Citrus Sinensis ID: 002562

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------
MNFGVGSVKLLLSLLLLLFAHLFLLIGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITASFLNEDTPTPSSSIKRSNSKEKSERENPVDDHSEGTGALVSPVNVTQLADIIAEGR
ccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEccHHHHccccccEEEcccccccccccHHHHcccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccHHHHHcccccccccccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEccccEEEEEEEccccccccccEEEEccccccccccHHHHHHcccccccccccccccccccEEEEEEEEEEEEccccccccccEEEEEEEEEEEcEEEEEEEEHHHHHcccccEEEEEEEEEEEccEEEEEEEEEEccccccccccccccHHHHHcccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcHHHHHHHccccccccccccccccccccccEEEccccccccHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHEcccccccccccccHHHcccccEEEEEEccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHcccccccEEEcccccccccccHHHHccccEEEcccccccccccHHHccccEEEEcccccccccccccccccHHHEEcccccccccccccccccccccccccccccccccccccccccHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHcHHHccccccEEEEHHHHHHHccccccccEEEEcccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccEEEcccccHHHHHHHHHHHHHHccHHHHHHcccccccccccccEEEccccccccHHHEEEEEcccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccHEHcccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEHHHHccccc
MNFGVGSVKLLLSLLLLLFAHLFLLIGlseaqnnttsttdpaEVRALNSILqqwdapavplwnisgepcsgsalnatdsefespnnnpaivcdctfdngatchITKLRVYALnkkgvipeeLVTLQYLTFLKidqnfftgplpsfigNLSRLMLLSVAHNvfsgsvprelgnlkeltvlsfgnnnfsgtlppeigNLAKLEQLYLnswgaggeipsTYAKLRNMQtlwasdapftgkipdfigNWTKLKSLRfqgnsfqgpipsslsklasldslrisdiynVSSSLDFVMSLKNLtdlslrnalitgsipsgigelqnlqtldlsfnnltgqiprtlfnigslnylflgnnslsgtlptqksenlqnidlsynhlsgpfpswvTSNLQMNLVannftfdrsnisvfpglhclqrnfpcnrnapryanfsikcggkqmradnivyeadnsslsassyavtntekwgvsnvgffyerenpAYVLNTLgqvtgtrtpelyqtsrispgslryyglglengpynVSLLFAETNILDRSTERWESLARRVFDIYIQgtlrwkdfdiskeaggpnraIIKNFNATVSENHLEIHLFwagkgtccvpkqgdygpaiSALSVVSafkpsvsglppstagnknhtglIVGIAVPLGILGLIAISIVFYMRrkkdnddeevlvgidskpntfSYAELRsatqdfdpsnklgeggygpvykkTQLMLSNFhgylapeyamrghltekadVFSFGVAALEIISgransdnsldMEKIYLLEWAWNLhennqslglvdptltefndkEALRVIGVALLctqaspmmrppmSRVVAMLAGDIEvgkviskpsyltdwdfkditasflnedtptpsssikrsnskekserenpvddhsegtgalvspvNVTQLADIIAEGR
MNFGVGSVKLLLSLLLLLFAHLFLLIGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLgqvtgtrtpelyqtsrisPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELrsatqdfdpsnklGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISgransdnslDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLctqaspmmrpPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITAsflnedtptpsssikrsnskekserenpvddhsegtgalvspvnvTQLADIIAEGR
MNFGVGSVKlllslllllfahlflliglSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPsslsklasldslRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITASFLNEDTPTPSSSIKRSNSKEKSERENPVDDHSEGTGALVSPVNVTQLADIIAEGR
***GVGSVKLLLSLLLLLFAHLFLLIGLSE*************VRALNSILQQWDAPAVPLWNISGE********************PAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPI***LSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGT********LQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFK**************NHTGLIVGIAVPLGILGLIAISIVFYMRRK******EVLVGI**************************EGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITASFL*****************************************************
************SLLLLLFAHLFLLIGLSEAQNN***TTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSI*************YEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRS*E**ESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGE**********QLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLA************************************************************************LA*IIA***
MNFGVGSVKLLLSLLLLLFAHLFLLIGLSEAQ********PAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITASFLNE*****************************GTGALVSPVNVTQLADIIAEGR
MNFGVGSVKLLLSLLLLLFAHLFLLIGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDI*******************************************************************T******A***
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFGVGSVKLLLSLLLLLFAHLFLLIGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRADNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKDNDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYKKTQLMLSNFHGYLAPEYAMRGHLTEKADVFSFGVAALEIISGRANSDNSLDMEKIYLLEWAWNLHENNQSLGLVDPTLTEFNDKEALRVIGVALLCTQASPMMRPPMSRVVAMLAGDIEVGKVISKPSYLTDWDFKDITASFLNEDTPTPSSSIKRSNSKEKSERENPVDDHSEGTGALVSPVNVTQLADIIAEGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query907 2.2.26 [Sep-21-2011]
C0LGH2 1032 Probable LRR receptor-lik yes no 0.767 0.674 0.503 0.0
C0LGH3 1033 Probable LRR receptor-lik no no 0.770 0.676 0.501 0.0
C0LGG8 1038 Probable LRR receptor-lik no no 0.714 0.624 0.367 1e-116
C0LGG9 1035 Probable LRR receptor-lik no no 0.714 0.626 0.363 1e-116
C0LGE0 1014 Probable LRR receptor-lik no no 0.713 0.638 0.375 1e-107
Q9ASQ6 1019 Probable LRR receptor-lik no no 0.728 0.648 0.365 2e-96
Q9FXF2 1021 Probable LRR receptor-lik no no 0.703 0.624 0.354 3e-95
C0LGN2 1020 Probable leucine-rich rep no no 0.729 0.649 0.337 4e-93
C0LGG7 953 Probable LRR receptor-lik no no 0.608 0.579 0.361 1e-92
Q9FL281173 LRR receptor-like serine/ no no 0.312 0.241 0.350 2e-36
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function desciption
 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/705 (50%), Positives = 480/705 (68%), Gaps = 9/705 (1%)

Query: 12  LSLLLLLFAHLFLLIGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSG 71
           L LL++ F  +   + + ++QN T +TT P E RALNSI   W   A   WNISGE CSG
Sbjct: 10  LLLLIIWFMCIAGSVQVVQSQNQTGATTHPDEARALNSIFAAWKIQAPREWNISGELCSG 69

Query: 72  SALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFL 131
           +A++A+  +  +P  NP I CDC+F N   C IT ++VYA++  G IP EL TL YLT L
Sbjct: 70  AAIDASVLD-SNPAYNPLIKCDCSFQNSTICRITNIKVYAIDVVGPIPPELWTLTYLTNL 128

Query: 132 KIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLP 191
            + QN  TG LP  IGNL+R+  ++   N  SG VP+E+G L +L +L   +NNFSG++P
Sbjct: 129 NLGQNVLTGSLPPAIGNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIP 188

Query: 192 PEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSL 251
            EIG   KL+Q+Y++S G  G IP ++A L  ++  W +D   T +IPDFIG+WTKL +L
Sbjct: 189 DEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTL 248

Query: 252 RFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIP 311
           R  G    GPIPSS S L SL  LR+ DI + SSSLDF+  +K+L+ L LRN  +TG+IP
Sbjct: 249 RIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIP 308

Query: 312 SGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDL 371
           S IGE  +L+ +DLSFN L G IP +LFN+  L +LFLGNN+L+G+ PTQK+++L+N+D+
Sbjct: 309 STIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQKTQSLRNVDV 368

Query: 372 SYNHLSGPFPSWVT-SNLQMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFS 430
           SYN LSG  PSWV+  +L++NLVANNFT +  +  V PGL+CLQ+NFPCNR    Y++FS
Sbjct: 369 SYNDLSGSLPSWVSLPSLKLNLVANNFTLEGLDNRVLPGLNCLQKNFPCNRGKGIYSDFS 428

Query: 431 IKCGGKQMRA-DNIVYEADNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQV 489
           I CGG + R+    ++E ++     +S+ V+  ++W  S+VG F    N  Y+  +  Q 
Sbjct: 429 INCGGPEKRSVTGALFEREDEDFGPASFFVSAGQRWAASSVGLFAGSSNNIYIATSQSQF 488

Query: 490 TGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDI 549
             T   EL+Q++R+S  S+RYYGLGLENG Y V+L FAE  IL  ++  W+ L RR FDI
Sbjct: 489 VNTLDSELFQSARLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDI 548

Query: 550 YIQGTLRWKDFDISKEAGGPN-RAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGP 608
           Y+QG L  KDFD+ + AG    RA+ + + A VSENHLE+HLFWAGKGTCC+P QG YGP
Sbjct: 549 YVQGRLVEKDFDVRRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGP 608

Query: 609 AISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYM--RRKKD 666
            ISA+S    F P+V+  PPS    KN TG IVG+ V +G+L ++A  ++F +  RRK+ 
Sbjct: 609 LISAVSATPDFTPTVANKPPSKG--KNRTGTIVGVIVGVGLLSILAGVVMFTIRKRRKRY 666

Query: 667 NDDEEVLVGIDSKPNTFSYAELRSATQDFDPSNKLGEGGYGPVYK 711
            DDEE L+G+D KP  F+Y+EL+SATQDFDPSNKLGEGG+GPVYK
Sbjct: 667 TDDEE-LLGMDVKPYIFTYSELKSATQDFDPSNKLGEGGFGPVYK 710

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 Back     alignment and function description
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=1 SV=1 Back     alignment and function description
>sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query907
296089254 1037 unnamed protein product [Vitis vinifera] 0.748 0.654 0.728 0.0
224053719 1041 predicted protein [Populus trichocarpa] 0.775 0.675 0.695 0.0
224072359 1016 predicted protein [Populus trichocarpa] 0.735 0.656 0.716 0.0
225444253 1048 PREDICTED: probable LRR receptor-like se 0.742 0.642 0.718 0.0
359484008 1037 PREDICTED: probable LRR receptor-like se 0.736 0.644 0.729 0.0
296089258 2282 unnamed protein product [Vitis vinifera] 0.747 0.297 0.714 0.0
255571932 1040 ATP binding protein, putative [Ricinus c 0.750 0.654 0.659 0.0
359484016 1039 PREDICTED: probable LRR receptor-like se 0.738 0.644 0.643 0.0
359495325993 PREDICTED: probable LRR receptor-like se 0.750 0.685 0.624 0.0
3594840241003 PREDICTED: probable LRR receptor-like se 0.746 0.674 0.595 0.0
>gi|296089254|emb|CBI39026.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/688 (72%), Positives = 571/688 (82%), Gaps = 9/688 (1%)

Query: 29  SEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNP 88
           S AQN   +T D +E  ALNSI QQWD  +  LWNISGEPC+GSA++   S FE   NNP
Sbjct: 36  STAQN---ATLDASEAEALNSIFQQWDTQSAALWNISGEPCTGSAISG--SGFEETANNP 90

Query: 89  AIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGN 148
           AI CDCT++N  TCHIT+LRVYALN++GVIPEEL  L YLTFLKIDQN+FTGPLPSFIGN
Sbjct: 91  AITCDCTYNNSTTCHITQLRVYALNRRGVIPEELTALTYLTFLKIDQNYFTGPLPSFIGN 150

Query: 149 LSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSW 208
           LS+L LLS+AHN  SG++P ELGNL+ELTVLS  +NNFSGTLPPE+GNL  L +LY+NS 
Sbjct: 151 LSKLQLLSLAHNALSGTIPMELGNLQELTVLSLSSNNFSGTLPPELGNLVNLRELYINSL 210

Query: 209 GAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSK 268
           G GGEIPST+A L NMQ + ASD PF+GKIPDFIGNWTKL SLRFQGNSF+GPIPSS SK
Sbjct: 211 GVGGEIPSTFANLENMQVMRASDCPFSGKIPDFIGNWTKLTSLRFQGNSFEGPIPSSFSK 270

Query: 269 LASLDSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFN 328
           L SL SLRISD++NVSSSLDF+  LKNLTDL LRNALITGSIPS IGE Q+LQ LDLSFN
Sbjct: 271 LTSLSSLRISDLFNVSSSLDFIKDLKNLTDLVLRNALITGSIPSYIGEFQSLQRLDLSFN 330

Query: 329 NLTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVTSNL 388
           NLTG IP +LFN+GSL  LFLGNNSLSGTLPTQKS+ LQNIDLSYN LSG FPSWVTS L
Sbjct: 331 NLTGGIPSSLFNLGSLANLFLGNNSLSGTLPTQKSKQLQNIDLSYNELSGSFPSWVTSGL 390

Query: 389 QMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMR-ADNIVYEA 447
           Q+NLVANNFTFD SN S+ PGL+CLQRNFPCN+N PRYANFSIKCGG +MR A+ IVYEA
Sbjct: 391 QLNLVANNFTFDSSNRSLLPGLNCLQRNFPCNKNTPRYANFSIKCGGSEMRNAEGIVYEA 450

Query: 448 DNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGS 507
           +NS+L A+SY VT+TEKW VSNVG F +R NP+YV N L QVTGT TPEL+Q+SRISPGS
Sbjct: 451 ENSTLGAASYYVTSTEKWAVSNVGLFSDRSNPSYVDNNLMQVTGTNTPELFQSSRISPGS 510

Query: 508 LRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAG 567
           LRYYGLGLENGPY VSL FAET   DR T+ WESL RRVFDIYIQG L++KDFDISKEAG
Sbjct: 511 LRYYGLGLENGPYIVSLEFAETVFKDRDTQTWESLGRRVFDIYIQGALQFKDFDISKEAG 570

Query: 568 GPNRAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGLP 627
           G  RA+ K F ATVSEN+LEIHLFWAGKGTCC P QG YGP+ISALSVVS F P+V+G P
Sbjct: 571 GVERALEKKFYATVSENYLEIHLFWAGKGTCCNPIQGYYGPSISALSVVSDFTPTVAGNP 630

Query: 628 PSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMRRKKD--NDDEEVLVGIDSKPNTFSY 685
           P     KN+TGLIVG+AV +G++ +I I  V Y++RK    N+DEE L GI  +PNTFSY
Sbjct: 631 PIPPSKKNNTGLIVGVAVSVGVVSMILICSVLYIKRKASYVNEDEEFL-GIGPRPNTFSY 689

Query: 686 AELRSATQDFDPSNKLGEGGYGPVYKKT 713
           +ELR+AT+DF+P+NKLGEGG+GPVYK T
Sbjct: 690 SELRTATEDFNPANKLGEGGFGPVYKGT 717

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224053719|ref|XP_002297945.1| predicted protein [Populus trichocarpa] gi|222845203|gb|EEE82750.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072359|ref|XP_002303698.1| predicted protein [Populus trichocarpa] gi|222841130|gb|EEE78677.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225444253|ref|XP_002273016.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484008|ref|XP_002272404.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089258|emb|CBI39030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255571932|ref|XP_002526908.1| ATP binding protein, putative [Ricinus communis] gi|223533747|gb|EEF35480.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359484016|ref|XP_002272816.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495325|ref|XP_002270976.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484024|ref|XP_003633055.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] gi|296089265|emb|CBI39037.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query907
TAIR|locus:2205250 1032 AT1G56130 [Arabidopsis thalian 0.747 0.656 0.500 2.5e-232
TAIR|locus:2205260 1047 AT1G56120 [Arabidopsis thalian 0.428 0.371 0.501 9.6e-148
TAIR|locus:2203718 1035 AT1G53440 [Arabidopsis thalian 0.714 0.626 0.355 1.4e-144
TAIR|locus:2019367 1078 AT1G29740 [Arabidopsis thalian 0.703 0.591 0.376 6.9e-130
TAIR|locus:2019317969 AT1G29730 [Arabidopsis thalian 0.616 0.576 0.364 5.1e-124
TAIR|locus:2203847 1021 RKF1 "receptor-like kinase in 0.687 0.611 0.353 2.1e-113
TAIR|locus:2009630 953 AT1G53420 [Arabidopsis thalian 0.611 0.582 0.335 3.3e-98
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.325 0.263 0.340 1.2e-49
TAIR|locus:20859491141 AT3G24240 [Arabidopsis thalian 0.343 0.273 0.323 5.2e-47
TAIR|locus:21398851013 AT4G28650 [Arabidopsis thalian 0.295 0.264 0.367 8.8e-47
TAIR|locus:2205250 AT1G56130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1767 (627.1 bits), Expect = 2.5e-232, Sum P(2) = 2.5e-232
 Identities = 344/687 (50%), Positives = 464/687 (67%)

Query:    30 EAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISGEPCSGSALNATDSEFESPNNNPA 89
             ++QN T +TT P E RALNSI   W   A   WNISGE CSG+A++A+  +  +P  NP 
Sbjct:    28 QSQNQTGATTHPDEARALNSIFAAWKIQAPREWNISGELCSGAAIDASVLD-SNPAYNPL 86

Query:    90 IVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNL 149
             I CDC+F N   C IT ++VYA++  G IP EL TL YLT L + QN  TG LP  IGNL
Sbjct:    87 IKCDCSFQNSTICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNL 146

Query:   150 SRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWG 209
             +R+  ++   N  SG VP+E+G L +L +L   +NNFSG++P EIG   KL+Q+Y++S G
Sbjct:   147 TRMQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSG 206

Query:   210 AGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPXXXXXX 269
               G IP ++A L  ++  W +D   T +IPDFIG+WTKL +LR  G    GPIP      
Sbjct:   207 LSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSFSNL 266

Query:   270 XXXXXXRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNN 329
                   R+ DI + SSSLDF+  +K+L+ L LRN  +TG+IPS IGE  +L+ +DLSFN 
Sbjct:   267 TSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNK 326

Query:   330 LTGQIPRTLFNIGSLNYLFLGNNSLSGTLPTQKSENLQNIDLSYNHLSGPFPSWVT-SNL 388
             L G IP +LFN+  L +LFLGNN+L+G+ PTQK+++L+N+D+SYN LSG  PSWV+  +L
Sbjct:   327 LHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQKTQSLRNVDVSYNDLSGSLPSWVSLPSL 386

Query:   389 QMNLVANNFTFDRSNISVFPGLHCLQRNFPCNRNAPRYANFSIKCGGKQMRA-DNIVYEA 447
             ++NLVANNFT +  +  V PGL+CLQ+NFPCNR    Y++FSI CGG + R+    ++E 
Sbjct:   387 KLNLVANNFTLEGLDNRVLPGLNCLQKNFPCNRGKGIYSDFSINCGGPEKRSVTGALFER 446

Query:   448 DNSSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNTLGQVTGTRTPELYQTSRISPGS 507
             ++     +S+ V+  ++W  S+VG F    N  Y+  +  Q   T   EL+Q++R+S  S
Sbjct:   447 EDEDFGPASFFVSAGQRWAASSVGLFAGSSNNIYIATSQSQFVNTLDSELFQSARLSASS 506

Query:   508 LRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARRVFDIYIQGTLRWKDFDISKEAG 567
             +RYYGLGLENG Y V+L FAE  IL  ++  W+ L RR FDIY+QG L  KDFD+ + AG
Sbjct:   507 VRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDIYVQGRLVEKDFDVRRTAG 566

Query:   568 GPN-RAIIKNFNATVSENHLEIHLFWAGKGTCCVPKQGDYGPAISALSVVSAFKPSVSGL 626
                 RA+ + + A VSENHLE+HLFWAGKGTCC+P QG YGP ISA+S    F P+V+  
Sbjct:   567 DSTVRAVQRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGPLISAVSATPDFTPTVANK 626

Query:   627 PPSTAGNKNHTGLIVGIAVPLGILGLIAISIVFYMR--RKKDNDDEEVLVGIDSKPNTFS 684
             PPS    KN TG IVG+ V +G+L ++A  ++F +R  RK+  DDEE+L G+D KP  F+
Sbjct:   627 PPSKG--KNRTGTIVGVIVGVGLLSILAGVVMFTIRKRRKRYTDDEELL-GMDVKPYIFT 683

Query:   685 YAELRSATQDFDPSNKLGEGGYGPVYK 711
             Y+EL+SATQDFDPSNKLGEGG+GPVYK
Sbjct:   684 YSELKSATQDFDPSNKLGEGGFGPVYK 710
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=ISS
TAIR|locus:2205260 AT1G56120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019367 AT1G29740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019317 AT1G29730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203847 RKF1 "receptor-like kinase in flowers 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C0LGH2Y1561_ARATH2, ., 7, ., 1, 1, ., 10.50350.76730.6744yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035223001
SubName- Full=Chromosome chr10 scaffold_76, whole genome shotgun sequence; (992 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query907
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 8e-52
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-43
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-39
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-32
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-27
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information 
 Score =  178 bits (453), Expect = 8e-52
 Identities = 78/190 (41%), Positives = 98/190 (51%), Gaps = 31/190 (16%)

Query: 428 NFSIKCGGKQMR-ADNIVYEADN-SSLSASSYAVTNTEKWGVSNVGFFYERENPAYVLNT 485
             +I CGG +   +D I YEAD   +  ++ Y V++T                     N 
Sbjct: 2   VLAINCGGPEHTDSDGITYEADTYFTGGSADYYVSDT---------------------NG 40

Query: 486 LGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWESLARR 545
              + GT  PELYQT R SP S  YY   LENG Y V L FAE    +        L RR
Sbjct: 41  SSSIAGTTDPELYQTERYSPSSFSYYIPCLENGNYTVILHFAEIYFGED------GLGRR 94

Query: 546 VFDIYIQGTLRWKDFDISKEAGGPNRAIIKNF-NATVSENHLEIHLFWAGKGTCCVPKQG 604
           VFD+Y+QG L  KDFDI  EAGG  +   K +   TV++  LEIH +WAGKGT  +P +G
Sbjct: 95  VFDVYVQGKLVLKDFDIVAEAGGKGKTAHKEYIPVTVTDGTLEIHFYWAGKGTLLIPFRG 154

Query: 605 DYG-PAISAL 613
            YG P ISA+
Sbjct: 155 VYGNPKISAI 164

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. Length = 164
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 907
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
PLN032101153 Resistant to P. syringae 6; Provisional 99.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.78
PLN032101153 Resistant to P. syringae 6; Provisional 99.78
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.78
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.68
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.68
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.62
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.62
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.6
PLN03150623 hypothetical protein; Provisional 99.57
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.56
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.55
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.53
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.53
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.5
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.5
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.5
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.47
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.46
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.45
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.45
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.44
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.43
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.43
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.42
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.42
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.41
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.41
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.4
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.39
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.39
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.39
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.39
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.39
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.38
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.38
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.38
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.38
PTZ00283 496 serine/threonine protein kinase; Provisional 99.38
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.37
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.37
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.37
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.36
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.36
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.36
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.36
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.36
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.35
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.35
PHA02882294 putative serine/threonine kinase; Provisional 99.35
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.35
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.35
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.35
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.35
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.35
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.35
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.35
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.34
KOG0595429 consensus Serine/threonine-protein kinase involved 99.34
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.34
PTZ00284467 protein kinase; Provisional 99.34
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.34
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.34
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.34
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.34
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.34
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.33
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.33
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.33
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.33
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.33
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.33
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.33
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.33
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.33
PHA02988283 hypothetical protein; Provisional 99.33
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.32
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.32
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.32
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.32
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.32
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.31
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.31
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.31
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.31
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.31
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.31
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.31
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.31
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.3
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.3
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.3
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.3
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.3
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.3
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.3
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.3
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.29
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.29
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.29
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.29
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.29
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.29
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.29
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.29
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.28
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.28
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.28
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.28
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.28
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.28
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.28
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.28
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.27
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.27
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.27
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.27
PTZ00036440 glycogen synthase kinase; Provisional 99.27
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.27
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.27
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.27
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.27
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.27
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.27
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.27
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.27
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.27
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.26
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.26
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.26
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.26
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.26
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.26
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.26
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.26
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.25
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.25
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.25
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.25
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.25
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.25
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.25
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.25
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.25
PHA03212391 serine/threonine kinase US3; Provisional 99.25
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.25
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.25
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.25
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.25
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.25
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.24
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.24
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.24
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.24
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.24
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.24
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.24
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.24
KOG0596677 consensus Dual specificity; serine/threonine and t 99.24
KOG3653534 consensus Transforming growth factor beta/activin 99.24
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.24
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.24
PTZ00267478 NIMA-related protein kinase; Provisional 99.24
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.24
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.24
PHA03209357 serine/threonine kinase US3; Provisional 99.24
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.24
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.23
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.23
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.23
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.23
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.23
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.23
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.23
KOG0578550 consensus p21-activated serine/threonine protein k 99.23
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.23
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.23
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.23
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.22
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.22
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.22
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.22
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.22
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.22
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.22
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.22
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.21
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.21
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.21
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.21
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.21
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.2
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.2
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.2
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.2
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.2
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.2
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.2
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.2
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.19
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.19
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.19
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.19
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.19
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.19
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.19
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.19
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.18
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.18
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.18
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.18
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.18
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.18
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.18
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.18
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.18
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.18
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.18
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.18
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.17
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.17
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.17
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.17
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.17
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.16
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.16
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.16
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.16
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.16
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.16
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.16
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.15
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.15
PHA03207392 serine/threonine kinase US3; Provisional 99.15
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.15
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.15
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.15
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.15
KOG0605550 consensus NDR and related serine/threonine kinases 99.15
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.14
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.14
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.14
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.14
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.14
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.14
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.14
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.14
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.14
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.13
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.13
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.13
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.13
PHA03211461 serine/threonine kinase US3; Provisional 99.12
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.12
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.12
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.12
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.12
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.12
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.12
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.12
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.12
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.11
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.11
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.11
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.11
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.11
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.11
PLN00009294 cyclin-dependent kinase A; Provisional 99.11
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.11
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.11
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.11
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.1
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.1
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.1
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.1
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.1
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.09
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.09
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.09
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.09
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.09
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.09
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.09
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.08
KOG0584 632 consensus Serine/threonine protein kinase [General 99.08
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.08
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.08
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.08
PLN03150623 hypothetical protein; Provisional 99.08
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.08
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.08
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.07
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.07
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.07
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.07
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.06
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.06
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.06
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.06
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.06
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.05
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.05
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.05
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.05
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.05
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.05
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.05
PHA03210501 serine/threonine kinase US3; Provisional 99.04
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.04
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.04
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.04
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.03
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.03
KOG0198313 consensus MEKK and related serine/threonine protei 99.03
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.03
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.02
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 99.02
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.02
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.01
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.01
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.01
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.0
KOG0589426 consensus Serine/threonine protein kinase [General 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.99
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 98.99
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.99
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.98
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.98
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 98.97
KOG0696683 consensus Serine/threonine protein kinase [Signal 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 98.95
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 98.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.94
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 98.93
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.93
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.93
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 98.93
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.92
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.91
KOG0663419 consensus Protein kinase PITSLRE and related kinas 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
KOG0671415 consensus LAMMER dual specificity kinases [Signal 98.89
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 98.89
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.88
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.87
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.86
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.85
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 98.84
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.81
KOG0616355 consensus cAMP-dependent protein kinase catalytic 98.8
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 98.79
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.78
PLN00181 793 protein SPA1-RELATED; Provisional 98.77
KOG0583370 consensus Serine/threonine protein kinase [Signal 98.76
KOG0660359 consensus Mitogen-activated protein kinase [Signal 98.76
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 98.76
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.72
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.71
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.69
KOG1151775 consensus Tousled-like protein kinase [Signal tran 98.68
KOG0610459 consensus Putative serine/threonine protein kinase 98.67
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.64
PTZ00024335 cyclin-dependent protein kinase; Provisional 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 98.57
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 98.56
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 98.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG0195448 consensus Integrin-linked kinase [Signal transduct 98.5
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 98.48
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 98.47
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 98.45
KOG0607463 consensus MAP kinase-interacting kinase and relate 98.42
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 98.39
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 98.39
PLN03224507 probable serine/threonine protein kinase; Provisio 98.37
KOG0695593 consensus Serine/threonine protein kinase [Signal 98.37
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 98.35
KOG1027903 consensus Serine/threonine protein kinase and endo 98.34
KOG0611 668 consensus Predicted serine/threonine protein kinas 98.33
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 98.29
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 98.29
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG1290590 consensus Serine/threonine protein kinase [Signal 98.24
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG0586 596 consensus Serine/threonine protein kinase [General 98.19
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.14
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG1345378 consensus Serine/threonine kinase [Signal transduc 98.13
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 98.05
KOG06081034 consensus Warts/lats-like serine threonine kinases 98.02
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
KOG1167418 consensus Serine/threonine protein kinase of the C 97.89
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.85
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 97.71
PRK15386426 type III secretion protein GogB; Provisional 97.63
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 97.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.58
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.33
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.25
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.19
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 97.09
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.02
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 96.95
KOG0590601 consensus Checkpoint kinase and related serine/thr 96.93
KOG0606 1205 consensus Microtubule-associated serine/threonine 96.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.87
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 96.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.79
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 96.66
KOG1152772 consensus Signal transduction serine/threonine kin 96.57
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.4
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.81
KOG4341483 consensus F-box protein containing LRR [General fu 95.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.37
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 95.02
KOG4308478 consensus LRR-containing protein [Function unknown 94.57
KOG1266458 consensus Protein kinase [Signal transduction mech 94.54
PF11721174 Malectin: Di-glucose binding within endoplasmic re 94.38
KOG4308478 consensus LRR-containing protein [Function unknown 94.31
COG0515384 SPS1 Serine/threonine protein kinase [General func 94.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.2
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 92.58
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.03
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 91.19
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.95
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 90.65
KOG2137 700 consensus Protein kinase [Signal transduction mech 90.12
KOG06061205 consensus Microtubule-associated serine/threonine 89.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 84.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.18
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.4e-61  Score=610.71  Aligned_cols=335  Identities=31%  Similarity=0.497  Sum_probs=253.3

Q ss_pred             CHHHHHHHHHHHHhCCCC--CCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCeeecCCCCCCceeeEEEEEeccCCcccc
Q 002562           40 DPAEVRALNSILQQWDAP--AVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKGV  117 (907)
Q Consensus        40 ~~~~~~aL~~~~~~~~~~--~~~~W~~~~~~C~~~~~w~~~~~~~~~~~~~gv~C~~~~~~~~~~~l~~L~l~~~~l~~~  117 (907)
                      +++|++||++||+++.++  .+.+|+...++|    .|            .||+|+.      ..+|+.|++.++++++.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c----~w------------~gv~c~~------~~~v~~L~L~~~~i~~~   84 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVC----LW------------QGITCNN------SSRVVSIDLSGKNISGK   84 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCC----cC------------cceecCC------CCcEEEEEecCCCcccc
Confidence            468999999999999754  357898667888    47            8999972      24799999999999999


Q ss_pred             CCccccCCCCCCEEEccCCcCCCCCChhhc-CCccCcEEEcccccCCCCcccccCCCCCCCEEEecCccCCCCCchhhcC
Q 002562          118 IPEELVTLQYLTFLKIDQNFFTGPLPSFIG-NLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGN  196 (907)
Q Consensus       118 ~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~-~L~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~  196 (907)
                      ++..|..+++|++|+|++|++++.+|..+. .+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+++.+|..+++
T Consensus        85 ~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~  162 (968)
T PLN00113         85 ISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGS  162 (968)
T ss_pred             CChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhc
Confidence            999999999999999999999888887654 888888888888888877664  45677777777777777777777777


Q ss_pred             CCcccEEEccccCCCCCCChhhcCCcCccEeeccCCcCcccCCccccCcccccEEEeecccccCCCCcccCCCCCCCEEE
Q 002562          197 LAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLR  276 (907)
Q Consensus       197 l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~  276 (907)
                      +++|++|+|++|.+.+.+|..+.++++|++|++++|.+++.+|..++++++|++|+|++|.+++.+|..+.++++|++|+
T Consensus       163 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  242 (968)
T PLN00113        163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLD  242 (968)
T ss_pred             CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEE
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             ccCCcCCCCChhhhcCCCCCCeeecccccCccCCCccCCCCCCCCEEeCcCCCCCCCCchhhhCCCCCcEEEccCCCCcc
Q 002562          277 ISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSG  356 (907)
Q Consensus       277 L~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~  356 (907)
                      +++|.+....+..+.++++|++|++++|.+.+.+|..+..+++|+.|+|++|.+.+.+|..+.++++|++|++++|.+++
T Consensus       243 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~  322 (968)
T PLN00113        243 LVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG  322 (968)
T ss_pred             CcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCC
Confidence            77777666666667777777777777777776677777777777777777777776677777777777777777777766


Q ss_pred             cCCCCC--CCCCcEEeccCCcCCCCCChhhc--cccc-ccccccccc
Q 002562          357 TLPTQK--SENLQNIDLSYNHLSGPFPSWVT--SNLQ-MNLVANNFT  398 (907)
Q Consensus       357 ~~p~~~--~~~L~~L~Ls~N~l~g~~p~~~~--~~l~-L~l~~N~~~  398 (907)
                      .+|...  +++|+.|+|++|.+++.+|..+.  ..|+ |++++|+++
T Consensus       323 ~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~  369 (968)
T PLN00113        323 KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT  369 (968)
T ss_pred             cCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeE
Confidence            666532  36667777777777666666554  3455 666666655

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query907
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-23
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-23
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-05
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-17
3uim_A326 Structural Basis For The Impact Of Phosphorylation 2e-17
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 2e-14
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 2e-14
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 9e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-05
2nry_A307 Crystal Structure Of Irak-4 Length = 307 9e-05
2nru_A307 Crystal Structure Of Irak-4 Length = 307 9e-05
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 1e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 2e-04
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-04
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 143/288 (49%), Gaps = 10/288 (3%)
Query: 99  GATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVA 158
           G+   +  L+++    +G IP+EL+ ++ L  L +D N  TG +PS + N + L  +S++
Sbjct: 436 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLS 495
Query: 159 HNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTY 218
           +N  +G +P+ +G L+ L +L   NN+FSG +P E+G+   L  L LN+    G IP+  
Sbjct: 496 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 555
Query: 219 AKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGN--SFQGPIPXXXXXXXXXXXXR 276
            K    Q+   +     GK   +I N    K     GN   FQG                
Sbjct: 556 FK----QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN 611
Query: 277 I-SDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIP 335
           I S +Y   +S  F  +  ++  L +   +++G IP  IG +  L  L+L  N+++G IP
Sbjct: 612 ITSRVYGGHTSPTFDNN-GSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 670
Query: 336 RTLFNIGSLNYLFLGNNSLSGTLPTQKSE--NLQNIDLSYNHLSGPFP 381
             + ++  LN L L +N L G +P   S    L  IDLS N+LSGP P
Sbjct: 671 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP 718
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query907
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-66
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-56
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-58
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 7e-51
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 7e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-43
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 4e-11
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 7e-41
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 7e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 4e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-21
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
3soc_A322 Activin receptor type-2A; structural genomics cons 5e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 9e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 3e-04
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-04
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 9e-04
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  235 bits (601), Expect = 5e-66
 Identities = 91/297 (30%), Positives = 131/297 (44%), Gaps = 20/297 (6%)

Query: 116 GVIPEELVT---LQYLTFLKIDQNFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGN 172
           G      V       L  L I  N  +G +   +     L  L V+ N FS  +P  LG+
Sbjct: 165 GANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIP-FLGD 221

Query: 173 LKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIPSTYAKLRNMQTLWASDA 232
              L  L    N  SG     I    +L+ L ++S    G IP     L+++Q L  ++ 
Sbjct: 222 CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYLSLAEN 279

Query: 233 PFTGKIPDFI-GNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSL--DF 289
            FTG+IPDF+ G    L  L   GN F G +P      + L+SL +S   N S  L  D 
Sbjct: 280 KFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS-NNFSGELPMDT 338

Query: 290 VMSLKNLTDLSLRNALITGSIPSGIGEL-QNLQTLDLSFNNLTGQIPRTLFNIG--SLNY 346
           ++ ++ L  L L     +G +P  +  L  +L TLDLS NN +G I   L      +L  
Sbjct: 339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 398

Query: 347 LFLGNNSLSGTLPTQ--KSENLQNIDLSYNHLSGPFPSWVT--SNLQM-NLVANNFT 398
           L+L NN  +G +P        L ++ LS+N+LSG  PS +   S L+   L  N   
Sbjct: 399 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 455
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 907
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-13
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-13
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-13
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-13
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-12
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-12
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-11
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 6e-11
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-10
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-10
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-10
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-10
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-05
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-10
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-09
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-09
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-09
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-09
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 9e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-08
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-08
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-08
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-07
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-07
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-07
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-06
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 8e-06
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-05
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-04
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-04
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-04
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-04
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.001
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 0.001
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 0.002
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 90.2 bits (222), Expect = 3e-20
 Identities = 87/324 (26%), Positives = 133/324 (41%), Gaps = 28/324 (8%)

Query: 40  DPAEVRALNSILQQWDAPAV-PLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDN 98
           +P + +AL  I +    P     W  + + C+ +                 ++CD    +
Sbjct: 4   NPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTW--------------LGVLCD---TD 46

Query: 99  GATCHITKLRVYALNKKGV--IPEELVTLQYLTFLKIDQN-FFTGPLPSFIGNLSRLMLL 155
             T  +  L +  LN      IP  L  L YL FL I       GP+P  I  L++L  L
Sbjct: 47  TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYL 106

Query: 156 SVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLYLNSWGAGGEIP 215
            + H   SG++P  L  +K L  L F  N  SGTLPP I +L  L  +  +     G IP
Sbjct: 107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166

Query: 216 STYAKLRNMQTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDS- 274
            +Y    +   L+ S      ++   I       +L F   S       +     S  + 
Sbjct: 167 DSYG---SFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNT 223

Query: 275 -LRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQ 333
                   +++  L  V   KNL  L LRN  I G++P G+ +L+ L +L++SFNNL G+
Sbjct: 224 QKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE 283

Query: 334 IPRTLFNIGSLNYL-FLGNNSLSG 356
           IP    N+   +   +  N  L G
Sbjct: 284 IP-QGGNLQRFDVSAYANNKCLCG 306
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query907
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.96
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.95
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.94
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.93
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.93
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.93
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.93
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.93
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.93
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.93
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.93
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.93
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.93
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.93
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.93
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.92
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.92
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.92
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.92
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.91
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.91
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.9
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.9
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.89
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.89
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.89
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.88
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.88
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.88
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.87
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.87
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.87
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.87
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.87
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.87
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.87
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.87
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.86
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.85
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.85
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.85
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.85
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.84
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.84
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.84
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.83
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.83
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.83
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.83
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.83
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.82
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.81
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.8
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.8
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.8
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.79
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.79
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.78
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.77
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.77
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.76
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.72
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.65
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.59
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.86
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 87.63
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=0  Score=297.93  Aligned_cols=298  Identities=28%  Similarity=0.465  Sum_probs=234.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEEEECCCCCCC
Q ss_conf             99989999999999829999-99998788989999987887767889999998030687899960109999943677555
Q 002562           38 TTDPAEVRALNSILQQWDAP-AVPLWNISGEPCSGSALNATDSEFESPNNNPAIVCDCTFDNGATCHITKLRVYALNKKG  116 (907)
Q Consensus        38 ~~~~~~~~aL~~~~~~~~~~-~~~~W~~~~~~C~~~~~w~~~~~~~~~~~~~gv~C~~~~~~~~~~~v~~L~l~~~~l~g  116 (907)
                      -|.++|++||++||+++.++ .+.+|..++|||.+  .|            .||+|+..   +...+|+.|++.+++++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~~--~w------------~gv~C~~~---~~~~~v~~L~L~~~~l~g   64 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNR--TW------------LGVLCDTD---TQTYRVNNLDLSGLNLPK   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTTT--CS------------TTEEECCS---SSCCCEEEEEEECCCCSS
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC--CC------------CCEEEECC---CCCEEEEEEECCCCCCCC
T ss_conf             98989999999999977999867788999999889--48------------89697489---994798899898998888


Q ss_pred             --CCCCCCCCCCCCCEEECCC-CCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHH
Q ss_conf             --5880013999998997647-7689988700038856758973266688886634579989997980173388789610
Q 002562          117 --VIPEELVTLQYLTFLKIDQ-NFFTGPLPSFIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPE  193 (907)
Q Consensus       117 --~~p~~l~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~  193 (907)
                        .+|+.+.++++|++|+|++ |++.|.+|..|+++++|++|+|++|.+.+..+..+..+..|++++++.|.+.+.+|..
T Consensus        65 ~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~  144 (313)
T d1ogqa_          65 PYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPS  144 (313)
T ss_dssp             CEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGG
T ss_pred             CCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHH
T ss_conf             88798478467533520202654333002431145420011020356434433222220111001111224555568512


Q ss_pred             HCCCCCCCEEECCCCCCCCCCCHHHCCCCCC-CEEECCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             0388866699833658998897000499676-574424875865577122486666478821563568798223799999
Q 002562          194 IGNLAKLEQLYLNSWGAGGEIPSTYAKLRNM-QTLWASDAPFTGKIPDFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASL  272 (907)
Q Consensus       194 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  272 (907)
                      +.++++|+.+++++|.+.+.+|..+..+.++ +.+.++.|++++..|..+..+.. ..+++..+.+.+.+|..+..++++
T Consensus       145 l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l  223 (313)
T d1ogqa_         145 ISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNT  223 (313)
T ss_dssp             GGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCC
T ss_pred             HCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             2067400000023553356203121443112323102246435332433222222-233333343322222222222221


Q ss_pred             CEEECCCCCCCCCCHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHCCCCCCEEECCCC
Q ss_conf             97971587699889232229987785434366476689835899999988947689788778432208999868976478
Q 002562          273 DSLRISDIYNVSSSLDFVMSLKNLTDLSLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNN  352 (907)
Q Consensus       273 ~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N  352 (907)
                      +.+                        ++++|.+.+.++ .++.+++|+.|+|++|++++.+|..+..+++|++|+|++|
T Consensus       224 ~~l------------------------~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N  278 (313)
T d1ogqa_         224 QKI------------------------HLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN  278 (313)
T ss_dssp             SEE------------------------ECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSS
T ss_pred             CCC------------------------CCCCCCCCCCCC-CCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEECCCC
T ss_conf             112------------------------222222222222-2224554444447657066608768847999998979588


Q ss_pred             CCCCCCCCCC-CCCCCEEECCCCC-CCC
Q ss_conf             7966689887-9997689533786-789
Q 002562          353 SLSGTLPTQK-SENLQNIDLSYNH-LSG  378 (907)
Q Consensus       353 ~l~g~~p~~~-~~~L~~L~Ls~N~-l~g  378 (907)
                      +++|.+|... ..+|+.+++++|+ ++|
T Consensus       279 ~l~g~iP~~~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         279 NLCGEIPQGGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             EEEEECCCSTTGGGSCGGGTCSSSEEES
T ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCCCCC
T ss_conf             3516689866679989788688950019
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure