerase III subunit delta'; Validated 96.17
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.16
PRK06762166 hypothetical protein; Provisional 96.16
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.1
PHA00729226 NTP-binding motif containing protein 96.07
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.06
PRK08118167 topology modulation protein; Reviewed 96.04
CHL00095821 clpC Clp protease ATP binding subunit 96.01
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.98
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.84
PRK08769319 DNA polymerase III subunit delta'; Validated 95.84
PRK08058329 DNA polymerase III subunit delta'; Validated 95.76
PRK06067234 flagellar accessory protein FlaH; Validated 95.73
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.72
PRK05541176 adenylylsulfate kinase; Provisional 95.71
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 95.68
PRK07952244 DNA replication protein DnaC; Validated 95.68
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.67
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.66
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.63
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.63
cd01394218 radB RadB. The archaeal protein radB shares simila 95.63
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.63
PRK08939306 primosomal protein DnaI; Reviewed 95.62
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.61
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.59
PRK06871325 DNA polymerase III subunit delta'; Validated 95.58
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.57
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.56
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.55
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.52
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.52
PRK08233182 hypothetical protein; Provisional 95.49
PRK04296190 thymidine kinase; Provisional 95.43
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.42
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.42
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.41
PRK04132846 replication factor C small subunit; Provisional 95.38
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 95.38
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.37
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.36
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.34
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.34
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.32
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.31
PRK07993334 DNA polymerase III subunit delta'; Validated 95.3
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.27
PRK05973237 replicative DNA helicase; Provisional 95.26
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.23
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.23
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.22
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.22
PRK12608380 transcription termination factor Rho; Provisional 95.19
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.17
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.13
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.12
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.11
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.09
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.08
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.06
PRK04328249 hypothetical protein; Provisional 95.05
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.04
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.01
PRK10867433 signal recognition particle protein; Provisional 95.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.99
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.99
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.96
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 94.95
CHL00195489 ycf46 Ycf46; Provisional 94.89
COG4618580 ArpD ABC-type protease/lipase transport system, AT 94.88
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 94.86
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.85
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.84
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 94.84
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.83
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.82
cd03246173 ABCC_Protease_Secretion This family represents the 94.81
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.81
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.8
PRK00771437 signal recognition particle protein Srp54; Provisi 94.79
PRK06696223 uridine kinase; Validated 94.78
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.75
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.74
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.73
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.72
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.7
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.7
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.65
PRK14974336 cell division protein FtsY; Provisional 94.64
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 94.6
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 94.6
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.6
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.58
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.55
cd03115173 SRP The signal recognition particle (SRP) mediates 94.55
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.51
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.5
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 94.49
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.49
PRK07667193 uridine kinase; Provisional 94.49
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.48
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.47
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.42
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.41
PRK13546264 teichoic acids export protein ATP-binding subunit; 94.4
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.4
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.39
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.39
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.38
PRK06090319 DNA polymerase III subunit delta'; Validated 94.37
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 94.37
PRK03839180 putative kinase; Provisional 94.37
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.35
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.35
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.35
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.34
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.33
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 94.33
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 94.33
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.31
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.3
TIGR00959428 ffh signal recognition particle protein. This mode 94.28
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.27
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 94.27
PRK05480209 uridine/cytidine kinase; Provisional 94.26
PRK09302509 circadian clock protein KaiC; Reviewed 94.25
PRK01184184 hypothetical protein; Provisional 94.24
PRK10908222 cell division protein FtsE; Provisional 94.23
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.22
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.2
PRK06964342 DNA polymerase III subunit delta'; Validated 94.2
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 94.2
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 94.19
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.16
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.16
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.15
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.13
PRK09354349 recA recombinase A; Provisional 94.12
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.12
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 94.12
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 94.12
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.12
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 94.12
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.11
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.09
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.09
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.08
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.06
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 94.05
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.05
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.05
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 94.05
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.04
PRK00131175 aroK shikimate kinase; Reviewed 94.03
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.02
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.01
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.01
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 94.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.0
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 93.98
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.96
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 93.96
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.95
PRK00625173 shikimate kinase; Provisional 93.92
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 93.92
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.86
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.86
PTZ00301210 uridine kinase; Provisional 93.83
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 93.82
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.81
PRK04040188 adenylate kinase; Provisional 93.79
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.74
cd03215182 ABC_Carb_Monos_II This family represents domain II 93.73
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 93.73
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 93.73
PRK13947171 shikimate kinase; Provisional 93.69
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.69
PRK06547172 hypothetical protein; Provisional 93.68
PRK13537306 nodulation ABC transporter NodI; Provisional 93.68
PRK13948182 shikimate kinase; Provisional 93.65
PRK04301317 radA DNA repair and recombination protein RadA; Va 93.64
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.64
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 93.63
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 93.62
PRK03846198 adenylylsulfate kinase; Provisional 93.62
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 93.57
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 93.57
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 93.56
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 93.55
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.55
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 93.54
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 93.53
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 93.49
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 93.48
KOG1969877 consensus DNA replication checkpoint protein CHL12 93.46
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.45
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 93.45
PHA02244383 ATPase-like protein 93.42
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.4
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 93.4
KOG1514767 consensus Origin recognition complex, subunit 1, a 93.39
TIGR02236310 recomb_radA DNA repair and recombination protein R 93.37
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 93.37
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.35
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.32
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 93.32
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 93.25
PRK08699325 DNA polymerase III subunit delta'; Validated 93.23
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 93.21
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 93.2
PRK00279215 adk adenylate kinase; Reviewed 93.17
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.17
KOG0736953 consensus Peroxisome assembly factor 2 containing 93.17
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 93.15
PRK06217183 hypothetical protein; Validated 93.13
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.13
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 93.13
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 93.13
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.13
KOG0734752 consensus AAA+-type ATPase containing the peptidas 93.13
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.13
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 93.12
PRK11153343 metN DL-methionine transporter ATP-binding subunit 93.12
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.11
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 93.11
PTZ00088229 adenylate kinase 1; Provisional 93.09
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 93.07
PRK14738206 gmk guanylate kinase; Provisional 93.06
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 93.05
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 93.04
PRK09984262 phosphonate/organophosphate ester transporter subu 92.96
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 92.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 92.95
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 92.94
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 92.93
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 92.93
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 92.9
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 92.89
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.89
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.89
PRK13949169 shikimate kinase; Provisional 92.87
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 92.87
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 92.85
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.85
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 92.84
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 92.84
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 92.82
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 92.81
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.8
smart00487201 DEXDc DEAD-like helicases superfamily. 92.8
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 92.79
PRK13545549 tagH teichoic acids export protein ATP-binding sub 92.78
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 92.75
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 92.74
PRK00889175 adenylylsulfate kinase; Provisional 92.72
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 92.7
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 92.7
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 92.68
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.68
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 92.67
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.67
PRK10875615 recD exonuclease V subunit alpha; Provisional 92.67
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 92.66
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 92.66
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 92.61
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.61
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.58
COG0488530 Uup ATPase components of ABC transporters with dup 92.57
PRK13536340 nodulation factor exporter subunit NodI; Provision 92.55
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 92.52
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.51
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 92.5
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 92.49
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 92.48
PRK13409590 putative ATPase RIL; Provisional 92.45
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.44
PRK13946184 shikimate kinase; Provisional 92.43
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 92.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.41
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 92.41
PRK14528186 adenylate kinase; Provisional 92.39
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 92.39
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 92.39
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 92.38
PRK02496184 adk adenylate kinase; Provisional 92.37
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 92.36
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 92.34
PRK05439311 pantothenate kinase; Provisional 92.32
PF07726131 AAA_3: ATPase family associated with various cellu 92.32
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 92.31
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 92.29
COG3910233 Predicted ATPase [General function prediction only 92.28
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.27
PRK00409782 recombination and DNA strand exchange inhibitor pr 92.26
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.25
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 92.24
PRK11823446 DNA repair protein RadA; Provisional 92.23
PRK10762501 D-ribose transporter ATP binding protein; Provisio 92.18
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 92.17
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.16
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 92.15
TIGR00064272 ftsY signal recognition particle-docking protein F 92.14
PRK00300205 gmk guanylate kinase; Provisional 92.13
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 92.12
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.12
PRK10070400 glycine betaine transporter ATP-binding subunit; P 92.1
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 92.07
PRK05057172 aroK shikimate kinase I; Reviewed 92.05
COG1084346 Predicted GTPase [General function prediction only 92.02
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 92.01
PRK04182180 cytidylate kinase; Provisional 91.98
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 91.97
PRK13975196 thymidylate kinase; Provisional 91.96
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 91.93
PRK14530215 adenylate kinase; Provisional 91.91
PRK12339197 2-phosphoglycerate kinase; Provisional 91.89
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.85
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.85
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 91.84
PRK14527191 adenylate kinase; Provisional 91.79
COG4088261 Predicted nucleotide kinase [Nucleotide transport 91.77
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.75
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 91.7
cd03299235 ABC_ModC_like Archeal protein closely related to M 91.65
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 91.65
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 91.64
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 91.64
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.55
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 91.55
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 91.54
PRK11607377 potG putrescine transporter ATP-binding subunit; P 91.54
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.53
PRK14737186 gmk guanylate kinase; Provisional 91.52
PRK09700510 D-allose transporter ATP-binding protein; Provisio 91.5
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 91.45
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 91.44
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.41
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 91.41
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 91.39
PRK14526211 adenylate kinase; Provisional 91.37
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 91.35
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 91.32
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 91.31
KOG0927614 consensus Predicted transporter (ABC superfamily) 91.3
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 91.28
KOG2170344 consensus ATPase of the AAA+ superfamily [General 91.27
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 91.24
COG1936180 Predicted nucleotide kinase (related to CMP and AM 91.22
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 91.19
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 91.17
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 91.12
PRK03731171 aroL shikimate kinase II; Reviewed 91.09
PRK15455644 PrkA family serine protein kinase; Provisional 91.06
PRK08760476 replicative DNA helicase; Provisional 91.04
PLN03186342 DNA repair protein RAD51 homolog; Provisional 91.01
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 91.01
PLN02318656 phosphoribulokinase/uridine kinase 91.01
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.4e-56  Score=540.30  Aligned_cols=553  Identities=17%  Similarity=0.191  Sum_probs=386.4

Q ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHhhcHHHHHHHHHhHHHHHHHHhhHHHHhhhh
Q 002559           13 IVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRM   92 (908)
Q Consensus        13 ~vs~l~~~~~~L~~~~~~l~~l~~~Le~L~~~L~d~e~~~~~~~~~~~~~~w~~qVr~~a~d~eD~ld~~~~~~~~~~~~   92 (908)
                      +.+.+.+....+.....++.++++.+..|+.++++++...   ........|...++++.|+++|.++.+.......+..
T Consensus        12 ~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~---~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~   88 (889)
T KOG4658|consen   12 LDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKR---DDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN   88 (889)
T ss_pred             HHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhc---chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4445555666777777789999999999999999999977   5666678899999999999999999997665553211


Q ss_pred             hhhc-c--cccccceecccccccHHHHHHHHHHHHHHHHHHHhhhhhhhhhHhhhcc------ccCCccccccccCCCcC
Q 002559           93 VSKS-K--IKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTA------QEVPTRLKVKAEQGYPI  163 (908)
Q Consensus        93 ~~~~-~--~~~~~~~~~~~~~~~~i~~~I~~I~~~l~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~g~  163 (908)
                      .... +  ........   ...+.....+..+.+++............ ...+....      ..++.....+... +|.
T Consensus        89 ~~l~~~~~~~~~~c~~---~~~~~~~~~~~~~~~rv~~~l~~ve~l~~-~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~  163 (889)
T KOG4658|consen   89 DLLSTRSVERQRLCLC---GFCSKNVSDSYKYGKRVSKVLREVESLGS-KGVFEVVGESLDPREKVETRPIQSESD-VGL  163 (889)
T ss_pred             HHhhhhHHHHHHHhhh---hhHhHhhhhhHhHHHHHHHHHHHHHHhcc-ccceecccccccchhhcccCCCCcccc-ccH
Confidence            1110 0  00111100   11122222333333333333322111110 01011111      0111111111122 888


Q ss_pred             ccHHHHHHHHHhccCCceEEEEEecCCCChHHHHHHHHhCCC---CccccceEEEeeeeeeccccccCCcchHHHHHHHH
Q 002559          164 SSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARK  240 (908)
Q Consensus       164 e~~~~~l~~LL~~~~~~~vV~I~GmgGiGKTtLA~~v~~~~~---~~F~~~~f~~~v~~wv~~~~~~~s~~~~~~~l~~~  240 (908)
                      +...+.+...|-.++. .+++|+||||+||||||+.++|+..   .+| +.++|+.|           |+++...++..+
T Consensus       164 e~~~~kl~~~L~~d~~-~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~F-d~~iWV~V-----------Sk~f~~~~iq~~  230 (889)
T KOG4658|consen  164 ETMLEKLWNRLMEDDV-GIVGIYGMGGVGKTTLARQIFNKFDEVGNHF-DGVIWVVV-----------SKEFTTRKIQQT  230 (889)
T ss_pred             HHHHHHHHHHhccCCC-CEEEEECCCcccHHHHHHHHhcccchhcccC-ceEEEEEE-----------cccccHHhHHHH
Confidence            8888887777766544 9999999999999999999999875   445 44544433           778888888888


Q ss_pred             HHHHHHHhccccccCCCCCCHHHHHHHHHHHhccCCeeEEEecCCchhHHHHHhhhcCC---CcEEEEEccchhhhhh-c
Q 002559          241 ISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN---DCKYLVTTRNEAVYEI-T  316 (908)
Q Consensus       241 i~~~L~~lg~~~~~~~~~~~~~~l~~~l~~~L~~kr~LLVLDDV~~~~~~e~l~~~~~~---gsrILVTTR~~~va~~-~  316 (908)
                      |+..+...+    ......+.+++...+.+.|++|||||||||||+..+|+.+..++|.   ||+|++|||+..|+.. +
T Consensus       231 Il~~l~~~~----~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m  306 (889)
T KOG4658|consen  231 ILERLGLLD----EEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAM  306 (889)
T ss_pred             HHHHhccCC----cccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccc
Confidence            876553322    1112223478899999999999999999999999999999988864   6999999999999997 6


Q ss_pred             cccee----cCChhhHHHHHHHHhhhcccccCcchHHHHHHHHhHhCCchhhHhHhhhhhhccCCHHHHHHHHHHhchh-
Q 002559          317 EAEKV----ELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTF-  391 (908)
Q Consensus       317 ~~~~~----~L~~~ea~~Lf~~~~~~~~~~~~~~l~~i~~~Iv~~cgGLPLAI~~ig~~L~~~~~~~eW~~~l~~L~~~-  391 (908)
                      +....    .|+.+|||+||.+.++.......+..+++|++++++|+|+|||+.++|+.|+.+.+..+|+.+++.+.+. 
T Consensus       307 ~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~  386 (889)
T KOG4658|consen  307 GVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSL  386 (889)
T ss_pred             cCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccc
Confidence            65332    7999999999999998776666666899999999999999999999999999998999999999999876 


Q ss_pred             hcCCCCCCCccchhhhcccccccchhhhhhccCcHHHHHHHHHhhhccCCCCCCHHHHHHHHHHHhh----------cch
Q 002559          392 ATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQ----------KSL  461 (908)
Q Consensus       392 ~~~~~~~~~~~~~~~~~~~~~I~~~L~lSy~~L~~~~K~cfl~lsiFp~~~~i~~~~L~~lW~a~g~----------~~~  461 (908)
                      ....++           ....|++++.+||+.||++.|.||+|||+||+|+.|+.+.|+.+|+++|.          .+.
T Consensus       387 ~~~~~~-----------~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~  455 (889)
T KOG4658|consen  387 AADFSG-----------MEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDV  455 (889)
T ss_pred             cCCCCc-----------hhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcc
Confidence            222211           12378899999999999889999999999999999999999999999992          356


Q ss_pred             HHHHHHHHHHcCCccccC---CCCeEEECHHHHHHHHHhccc-----cchhhcccc-----ccc--cccccccceeccCc
Q 002559          462 FSLAVCKLVEGSLLMKDD---TDPLYQVHDMVSLYLDSKTND-----SIQMLINGL-----KAE--EIAFICPWFLIFGK  526 (908)
Q Consensus       462 ~e~~l~~Lv~rsLl~~~~---~~~~~~mHdLVr~~a~~~~~e-----~~~~i~~~~-----~~~--~~~~~~~~~~~~~~  526 (908)
                      +..++++|+++||+....   ...+|.|||+||++|..++.+     +. .++...     .++  .....++.....+.
T Consensus       456 G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~  534 (889)
T KOG4658|consen  456 GYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNK  534 (889)
T ss_pred             hHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccc
Confidence            789999999999999875   346899999999999999983     33 223221     010  00000111111111


Q ss_pred             h-hhh-ccccccccchhccccchhhHhhHHHHHHhhccCCccCEEEecC-ccccccccccccceeccCCCCcccc----c
Q 002559          527 E-NIK-NIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSR-ICFSGILGPRIADLISRDSQSLTVV----S  599 (908)
Q Consensus       527 ~-~~~-~~~~~~l~~ll~~~~~~~~~~~l~~~~~~l~~l~~LrvLdLs~-~~~~~~LP~~I~~L~~L~~l~l~~~----~  599 (908)
                      - ... .....++++++......   ........+|..++.|||||||+ ..+.+ ||..|++|.||+||++..+    +
T Consensus       535 ~~~~~~~~~~~~L~tLll~~n~~---~l~~is~~ff~~m~~LrVLDLs~~~~l~~-LP~~I~~Li~LryL~L~~t~I~~L  610 (889)
T KOG4658|consen  535 IEHIAGSSENPKLRTLLLQRNSD---WLLEISGEFFRSLPLLRVLDLSGNSSLSK-LPSSIGELVHLRYLDLSDTGISHL  610 (889)
T ss_pred             hhhccCCCCCCccceEEEeecch---hhhhcCHHHHhhCcceEEEECCCCCccCc-CChHHhhhhhhhcccccCCCcccc
Confidence            1 111 11122455555444332   11112344688999999999995 66778 9999999999999977654    4


Q ss_pred             hhhHhhh
Q 002559          600 AEAITNI  606 (908)
Q Consensus       600 ~~~l~~l  606 (908)
                      |..+.++
T Consensus       611 P~~l~~L  617 (889)
T KOG4658|consen  611 PSGLGNL  617 (889)
T ss_pred             chHHHHH
Confidence            5555443

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query908
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-58
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-27
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 9e-27
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-23
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-12
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-09
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-09
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-06
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-05
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 8e-09
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-07
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-04
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 6e-07
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 8e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-05
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  217 bits (554), Expect = 1e-58
 Identities = 113/642 (17%), Positives = 218/642 (33%), Gaps = 151/642 (23%)

Query: 41  LEDFVC-DLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVS--KSK 97
           +++F C D++++ + I       L   ++DH + S +         +    R+     SK
Sbjct: 30  VDNFDCKDVQDMPKSI-------LSKEEIDHIIMSKD--------AVSGTLRLFWTLLSK 74

Query: 98  IKNLAHVVWTSMAGDPLRKLLNSINDDLNW-WLESQILAQNVEKVIELTA-QEVPTRLK- 154
            + +          + LR          N+ +L S I  +  +  +      E   RL  
Sbjct: 75  QEEMVQK----FVEEVLRI---------NYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYN 121

Query: 155 -VKAEQGYPISSKSKF--LRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPP--ERFV 209
             +    Y +S    +  LR+ L +    + +LI G+ G GK+ +A  V        +  
Sbjct: 122 DNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMD 181

Query: 210 GGAVELGFGQWCSRAACNGSKS--DYQKRLARKISKFLVQIG-FWKKIKDENSDL-EYLC 265
                  F  W +   CN  ++  +  ++L  +I             IK     +   L 
Sbjct: 182 FKI----F--WLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELR 235

Query: 266 CLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYE-ITEAEKVELS 324
            LL+   Y   +L+ L +V        F    +  CK L+TTR + V + ++ A    +S
Sbjct: 236 RLLKSKPYENCLLV-LLNVQNAKAWNAF----NLSCKILLTTRFKQVTDFLSAATTTHIS 290

Query: 325 KDDIMEI-----SKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKEL-RS 378
            D           KS+LL +     ++LP            +P  ++++ +++R  L   
Sbjct: 291 LDHHSMTLTPDEVKSLLLKYLDCRPQDLPREV------LTTNPRRLSIIAESIRDGLATW 344

Query: 379 EKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAM-PRDSRRLFIALAA 437
           + W+                  +VN  +    +      E SL  + P + R++F  L+ 
Sbjct: 345 DNWK------------------HVNCDKLTTII------ESSLNVLEPAEYRKMFDRLSV 380

Query: 438 LSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSK 497
              +  +P   L  IW  +++  +  + V KL + SL+ K   +    +     +YL+ K
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDVMVV-VNKLHKYSLVEKQPKESTISIPS---IYLELK 436

Query: 498 TNDSI-----QMLIN----GLKAEEIAFICP-------WFL---IFGKENIKNIAE-EKV 537
                     + +++        +    I P         +   +   E+ + +     V
Sbjct: 437 VKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV 496

Query: 538 ELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADL------ISRD 591
            L     E+K     I     A  AS SI                 +  L      I  +
Sbjct: 497 FLDFRFLEQK-----IRHDSTAWNASGSILNT--------------LQQLKFYKPYICDN 537

Query: 592 SQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQ 633
                    E + N         ++P +E      K   LL+
Sbjct: 538 DPKY-----ERLVN-----AILDFLPKIEENLICSKYTDLLR 569
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 908
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 7e-16
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 8e-04
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.003
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 76.8 bits (188), Expect = 7e-16
 Identities = 30/230 (13%), Positives = 73/230 (31%), Gaps = 14/230 (6%)

Query: 166 KSKFLRKLLE-QEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGF-GQWCSR 223
             + ++KL E  +     + + G +G GKS +A Q  S   +      + + +      +
Sbjct: 29  VDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQL-----IGINYDSIVWLK 83

Query: 224 AACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDD 283
            +    KS +       +              +  + +     +    +   + L + DD
Sbjct: 84  DSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDD 143

Query: 284 VWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLA 343
           V +++ +       +   + LVTTR+  +          +    +        L    + 
Sbjct: 144 VVQEETIRWA---QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMP 200

Query: 344 EE---ELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLST 390
                +        +E    +P T+ +  K+   +   EK  +    L +
Sbjct: 201 MPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES 249
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query908
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.23
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.82
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.73
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.58
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.58
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.52
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.5
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.46
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.39
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.39
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.23
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.21
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.15
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.15
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.13
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.09
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.08
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.08
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.97
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.91
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.71
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 97.43
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.39
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.35
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 97.11
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.76
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.65
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.5
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.48
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.37
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.35
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.32
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.29
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.28
d2qy9a2211 GTPase domain of the signal recognition particle r 96.21
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.14
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.1
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.02
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.89
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.85
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.82
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.8
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.79
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.78
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.77
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.73
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.69
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.68
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.66
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.65
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.65
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.62
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.62
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.62
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.61
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.59
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 95.55
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.53
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.5
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.48
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.47
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.46
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.45
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.36
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.34
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.33
d1vmaa2213 GTPase domain of the signal recognition particle r 95.3
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.24
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.2
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.13
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.11
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.1
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.96
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.93
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.85
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.83
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.83
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.83
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.79
d1okkd2207 GTPase domain of the signal recognition particle r 94.73
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.61
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.59
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.49
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.41
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.4
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.38
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 94.32
d1xpua3289 Transcription termination factor Rho, ATPase domai 94.27
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.24
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.14
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.11
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.06
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.02
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.96
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.84
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.73
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.73
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.7
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.64
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.52
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.51
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.43
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.35
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.29
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.24
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.2
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.18
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.06
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.87
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.65
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.55
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 92.51
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.48
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.65
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.51
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.43
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 91.41
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.36
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.3
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.09
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 90.9
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.86
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.74
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.61
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.48
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 90.43
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.41
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.32
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.21
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.04
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.01
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 89.89
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.59
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.52
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.28
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.09
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.08
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.85
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.85
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 88.81
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.78
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.41
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.35
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.31
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.29
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.19
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.14
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.1
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.1
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.01
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 87.99
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.93
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 87.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.77
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.73
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.72
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.72
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.7
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.42
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.42
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.36
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 87.33
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.3
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.29
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.2
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.13
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.1
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 87.04
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.88
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 86.86
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 86.84
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.78
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.57
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.41
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.34
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.32
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.27
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.21
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.12
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.04
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.03
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.92
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 85.71
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.69
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.68
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.61
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.48
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 85.47
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 85.36
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.1
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.09
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.55
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.45
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.42
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.29
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.22
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 84.12
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.09
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.08
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.96
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.84
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.83
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 83.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 83.52
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.43
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 83.03
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 82.67
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 82.06
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 82.02
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.9
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 81.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 81.26
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.08
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 81.07
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 80.98
d1tuea_205 Replication protein E1 helicase domain {Human papi 80.68
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.16
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=3e-41  Score=282.37  Aligned_cols=246  Identities=15%  Similarity=0.128  Sum_probs=183.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHC--CCCCEEEEEEECCCCCHHHHHHHHHHCCC---CCCCCCEEEEEEEEEECCCCCCCCC
Q ss_conf             456777675189999998711--69926999992489976899999980998---8665634998131222045336996
Q 002559          156 KAEQGYPISSKSKFLRKLLEQ--EETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAACNGSK  230 (908)
Q Consensus       156 ~~~~~~g~e~~~~~i~~LL~~--~~~~~vI~I~GmgGiGKTTLA~~v~~~~~---~~F~~~~f~~~v~~wv~~~~c~~s~  230 (908)
                      ..+..|||+..++.+..+|..  +.+.++|+|+||||+||||||+++|++..   ..|+++++|+++.           .
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs-----------~   86 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDS-----------G   86 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECC-----------C
T ss_pred             CCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEC-----------C
T ss_conf             98862373999999999987346878408999779978889999999985565540127648999936-----------8


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCC--C--CCCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             068999999999999982334455--7--999989999999999851397067982488616799973003998479997
Q 002559          231 SDYQKRLARKISKFLVQIGFWKKI--K--DENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVT  306 (908)
Q Consensus       231 ~~~~~~i~~~I~~~L~~~g~~~~~--~--~~~~~~~~l~~~l~~~L~~Kr~LLVLDDVw~~~~~e~l~~~~~~GskIIVT  306 (908)
                      .+....+...+...+...+.....  .  ............+.+.+.++|+|+||||||+.++|+.+.   ..|||||||
T Consensus        87 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~---~~~srilvT  163 (277)
T d2a5yb3          87 TAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ---ELRLRCLVT  163 (277)
T ss_dssp             CSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH---HTTCEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC---CCCCEEEEE
T ss_conf             77777899999999987220220278632123369999999999844688167525066776655520---457559999


Q ss_pred             CCCHHHHHHCCCC----EE-CCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHH
Q ss_conf             3540222101230----00-178555999999986320355676249999999968189614676863553116899999
Q 002559          307 TRNEAVYEITEAE----KV-ELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKW  381 (908)
Q Consensus       307 TR~~~va~~~~~~----~~-~L~~~ea~eLf~~~~~~~~~~~~~~l~~i~~~Iv~~C~GlPLAI~~ig~~L~~~~~~~eW  381 (908)
                      ||+..++..+...    .+ +|+.+|||+||.+.++..  ...+..++++++|+++|+|+||||+++|+.|+.+ +.++|
T Consensus       164 TR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~--~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~  240 (277)
T d2a5yb3         164 TRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM--PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKM  240 (277)
T ss_dssp             ESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCC--C--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHH
T ss_pred             EEHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCC--CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCC-CHHHH
T ss_conf             64489998637887168778899799999999984776--6742567999999999589989999999986559-89999


Q ss_pred             HHHHHHHCHHHCCCCCCCCCCCHHHHCCCCCCCCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             999998601001799998765601110112301304465215968899999995
Q 002559          382 EKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIAL  435 (908)
Q Consensus       382 ~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~I~~~L~lSy~~L~~~~K~cfl~l  435 (908)
                      .+..+.|....                 ...|..++.+||++||+++|.||.++
T Consensus       241 ~~~~~~L~~~~-----------------~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         241 AQLNNKLESRG-----------------LVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHHC-----------------SSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHCCC-----------------HHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             99999973486-----------------78899999998851269999999739
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure