Citrus Sinensis ID: 002594


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900---
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR
cccccHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHccHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHccccccHHccHHHHHHHHcccHHHHHHHcccHHHHHcccccHHHHHHcHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHcccccccccHHHHHHHHHHHccccccccccHHHHccHHHHHcccccccccccHHHHHHcccccccc
cHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHccccccccccccHHHccccccHHHHHHHccHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHcHcHHHHHHHccccHHHHHHHHHHHHHHcHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHcHHHHHHHHHHHHccHEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEHHHHHHHHccccccccHHHHHHEEEEEcHcccc
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGcafsalgrkEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKqdrsvtceydvsnsmssltvsesglnandkmsetsenhnksdicdsssqsrdvsetcsksshdpdlcngrsdeakggssvpvsksglhingklrevsenhngssdgsksthasrdaseinrqssddfdicngpidkasvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQilkedpmypealigRGTARAFQRELEAAISDFTEAiqsnpsagEAWKRRGQARAALGESVEAIQDLSKalefepnsadilhergivnfkfkdFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDlssglgidpsnieCLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASkinsefcwfdidgdidplfkeywckrlhpknvcekvyrqpplrdslkkgklrrqdfsvTKQKTALLLVADSIGkkiqydcpgflsnRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKysnrssskngkrarrkdriniasqnrggagcstssssdtssygiteerssghpkmswqDVYTLAVKWRqisepcdpvvWVNKLSeefnsgfgshtpmilgqAKVVRYFPNYAR
mlkrklldsryrlnkthkticeidelvrvDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETsenhnksdicdsssqsrDVSEtcsksshdpdlcngrsdeakggssvpvsksgLHINGKLrevsenhngssdgsksthasrdaseinrqssddfdicNGPIDKAsvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklsfkWDMLKetsneakrnkkfcvtrisksksisvdfrlsrgiaqvnegkyASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRlhpknvcekvyrqpplrdslkkgklrrqdfsvtkqktaLLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAewkysnrssskngkrarrkdriniasqnrggagcstssssdtssygiteerssghpkmswQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSgfgshtpmilgqakvVRYFPNYAR
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAkggssvpvsksgLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKlssdsaslndsntnsesyskssisdnkssdstesrsklsFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYhlrglllhglgqhKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCstssssdtssYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR
*********RYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQ**SVTCE************************************************************************************************************************************************************************************************************KFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDF*************************************LEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQ***************DFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKY******************************************************SWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPN***
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQA********************RINIASQNRGGAGCST******************HPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYA*
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNAN*************************************LCNGRS**********VSKSGLHINGKLREVS***********************RQSSDDFDICNGPIDKASVNER**************************************************KLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS******************GESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWK***************KDRINIASQ******************************MSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNR***************************KMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query903 2.2.26 [Sep-21-2011]
Q8NBP0 860 Tetratricopeptide repeat yes no 0.514 0.540 0.282 4e-56
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.227 0.209 0.255 1e-12
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.286 0.278 0.242 5e-12
O82039 932 Probable UDP-N-acetylgluc N/A no 0.241 0.233 0.248 5e-11
Q68FQ7659 RNA polymerase II-associa no no 0.261 0.358 0.269 5e-10
Q96301 914 Probable UDP-N-acetylgluc no no 0.241 0.238 0.248 8e-10
Q04737248 TPR repeat-containing pro N/A no 0.161 0.588 0.270 1e-09
Q5ZKQ3665 RNA polymerase II-associa no no 0.261 0.354 0.252 2e-09
Q86TZ1520 Tetratricopeptide repeat no no 0.271 0.471 0.252 2e-09
Q54VG4334 Small glutamine-rich tetr no no 0.128 0.347 0.316 4e-09
>sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 Back     alignment and function desciption
 Score =  220 bits (561), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 149/527 (28%), Positives = 257/527 (48%), Gaps = 62/527 (11%)

Query: 380 SVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQ-----RELEAA 434
           S +  L+     +  G Y  AI  F  +L+E+P    A+ GRG A   +     +  E A
Sbjct: 142 STNEELAIAYVLIGSGLYDEAIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELA 201

Query: 435 ISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNF 494
           + + +  I   P   E +++R +  + LG   EA+ DL+KA++ +P SA +   RG + F
Sbjct: 202 LFELSRVITLEPDRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQP-SARLYRHRGTLYF 260

Query: 495 KFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAW 554
             +D+  A ED    ++L+K    A  Y GL     G  K+A E+  +A++   +F++A+
Sbjct: 261 ISEDYATAHEDFQQSLELNKNQPIAMLYKGLTFFHRGLLKEAIESFKEALKQKVDFIDAY 320

Query: 555 GHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGI 614
             L Q Y++L N E A E  Q+ L +++   +   LRG++L+  G  ++A+K+    L +
Sbjct: 321 KSLGQAYRELGNFEAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQL 380

Query: 615 DPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAF-YQKEIALYTA 673
           +P N  C Y++   + A+G++ E IK     +  +    +K   + L   Y +E + Y  
Sbjct: 381 EPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLH 440

Query: 674 SKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVT 733
           + +++    ++ID D+   FK++W K L    + E    QP L+  +K   +  Q+F   
Sbjct: 441 AHLDTPLTEYNIDVDLPGSFKDHWAKNL--PFLIEDYEEQPGLQPHIK--DVLHQNFESY 496

Query: 734 KQKTA-LLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYS 792
           K +   L+ VAD +G  +QY+ PGFL N+R HR  GLAA+E+ Q V + W         +
Sbjct: 497 KPEVQELICVADRLGSLMQYETPGFLPNKRIHRAMGLAALEVMQAVQRTW---------T 547

Query: 793 NRSSSKNGKRARRKDRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYT 852
           N     NG     K R+                                   M W+D++ 
Sbjct: 548 NSKVRMNG-----KTRL-----------------------------------MQWRDMFD 567

Query: 853 LAVKWRQISEPCDPVVWVNKL-SEEFNSGFGSHTPMILGQAKVVRYF 898
           +AVKWR+I++P  PV+W++++ +   + GF +H  +I GQ   +RY 
Sbjct: 568 IAVKWRRIADPDQPVLWLDQMPARSLSRGFNNHINLIRGQVINMRYL 614





Homo sapiens (taxid: 9606)
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0751 PE=4 SV=1 Back     alignment and function description
>sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 Back     alignment and function description
>sp|Q86TZ1|TTC6_HUMAN Tetratricopeptide repeat protein 6 OS=Homo sapiens GN=TTC6 PE=2 SV=1 Back     alignment and function description
>sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query903
255567975 1101 tetratricopeptide repeat protein, tpr, p 0.957 0.785 0.724 0.0
225438920 1068 PREDICTED: tetratricopeptide repeat prot 0.918 0.776 0.697 0.0
357482703798 Tetratricopeptide repeat protein [Medica 0.875 0.991 0.653 0.0
357482705 1033 Tetratricopeptide repeat protein [Medica 0.875 0.765 0.653 0.0
357482701 1062 Tetratricopeptide repeat protein [Medica 0.875 0.744 0.653 0.0
449520722 1046 PREDICTED: tetratricopeptide repeat prot 0.894 0.772 0.646 0.0
449448472 1046 PREDICTED: tetratricopeptide repeat prot 0.894 0.772 0.646 0.0
356565517 1042 PREDICTED: tetratricopeptide repeat prot 0.888 0.769 0.654 0.0
356496945 1047 PREDICTED: tetratricopeptide repeat prot 0.884 0.763 0.650 0.0
297798124 1043 hypothetical protein ARALYDRAFT_912592 [ 0.882 0.764 0.615 0.0
>gi|255567975|ref|XP_002524965.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223535800|gb|EEF37462.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/872 (72%), Positives = 723/872 (82%), Gaps = 7/872 (0%)

Query: 33  MASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDC 92
           MASAI+ R+ELAKLC+ R+WSKAIR+LDSLL+QS  IQDICNRAFCYSQLELHKHVI+DC
Sbjct: 1   MASAISERVELAKLCASRDWSKAIRVLDSLLSQSCTIQDICNRAFCYSQLELHKHVIKDC 60

Query: 93  DKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTA 152
           DKALQLDP LLQAYILKG AFS+LGRK++AL VW++GYEHAL QSADLKQ LELEELL  
Sbjct: 61  DKALQLDPMLLQAYILKGRAFSSLGRKDDALLVWQQGYEHALRQSADLKQLLELEELLKF 120

Query: 153 AKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNK-SDICDSSSQSRDVSETC 211
           AKQ+R++     V+ S + +  +E   + N K +E S+N ++ SDI +S  +S D SE C
Sbjct: 121 AKQERNIGLRDHVTES-TPMNTTEFATHTNGKSNEASKNRDQLSDISNSCRESGDGSEIC 179

Query: 212 SKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDAS 271
           SK   + D  N   D+A G S + + +   H+NGK  +V  NH+   D SK  + SRD  
Sbjct: 180 SKFGGNFDAMNVIRDKAGGESPITIPECRPHMNGKSDDVCTNHDKLGDKSKLHNESRDTY 239

Query: 272 EINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKS 331
           +I   S D+  I N    KA  + +  +  NGTH+  DK+S DS S N  +  S   SKS
Sbjct: 240 KICCNSGDNCAIQNYLSRKAEGDVKTDK--NGTHNFIDKIS-DSESCNVLSDTSVPSSKS 296

Query: 332 SISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQ 391
           S     S D+++ R KLS K D+  E  +E K++KKF VTRISK+KSI+VDFRLSRGIAQ
Sbjct: 297 STISISSGDTSDIRVKLSNKTDIPNEAGDETKKSKKFSVTRISKTKSITVDFRLSRGIAQ 356

Query: 392 VNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEA 451
           VNEGKYASAISIFDQIL EDP YPEALIGRGTA AFQRELEAAI+DF++AIQSNP AGEA
Sbjct: 357 VNEGKYASAISIFDQILTEDPTYPEALIGRGTAHAFQRELEAAIADFSKAIQSNPLAGEA 416

Query: 452 WKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVK 511
           WKRRGQARAALGES+EAI DL+KALEFEPNSADILHERGIVNFKFKDF+AAV+DLSACVK
Sbjct: 417 WKRRGQARAALGESIEAIHDLTKALEFEPNSADILHERGIVNFKFKDFDAAVQDLSACVK 476

Query: 512 LDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKAL 571
           LDK+NKSAYTYLGLALSS GEYKKAEEAHLK+IQLDR+FLE W HLTQFYQDLAN  KA 
Sbjct: 477 LDKDNKSAYTYLGLALSSTGEYKKAEEAHLKSIQLDRSFLEGWAHLTQFYQDLANLTKAF 536

Query: 572 ECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHA 631
           EC++QVL ID RF+KAYHL GLLLHG+G+H+KAIK+LS GL I+ SNIECLYLRASCYHA
Sbjct: 537 ECIKQVLQIDARFAKAYHLHGLLLHGMGEHRKAIKELSLGLSIENSNIECLYLRASCYHA 596

Query: 632 IGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDP 691
           IGEY EA+KDYDA LD+ELDSMEKFVLQCLAFYQKE+ALYTASKINSEFCWFDIDGDIDP
Sbjct: 597 IGEYGEAVKDYDATLDMELDSMEKFVLQCLAFYQKELALYTASKINSEFCWFDIDGDIDP 656

Query: 692 LFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQ 751
           LFKEYWCKRLHPKNVCEKVYRQPPLRDSLK+GKLR+QDF +TKQKTALL+ ADSIGKKIQ
Sbjct: 657 LFKEYWCKRLHPKNVCEKVYRQPPLRDSLKRGKLRKQDFVITKQKTALLMAADSIGKKIQ 716

Query: 752 YDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINI 811
           YDCPGFL NRRQHRMAGLAAIEIAQKVSK WRSLQAEWK+SN+S SK GK+ RR  RIN+
Sbjct: 717 YDCPGFLPNRRQHRMAGLAAIEIAQKVSKAWRSLQAEWKHSNKSMSKYGKKTRR--RINM 774

Query: 812 ASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVN 871
            SQNRGGAGCS++SS  ++SYGI+EERSSG   +SWQDVY+LAVKWRQISEPCDPVVWVN
Sbjct: 775 PSQNRGGAGCSSNSSETSTSYGISEERSSGRHMISWQDVYSLAVKWRQISEPCDPVVWVN 834

Query: 872 KLSEEFNSGFGSHTPMILGQAKVVRYFPNYAR 903
           KLSEEFN+GFGS TP+ILGQAKVVRY+ NY R
Sbjct: 835 KLSEEFNTGFGSQTPLILGQAKVVRYYMNYER 866




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438920|ref|XP_002279290.1| PREDICTED: tetratricopeptide repeat protein 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357482703|ref|XP_003611638.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512973|gb|AES94596.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357482705|ref|XP_003611639.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512974|gb|AES94597.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357482701|ref|XP_003611637.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512972|gb|AES94595.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449520722|ref|XP_004167382.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448472|ref|XP_004141990.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356565517|ref|XP_003550986.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|356496945|ref|XP_003517325.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|297798124|ref|XP_002866946.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] gi|297312782|gb|EFH43205.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query903
TAIR|locus:2126347 1052 SRFR1 "SUPPRESSOR OF RPS4-RLD 0.599 0.514 0.719 4.2e-261
ZFIN|ZDB-GENE-080722-25 826 ttc13 "tetratricopeptide repea 0.435 0.475 0.296 2.5e-47
DICTYBASE|DDB_G0272186 1050 DDB_G0272186 "TPR_1 repeat-con 0.246 0.212 0.290 1.7e-44
UNIPROTKB|Q74DZ8266 GSU1166 "TPR domain protein" [ 0.246 0.838 0.271 1.7e-14
TIGR_CMR|GSU_1166266 GSU_1166 "TPR domain protein" 0.246 0.838 0.271 1.7e-14
UNIPROTKB|F1NNH9599 TOMM70A "Uncharacterized prote 0.299 0.450 0.224 5.3e-12
UNIPROTKB|P72802266 mom72 "Mitochondrial outer mem 0.201 0.684 0.279 1.3e-11
RGD|1303049610 Tomm70a "translocase of outer 0.307 0.455 0.223 4.2e-11
MGI|MGI:106295611 Tomm70a "translocase of outer 0.307 0.454 0.223 4.2e-11
ZFIN|ZDB-GENE-041121-17542 stip1 "stress-induced-phosphop 0.199 0.332 0.247 1.5e-10
TAIR|locus:2126347 SRFR1 "SUPPRESSOR OF RPS4-RLD 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2092 (741.5 bits), Expect = 4.2e-261, Sum P(2) = 4.2e-261
 Identities = 393/546 (71%), Positives = 460/546 (84%)

Query:   359 SNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEAL 418
             S+E+++NKK+ + RIS + SISVDFRLSRGIAQVNEG Y  AISIFD++LKE+P YPEAL
Sbjct:   275 SDESRKNKKYTIARISGTHSISVDFRLSRGIAQVNEGNYTKAISIFDKVLKEEPTYPEAL 334

Query:   419 IGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEF 478
             IGRGTA AFQRELE+AI+DFT+AIQSNP+A EAWKRRGQARAALGE VEA++DL+KAL F
Sbjct:   335 IGRGTAYAFQRELESAIADFTKAIQSNPAASEAWKRRGQARAALGEYVEAVEDLTKALVF 394

Query:   479 EPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEE 538
             EPNS D+LHERGIVNFK KDF AAV+DLS C+K +K+NKSAYTYLGLA +S+GEYKKAEE
Sbjct:   395 EPNSPDVLHERGIVNFKSKDFTAAVKDLSICLKQEKDNKSAYTYLGLAFASLGEYKKAEE 454

Query:   539 AHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYXXXXXXXXXX 598
             AHLK+IQLD N+LEAW HL QFYQ+LA+  KALEC++QVL +D R  KAY          
Sbjct:   455 AHLKSIQLDSNYLEAWLHLAQFYQELADHCKALECIEQVLQVDNRVWKAYHLRGLVFHGL 514

Query:   599 XXXKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVL 658
                +KAI++LS GL I+ + IECLYLR SCYHA+GEYR+A+KDYDA +D+ELD++EKFVL
Sbjct:   515 GEHRKAIQELSIGLSIE-NTIECLYLRGSCYHAVGEYRDAVKDYDATVDVELDAVEKFVL 573

Query:   659 QCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRD 718
             QCLAFYQKE+ALYTASK++SEF  FDIDGDIDP+FKEYWCKRLHPKNVCEKVYRQPPLR+
Sbjct:   574 QCLAFYQKELALYTASKVSSEFLCFDIDGDIDPMFKEYWCKRLHPKNVCEKVYRQPPLRE 633

Query:   719 SLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKV 778
             SLKKGKL++QD ++TKQK  +L  AD IGK+IQYDCPGFL N+RQHRMAGLA IEIAQKV
Sbjct:   634 SLKKGKLKKQDLAITKQKANILRFADLIGKRIQYDCPGFLPNKRQHRMAGLAVIEIAQKV 693

Query:   779 SKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCXXXXXXXXXX-YGITEE 837
             SK WR    EW+ S + ++KNGK+ RR++R NI SQNRGGAGC           Y   E+
Sbjct:   694 SKAWR---IEWRNSTKGTTKNGKKNRRRERTNILSQNRGGAGCSSSSFSETSTGYASLED 750

Query:   838 RSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRY 897
             RSSG   +SWQDVY+ AV+WRQISEPCDPVVWVNKLSEEFNSGFGSHTPM+LGQAKVVRY
Sbjct:   751 RSSGRSILSWQDVYSPAVRWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMVLGQAKVVRY 810

Query:   898 FPNYAR 903
             FPNY R
Sbjct:   811 FPNYER 816


GO:0042742 "defense response to bacterium" evidence=IGI
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0032947 "protein complex scaffold" evidence=TAS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
ZFIN|ZDB-GENE-080722-25 ttc13 "tetratricopeptide repeat domain 13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272186 DDB_G0272186 "TPR_1 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q74DZ8 GSU1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1166 GSU_1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNH9 TOMM70A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P72802 mom72 "Mitochondrial outer membrane 72K protein" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
RGD|1303049 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:106295 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
scaffold_700334.1
annotation not avaliable (1043 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.7__1942__AT4G23570.3
annotation not avaliable (351 aa)
      0.701

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 6e-21
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-17
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-17
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 8e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-16
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-13
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-13
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-13
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 8e-10
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-09
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-08
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-07
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 7e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-06
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 1e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 6e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 7e-06
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 9e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 1e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-05
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 4e-05
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 6e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-04
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-04
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 2e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 6e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 7e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.001
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.001
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.002
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 0.002
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.004
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
 Score = 94.1 bits (232), Expect = 6e-21
 Identities = 84/290 (28%), Positives = 133/290 (45%), Gaps = 10/290 (3%)

Query: 394 EGKYASAISIFDQILKEDPMYPEALIGRGTAR-AFQRELEAAISDFTEAIQSNPSAGEA- 451
                 A++I  + L +      AL+  G A      EL  A+    EA++  P++  A 
Sbjct: 1   LKDLLLALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAG 60

Query: 452 -WKRRGQARAALGESVEAIQDLSKALEFE--PNSADILHERGIVNFKFKDFNAAVEDLSA 508
                  A   LG   EA++ L KALE E  PN A+ L   G++      +  A+E L  
Sbjct: 61  LLLLLALALLKLGRLEEALELLEKALELELLPNLAEALLNLGLLLEALGKYEEALELLEK 120

Query: 509 CVKLDKENKSAYTYLGL-ALSSIGEYKKAEEAHLKAIQLD---RNFLEAWGHLTQFYQDL 564
            + LD +   A   L L AL  +G+Y++A E + KA++LD       EA   L    + L
Sbjct: 121 ALALDPDPDLAEALLALGALYELGDYEEALELYEKALELDPELNELAEALLALGALLEAL 180

Query: 565 ANSEKALECLQQVLYID-KRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLY 623
              E+ALE L++ L ++    ++A    GLL   LG++++A++     L +DP N E LY
Sbjct: 181 GRYEEALELLEKALKLNPDDDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNAEALY 240

Query: 624 LRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTA 673
             A     +G Y EA++  + AL+L+ D     +   L   +    L  A
Sbjct: 241 NLALLLLELGRYEEALEALEKALELDPDLYNLGLALLLLLAEALELLEKA 290


Length = 291

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 903
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.98
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.97
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.96
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.94
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG2003840 consensus TPR repeat-containing protein [General f 99.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.91
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
PRK14574822 hmsH outer membrane protein; Provisional 99.9
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG2003840 consensus TPR repeat-containing protein [General f 99.89
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.88
KOG2076 895 consensus RNA polymerase III transcription factor 99.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
PRK12370553 invasion protein regulator; Provisional 99.86
KOG2076 895 consensus RNA polymerase III transcription factor 99.86
PRK14574822 hmsH outer membrane protein; Provisional 99.85
KOG1129478 consensus TPR repeat-containing protein [General f 99.85
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.83
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.83
KOG1125579 consensus TPR repeat-containing protein [General f 99.82
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.81
PRK11189296 lipoprotein NlpI; Provisional 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
PRK11189296 lipoprotein NlpI; Provisional 99.8
PLN032181060 maturation of RBCL 1; Provisional 99.8
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.8
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
PLN032181060 maturation of RBCL 1; Provisional 99.77
PLN02789320 farnesyltranstransferase 99.77
PLN03077857 Protein ECB2; Provisional 99.76
PLN02789320 farnesyltranstransferase 99.76
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.75
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
PLN03077857 Protein ECB2; Provisional 99.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.73
KOG0553304 consensus TPR repeat-containing protein [General f 99.72
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.71
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.71
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.71
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.67
KOG1915677 consensus Cell cycle control protein (crooked neck 99.64
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.64
KOG2376652 consensus Signal recognition particle, subunit Srp 99.61
KOG2376652 consensus Signal recognition particle, subunit Srp 99.6
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.56
KOG4234271 consensus TPR repeat-containing protein [General f 99.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.55
PRK15359144 type III secretion system chaperone protein SscB; 99.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.52
PRK15359144 type III secretion system chaperone protein SscB; 99.5
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.49
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.49
KOG1915677 consensus Cell cycle control protein (crooked neck 99.47
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.47
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.47
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.46
PRK10370198 formate-dependent nitrite reductase complex subuni 99.45
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.44
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.44
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.42
PRK10370198 formate-dependent nitrite reductase complex subuni 99.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.42
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.4
KOG4648536 consensus Uncharacterized conserved protein, conta 99.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.36
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.35
KOG1128777 consensus Uncharacterized conserved protein, conta 99.35
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.34
KOG1128777 consensus Uncharacterized conserved protein, conta 99.34
PRK04841903 transcriptional regulator MalT; Provisional 99.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.31
PRK04841903 transcriptional regulator MalT; Provisional 99.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.29
KOG0553304 consensus TPR repeat-containing protein [General f 99.28
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.23
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.22
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.22
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.2
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.2
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.19
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.16
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.14
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.13
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.1
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.09
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.02
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.01
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.98
KOG4648536 consensus Uncharacterized conserved protein, conta 98.95
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.94
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.94
KOG1941518 consensus Acetylcholine receptor-associated protei 98.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.94
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.91
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 98.89
PRK11906458 transcriptional regulator; Provisional 98.88
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.88
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.86
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.86
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.85
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.84
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.83
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.83
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.82
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.81
PRK11906458 transcriptional regulator; Provisional 98.81
KOG1941518 consensus Acetylcholine receptor-associated protei 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.78
PRK15331165 chaperone protein SicA; Provisional 98.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.76
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.76
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.74
PRK15331165 chaperone protein SicA; Provisional 98.73
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.72
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.71
COG3898531 Uncharacterized membrane-bound protein [Function u 98.69
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
KOG4555175 consensus TPR repeat-containing protein [Function 98.65
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.63
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.61
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.61
COG3898531 Uncharacterized membrane-bound protein [Function u 98.6
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.58
PRK10803263 tol-pal system protein YbgF; Provisional 98.56
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.55
COG4700251 Uncharacterized protein conserved in bacteria cont 98.54
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
PF12688120 TPR_5: Tetratrico peptide repeat 98.49
KOG2471696 consensus TPR repeat-containing protein [General f 98.48
PF12688120 TPR_5: Tetratrico peptide repeat 98.47
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.43
KOG4234271 consensus TPR repeat-containing protein [General f 98.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.41
PF1337173 TPR_9: Tetratricopeptide repeat 98.4
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.39
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.39
PF13512142 TPR_18: Tetratricopeptide repeat 98.38
COG4700251 Uncharacterized protein conserved in bacteria cont 98.38
PF13512142 TPR_18: Tetratricopeptide repeat 98.36
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.34
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.34
KOG2471696 consensus TPR repeat-containing protein [General f 98.32
PF1337173 TPR_9: Tetratricopeptide repeat 98.32
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.29
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.27
KOG1586288 consensus Protein required for fusion of vesicles 98.25
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.23
KOG1586288 consensus Protein required for fusion of vesicles 98.2
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.18
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.18
KOG4555175 consensus TPR repeat-containing protein [Function 98.17
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.08
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.04
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.03
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.02
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.02
KOG1585308 consensus Protein required for fusion of vesicles 97.99
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.95
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.95
KOG1258577 consensus mRNA processing protein [RNA processing 97.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.88
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.88
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.85
KOG1585308 consensus Protein required for fusion of vesicles 97.82
PF1343134 TPR_17: Tetratricopeptide repeat 97.79
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.77
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.77
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.73
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.7
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.66
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.66
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.63
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.62
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.62
PF1342844 TPR_14: Tetratricopeptide repeat 97.62
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.61
KOG1550552 consensus Extracellular protein SEL-1 and related 97.6
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.57
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.55
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.55
KOG1310758 consensus WD40 repeat protein [General function pr 97.55
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.5
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.48
PF1342844 TPR_14: Tetratricopeptide repeat 97.48
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.47
KOG1258577 consensus mRNA processing protein [RNA processing 97.36
PF1343134 TPR_17: Tetratricopeptide repeat 97.36
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.27
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.26
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.25
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.24
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.24
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.19
KOG1550552 consensus Extracellular protein SEL-1 and related 97.17
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.16
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.16
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.16
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.08
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.04
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.02
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.0
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.98
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.97
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 96.91
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.91
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.9
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.85
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.83
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.72
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.58
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.54
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.46
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.42
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.42
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.38
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.37
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.23
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.23
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.21
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.19
KOG20411189 consensus WD40 repeat protein [General function pr 96.15
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.05
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.01
KOG20411189 consensus WD40 repeat protein [General function pr 95.89
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.88
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.86
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.68
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.51
PRK10941269 hypothetical protein; Provisional 95.48
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.34
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.31
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.25
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.22
PRK10941269 hypothetical protein; Provisional 95.13
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.13
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.03
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.02
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.0
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.99
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 94.96
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.82
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.82
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.82
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.75
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.75
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.69
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.57
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.4
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 94.09
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 94.05
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.01
PRK11619644 lytic murein transglycosylase; Provisional 93.96
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.96
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.86
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.71
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.65
KOG15381081 consensus Uncharacterized conserved protein WDR10, 93.58
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.53
KOG1310758 consensus WD40 repeat protein [General function pr 93.45
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.05
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.0
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.92
COG4976287 Predicted methyltransferase (contains TPR repeat) 92.91
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.81
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.73
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 92.7
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.53
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.51
KOG3364149 consensus Membrane protein involved in organellar 92.43
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.33
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.08
KOG1463411 consensus 26S proteasome regulatory complex, subun 91.96
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.96
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.79
KOG15381081 consensus Uncharacterized conserved protein WDR10, 91.77
KOG3364149 consensus Membrane protein involved in organellar 91.69
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.65
KOG0529421 consensus Protein geranylgeranyltransferase type I 90.94
COG5191435 Uncharacterized conserved protein, contains HAT (H 90.88
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.66
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 90.54
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 90.48
KOG4814872 consensus Uncharacterized conserved protein [Funct 90.24
KOG0529421 consensus Protein geranylgeranyltransferase type I 90.2
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.8
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 89.75
COG5191435 Uncharacterized conserved protein, contains HAT (H 89.58
COG5159421 RPN6 26S proteasome regulatory complex component [ 89.37
COG1747711 Uncharacterized N-terminal domain of the transcrip 89.32
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.23
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.92
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.81
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.78
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.61
KOG2581493 consensus 26S proteasome regulatory complex, subun 87.38
KOG2581493 consensus 26S proteasome regulatory complex, subun 87.16
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.93
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 86.7
COG4941415 Predicted RNA polymerase sigma factor containing a 86.02
COG2912269 Uncharacterized conserved protein [Function unknow 85.69
COG2912269 Uncharacterized conserved protein [Function unknow 85.59
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 85.17
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.53
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 83.73
COG3629280 DnrI DNA-binding transcriptional activator of the 83.59
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 83.21
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.05
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 82.9
COG4941415 Predicted RNA polymerase sigma factor containing a 82.81
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 82.76
COG3629280 DnrI DNA-binding transcriptional activator of the 82.51
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 82.5
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 82.32
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 81.16
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 81.11
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.4e-44  Score=375.46  Aligned_cols=327  Identities=20%  Similarity=0.232  Sum_probs=211.7

Q ss_pred             HHHhhccCCccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcH
Q 002594          370 VTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAG  449 (903)
Q Consensus       370 ~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~  449 (903)
                      +...+..+|....+...+|..+-..|+..+|..+|.++++..|..+.+|.++|.++...|+...|+..|++|+.++|...
T Consensus       173 ~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~  252 (966)
T KOG4626|consen  173 FFEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFL  252 (966)
T ss_pred             HHHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcch
Confidence            33444455555555556666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Q 002594          450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSS  529 (903)
Q Consensus       450 ~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~  529 (903)
                      ++|+++|.+|...+.+++|+.+|.+++.+.|+++.++-++|.+|+.+|..+-|+..|++++++.|+.++++.++|.++-.
T Consensus       253 dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd  332 (966)
T KOG4626|consen  253 DAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKD  332 (966)
T ss_pred             HHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHh
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             cCCHHHHHHHHHHHHHhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
Q 002594          530 IGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLS  609 (903)
Q Consensus       530 ~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~  609 (903)
                      .|+..+|..+|.+++.+.|+++++.++||.+|.++|.+++|..+|.++++..|..+.++.++|.+|.++|++++|+.+|+
T Consensus       333 ~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~Yk  412 (966)
T KOG4626|consen  333 KGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYK  412 (966)
T ss_pred             ccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHH
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HhHccCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHhhhhcc
Q 002594          610 SGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDI  689 (903)
Q Consensus       610 ~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~l~~a~~~  689 (903)
                      .++.+.|..++++.++|..|..+|+...|+.+|.+|+.++|...+       ++.++|..+-..|+..+|+..|+.++.+
T Consensus       413 ealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~Ae-------AhsNLasi~kDsGni~~AI~sY~~aLkl  485 (966)
T KOG4626|consen  413 EALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAE-------AHSNLASIYKDSGNIPEAIQSYRTALKL  485 (966)
T ss_pred             HHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHH-------HHhhHHHHhhccCCcHHHHHHHHHHHcc
Confidence            666666666666666666666666666666666666666666554       3333444445556666666666666666


Q ss_pred             CCCcHHHHHhhcCC
Q 002594          690 DPLFKEYWCKRLHP  703 (903)
Q Consensus       690 ~p~~~~~w~~r~~~  703 (903)
                      +|+|++.+|++++.
T Consensus       486 kPDfpdA~cNllh~  499 (966)
T KOG4626|consen  486 KPDFPDAYCNLLHC  499 (966)
T ss_pred             CCCCchhhhHHHHH
Confidence            66666666665543



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-13
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 1e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-10
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 8e-06
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 3e-07
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-04
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 8e-09
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 9e-08
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 6e-06
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 8e-06
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 1e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 2e-05
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 3e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 7e-05
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 4e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 4e-04
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 5e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 74.7 bits (182), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 46/134 (34%), Positives = 71/134 (52%) Query: 450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSAC 509 EAW G A G+ EAI+ KALE +P SA+ + G +K D++ A+E Sbjct: 2 EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61 Query: 510 VKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEK 569 ++LD + A+ LG A G+Y +A E + KA++LD EAW +L Y + ++ Sbjct: 62 LELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDE 121 Query: 570 ALECLQQVLYIDKR 583 A+E Q+ L +D R Sbjct: 122 AIEYYQKALELDPR 135
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-59
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-57
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-57
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-52
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-59
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-59
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-59
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-58
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-55
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-50
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-47
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-32
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-16
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-55
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-52
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-44
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-39
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-48
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-42
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-42
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-41
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-37
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-36
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-35
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-55
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-53
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-43
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-39
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-32
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-25
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-54
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-48
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-40
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-39
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-48
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-44
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-41
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-27
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-48
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-44
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-44
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-41
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-30
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-45
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-45
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-44
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-44
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-43
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-43
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-40
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-38
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-38
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-36
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-32
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-32
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-44
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-26
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-41
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-30
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-28
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-23
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-20
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-30
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-23
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-32
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-32
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-23
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-25
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-21
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-17
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-32
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-32
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-25
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-29
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-26
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-24
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-25
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-24
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-24
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-25
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-23
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-10
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 9e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-12
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 9e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-21
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-21
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-20
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-19
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-18
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-13
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-19
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-19
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-14
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-10
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-17
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-17
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-10
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-15
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-11
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 7e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-15
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-12
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-13
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-07
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-12
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 6e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 9e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 7e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 5e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-12
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 7e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 9e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 8e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 6e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-07
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-10
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-07
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-10
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 8e-10
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 6e-08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 7e-08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-06
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 5e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-10
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-10
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-10
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 3e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-08
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 7e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 9e-06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 5e-08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 7e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 5e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-05
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 2e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 9e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-04
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 3e-04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 3e-04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 6e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  207 bits (528), Expect = 2e-59
 Identities = 62/302 (20%), Positives = 117/302 (38%), Gaps = 6/302 (1%)

Query: 385 LSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS 444
           +     +   G + +A     Q+ +++P     L+   +     R L+ +    T AI+ 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 445 NPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVE 504
           NP   EA+   G      G+  EAI+    AL  +P+  D             D   AV+
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 505 DLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDL 564
              + ++ + +     + LG  L ++G  ++A+  +LKAI+   NF  AW +L   +   
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 565 ANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYL 624
                A+   ++ + +D  F  AY   G +L       +A+      L + P++      
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN 242

Query: 625 RASCYHAIGEYREAIKDYDAALDLELDSMEKF-----VLQCLAFYQKEIALY-TASKINS 678
            A  Y+  G    AI  Y  A++L+    + +      L+      +    Y TA ++  
Sbjct: 243 LACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCP 302

Query: 679 EF 680
             
Sbjct: 303 TH 304


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 903
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-32
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-32
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-30
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-27
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-26
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-26
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-20
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-19
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-15
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-08
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-05
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.004
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-19
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-10
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-19
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-15
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-11
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-18
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-12
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.003
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-17
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-15
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-13
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-13
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-11
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 8e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-14
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 9e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-12
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-07
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 7e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 5e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 4e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-08
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.001
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 8e-05
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.004
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 2e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.004
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 9e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.004
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-05
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 1e-05
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  128 bits (322), Expect = 1e-32
 Identities = 43/233 (18%), Positives = 93/233 (39%)

Query: 401 ISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARA 460
            + + + ++  P +  A    G     Q E+  AI  F +A+  +P+  +A+   G    
Sbjct: 155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK 214

Query: 461 ALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAY 520
                  A+    +AL   PN A +      V ++    + A++     ++L      AY
Sbjct: 215 EARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY 274

Query: 521 TYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYI 580
             L  AL   G   +AE+ +  A++L     ++  +L    ++  N E+A+   ++ L +
Sbjct: 275 CNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV 334

Query: 581 DKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIG 633
              F+ A+     +L   G+ ++A+      + I P+  +      +    + 
Sbjct: 335 FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query903
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.91
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.84
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.69
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.53
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.52
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.52
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.5
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.47
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.44
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.43
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.26
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.1
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.09
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.05
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.02
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.77
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.53
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.46
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.58
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.5
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.35
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.3
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.83
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.4e-38  Score=283.87  Aligned_cols=382  Identities=16%  Similarity=0.146  Sum_probs=318.5

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHH
Q ss_conf             9999951899999999999983237-915785699999971268999999999998099974599999999998699999
Q 002594           43 LAKLCSLRNWSKAIRILDSLLAQSY-EIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEE  121 (903)
Q Consensus        43 ~~~~~~~~~y~~Ai~~y~~ai~~~~-~~~~~~~ra~~~~~lg~~~~Ai~~~~~Al~l~P~~~~a~~~lG~~~~~lg~~~e  121 (903)
                      +..+|+.|+|++|+..|++++..+| ++..+..+|.+|.++|++++|+..++++++++|++..+++.+|.++..+|++++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99999869999999999999986899899999999999986999999999999998599989999999999642000222


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCC
Q ss_conf             99999999952158948689999799999999820001000000146876554567878898530321037987522334
Q 002594          122 ALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSS  201 (903)
Q Consensus       122 A~~~~~~al~~~~~~~~~~~~~l~l~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  201 (903)
                      |+..+..+.+..+...............       .     ..                                     
T Consensus        86 A~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~-----~~-------------------------------------  116 (388)
T d1w3ba_          86 AIEHYRHALRLKPDFIDGYINLAAALVA-------A-----GD-------------------------------------  116 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHH-------H-----SC-------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-------C-----CC-------------------------------------
T ss_conf             2222221211222222222222222222-------2-----22-------------------------------------


Q ss_pred             CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43501243410589998887787755679986765566644588641111258899999886544477421123688865
Q 002594          202 SQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDF  281 (903)
Q Consensus       202 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  281 (903)
                                                                                                      
T Consensus       117 --------------------------------------------------------------------------------  116 (388)
T d1w3ba_         117 --------------------------------------------------------------------------------  116 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57899887667544456667885556778887845458888740000134457899988043323223214664785479
Q 002594          282 DICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNE  361 (903)
Q Consensus       282 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  361 (903)
                                                                                                      
T Consensus       117 --------------------------------------------------------------------------------  116 (388)
T d1w3ba_         117 --------------------------------------------------------------------------------  116 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             88629999998311488669999999999998399899999999999969999999999999999838999999999999
Q 002594          362 AKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEA  441 (903)
Q Consensus       362 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a  441 (903)
                       ...............+.........+......+....+...+.+.+...|..+.++..+|..+...+++++|...+.++
T Consensus       117 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a  195 (388)
T d1w3ba_         117 -MEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKA  195 (388)
T ss_dssp             -SSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             -2222222111222222222222222222211000135678888740258610689986363010247199999999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             98299949999999999999199899999999999819998999999999999828999999999999971899999999
Q 002594          442 IQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYT  521 (903)
Q Consensus       442 l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~  521 (903)
                      +..+|++..++..+|.++...|++++|+..++++....|.....+..+|.++...|++++|+..++++++.+|+++.++.
T Consensus       196 l~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~  275 (388)
T d1w3ba_         196 VTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYC  275 (388)
T ss_dssp             HHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHH
T ss_pred             HHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             98494649999997155220052999999999857775547999999999999878999999999999984999899999


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCH
Q ss_conf             99999998299999999999999718040999999999999929989999999999930889799999999999988999
Q 002594          522 YLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQH  601 (903)
Q Consensus       522 ~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  601 (903)
                      .+|.++...|++++|+..++.++...|.....+..++.++...|++++|+..++++++..|+++.++..+|.++...|++
T Consensus       276 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  355 (388)
T d1w3ba_         276 NLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL  355 (388)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCH
T ss_conf             99999997487999999998654048730010157999999878999999999999986889899999999999985999


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             999999998671399999999999999999199
Q 002594          602 KKAIKDLSSGLGIDPSNIECLYLRASCYHAIGE  634 (903)
Q Consensus       602 ~eA~~~~~~al~~~p~~~~~~~~la~~~~~~g~  634 (903)
                      ++|+..|+++++++|+++.++.++|.+|..+|+
T Consensus       356 ~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         356 QEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             999999999997099989999999999998589



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure