Citrus Sinensis ID: 002600

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900--
MKSTMVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPEDRNENGNEDEDEVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccEEEcccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHcccccccEEEccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEEcHHHHcccccccEEEccccEEEEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHcccccEEEccccccEEEcccccccccccccccEEEcccccccEEcccHHHHccccccccccEEEccccEEEEcccHHHHHccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHHHHcccccccccccccEEccccccEEEEEEEEEEccccccHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcEEEEEEEEEEc
cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccHHHHHccccccEEEcccccccccccccccHccccccEEEEcccccccccccccHccccccEEEEccccccccccccccHHHHcccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccHHHcccccccEEEEccccccccccHHHcccccccccccEEEEEccccccccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHcccccccEEEccccccccccccccccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccccHccccccccEEEEEcccccccccccHHHccccccccccEEEEEcccccccccccHHHccHHHHHHHcccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccHHccEEEccccccccccccccccHHHHHHHccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccHHHccHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MKSTMVVFVALLFLELFTLVTMINISfcignpnvgcvdSERQALLKLKQdlsdpsnrlaswnigdgdccawdgvvcnnfTGHVLQlnlgnpnpnygtgsklvgkinpslfdlkhlihldlsdndfqgiqtpsylgslkNLRYLnlsgaefagviphqlgnisnlqylDLSKSYYELQVESISWLSGLSFLEHLDLSLVdltkssdglvtinslpslkVLKLSycelhhfpslpstnfsslkaldlsgnhfnnslfQYSSWVFglrnlvffdlsdnefhgkipsglgnltflrhldlssnefnsaipgwlsklndleflslrelggqiptSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLsgchicghltnqlgqfkslhtlelrdnslsgplppalgelssmknldlfnntldgaipmslgqlshlelldlsnnrlngtlseihfvnltkltsfsafgNSLIFkvnqswvppfqleklrlrschlgpqfpswlrSQKHLFIldisntrisdtiprwFWNSISQYVYLNLStnqiygeipncdrplplvpspglldlsnnalsgSIFHLICKRENEADNIYVYLKLSknyfsgdipdcwmnwpnLLVLNLGLSILnlrsnklhgslpiqlcrlnsLQILDVAHNslsgiiprCINNFTAmaaanssdqdnaisyirggvsdvfedasVVTKGFMVEYNTILNLVRIMDisnnnfsgevpKELTNLmglqslnfshnlftgkipenignmrsiesldfsmnqlsgkvpqsmsslSFLNHLNLSYnnltgkipsstqlqsmdassfagnnlcgaplpncpeknalvpedrnengnededeVDWLLYVSMALGFVLGFWCfmgpllinrrwRYKYCYFLdgcvdrfgcpvrkcy
MKSTMVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQdlsdpsnrlASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPEDRNENGNEDEDEVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
MKSTMvvfvallflelftlvTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMnwpnllvlnlglsilnlRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQsmsslsflnhlnlsynnlTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPedrnengnededeVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
****MVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQ******NRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLEL*******************KNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNM*************************FLNHLNLSYNNL****************************************************VDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVR***
*****VV*VALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAA***********YIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGA****************************WLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
MKSTMVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPE*********EDEVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
***TMVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPEDRNENGNEDEDEVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSTMVVFVALLFLELFTLVTMINISFCIGNPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNNLCGAPLPNCPEKNALVPEDRNENGNEDEDEVDWLLYVSMALGFVLGFWCFMGPLLINRRWRYKYCYFLDGCVDRFGCPVRKCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query902 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.840 0.606 0.311 8e-69
Q9C9H7847 Receptor-like protein 12 no no 0.837 0.891 0.302 1e-68
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.779 0.561 0.290 2e-65
Q9FL28 1173 LRR receptor-like serine/ no no 0.800 0.615 0.299 1e-62
O49318 1124 Probable leucine-rich rep no no 0.783 0.629 0.278 3e-55
Q9SHI2 1101 Leucine-rich repeat recep no no 0.782 0.641 0.268 4e-55
Q9LP24 1120 Probable leucine-rich rep no no 0.764 0.616 0.282 2e-53
Q9LVP0 1102 Probable leucine-rich rep no no 0.754 0.617 0.287 1e-52
Q9LYN8 1192 Leucine-rich repeat recep no no 0.800 0.605 0.288 8e-52
C0LGS2 1136 Probable LRR receptor-lik no no 0.841 0.668 0.269 6e-51
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  262 bits (670), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 275/884 (31%), Positives = 426/884 (48%), Gaps = 126/884 (14%)

Query: 29  IGNPNVGCVDSERQALLKLKQDL-SDPS--NRLASWNIGDGDCCAWDGVVCNNFTG--HV 83
           +G P  G ++++ Q LL++K+ L ++P   + L  WN  + + C+W GV C+N TG   V
Sbjct: 17  LGQP--GIINNDLQTLLEVKKSLVTNPQEDDPLRQWNSDNINYCSWTGVTCDN-TGLFRV 73

Query: 84  LQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYL 143
           + LNL        TG  L G I+P      +LIHLDLS N+  G   P+ L +L +L  L
Sbjct: 74  IALNL--------TGLGLTGSISPWFGRFDNLIHLDLSSNNLVG-PIPTALSNLTSLESL 124

Query: 144 NLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLT-- 201
            L   +  G IP QLG++ N++ L +  +  EL  +    L  L  L+ L L+   LT  
Sbjct: 125 FLFSNQLTGEIPSQLGSLVNIRSLRIGDN--ELVGDIPETLGNLVNLQMLALASCRLTGP 182

Query: 202 -KSSDG-LVTINSLPSLKVLKLSYCELHHFPSLPST--NFSSLKALDLSGNHFNNSLFQY 257
             S  G LV + SL    +L+ +Y E      +P+   N S L     + N  N ++   
Sbjct: 183 IPSQLGRLVRVQSL----ILQDNYLE----GPIPAELGNCSDLTVFTAAENMLNGTI--- 231

Query: 258 SSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEF 317
            + +  L NL   +L++N   G+IPS LG ++ L++L L +N+    IP  L+ L +L+ 
Sbjct: 232 PAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQT 291

Query: 318 LSLRE--LGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYA-LESLVLSGC 374
           L L    L G+IP  F  + +L  + ++   L   L +     S C     LE LVLSG 
Sbjct: 292 LDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPK-----SICSNNTNLEQLVLSGT 346

Query: 375 HICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQ 434
            + G +  +L + +SL  L+L +NSL+G +P AL EL  + +L L NNTL+G +  S+  
Sbjct: 347 QLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISN 406

Query: 435 LSHLELLDLSNNRLNGTLS---------EIHFV--------------NLTKLTSFSAFGN 471
           L++L+ L L +N L G L          E+ F+              N T L     FGN
Sbjct: 407 LTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGN 466

Query: 472 SLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWN 531
               ++  S     +L  L LR   L    P+ L +   L ILD+++ ++S +IP  F  
Sbjct: 467 HFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSF-G 525

Query: 532 SISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNI 591
            +     L L  N + G +P+    L  + +   ++LS+N L+G+I H +C       + 
Sbjct: 526 FLKGLEQLMLYNNSLQGNLPDS---LISLRNLTRINLSHNRLNGTI-HPLC-----GSSS 576

Query: 592 YVYLKLSKNYFSGDIPDCWMNWPNLLVLNLG-----------------LSILNLRSNKLH 634
           Y+   ++ N F  +IP    N  NL  L LG                 LS+L++ SN L 
Sbjct: 577 YLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALT 636

Query: 635 GSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAAN-SSDQ-------------- 679
           G++P+QL     L  +D+ +N LSG IP  +   + +     SS+Q              
Sbjct: 637 GTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTK 696

Query: 680 -----------DNAISYIRG--GVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFS 726
                      + +I    G  G  +V         G + +    L+ +  + +S N+ +
Sbjct: 697 LLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLT 756

Query: 727 GEVPKELTNLMGLQS-LNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLS 785
           GE+P E+  L  LQS L+ S+N FTG IP  IG +  +E+LD S NQL+G+VP S+  + 
Sbjct: 757 GEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMK 816

Query: 786 FLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGNN-LCGAPLPNC 828
            L +LN+S+NNL GK+    Q     A SF GN  LCG+PL  C
Sbjct: 817 SLGYLNVSFNNLGGKL--KKQFSRWPADSFLGNTGLCGSPLSRC 858
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query902
350284745976 receptor-like protein [Malus x domestica 0.963 0.890 0.455 0.0
315436720 1020 verticillium wilt resistance-like protei 0.976 0.863 0.453 0.0
350284747978 receptor-like protein [Malus x domestica 0.965 0.890 0.452 0.0
350284771978 receptor-like protein [Malus x domestica 0.965 0.890 0.450 0.0
350284759980 receptor-like protein [Malus micromalus] 0.970 0.892 0.445 0.0
350284743978 receptor-like protein [Malus x domestica 0.967 0.892 0.448 0.0
350284739978 receptor-like protein [Malus x domestica 0.972 0.896 0.440 0.0
350284741982 receptor-like protein [Malus x domestica 0.964 0.885 0.441 0.0
14330714 1015 HcrVf1 protein [Malus floribunda] 0.958 0.852 0.441 0.0
224072885 1024 predicted protein [Populus trichocarpa] 0.952 0.838 0.444 0.0
>gi|350284745|gb|AEQ27744.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/987 (45%), Positives = 588/987 (59%), Gaps = 118/987 (11%)

Query: 1   MKSTM-VVFVALLFLELFTLVTMINISFCIGNPNVG--CVDSERQALLKLKQDLSDPSNR 57
           M+ TM VV + + FL + T+    +I  C GNP+    C +SERQ+LL  KQDL DP+NR
Sbjct: 1   MERTMRVVLLLIRFLAIATIT--FSIGLCNGNPSWPPLCKESERQSLLMFKQDLKDPANR 58

Query: 58  LASWNIG-DGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLI 116
           LASW    D DCC+W GVVC++ TGH+ +L+L N  P     S   GKINPSL  LKHL 
Sbjct: 59  LASWVAEEDSDCCSWTGVVCDHMTGHIRELHLNNSEPYLE--SSFGGKINPSLLGLKHLN 116

Query: 117 HLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYEL 176
           +LDLS+N+FQG Q PS+ GS+ +L +LNL  +EF GVIPH+LGN+++L+YL+LS+  Y+L
Sbjct: 117 YLDLSNNNFQGTQIPSFFGSMTSLTHLNLGHSEFGGVIPHKLGNLTSLRYLNLSR-LYDL 175

Query: 177 QVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTN 236
           +VE++ W+SGLS L+HLDLS V+L+K+SD L   N LPSL  L +SYC+LH    LP+TN
Sbjct: 176 KVENLQWISGLSLLKHLDLSWVNLSKASDWLQVTNMLPSLVELDMSYCQLHQITPLPTTN 235

Query: 237 FSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDL 296
           F+SL  LDLS N FN+ + +   WVF L+NLV   LS   F G IPS   N+T LR +DL
Sbjct: 236 FTSLVVLDLSFNSFNSLMLR---WVFSLKNLVSLHLSFCGFQGLIPSISQNITSLREIDL 292

Query: 297 SSNEFN-SAIPGWLSKLNDLEF-LSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQV 354
           S N  +   IP WL    +LE  L   +L GQ+P+S   +  L  +++        + + 
Sbjct: 293 SHNSMSLDPIPKWLFNQKNLELSLEANQLTGQLPSSIQNMTGLKVLNLEVNNFNSTIPEW 352

Query: 355 LDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSM 414
           L          LESL+LS  + CG +++ +G  KSL   +L  NS+SGP+P +LG LSS+
Sbjct: 353 L-----YSLNNLESLLLSYNYFCGEISSSIGNLKSLRHFDLSSNSISGPIPMSLGNLSSL 407

Query: 415 KNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLI 474
           + LD+  N  +G     +GQL  L  LD+S N L G +SE+ F NLTKL  F A GNS  
Sbjct: 408 EKLDISGNQFNGTFIEVIGQLKMLMDLDISYNSLEGAMSEVSFSNLTKLKHFIANGNSFT 467

Query: 475 FKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILDISNTRISDTIPRWFWNSIS 534
            K ++ WVPPFQLE L+L S HLGP++P WLR+Q  L  L +S T IS TIP WFWN  S
Sbjct: 468 LKTSRDWVPPFQLEILQLDSWHLGPKWPMWLRTQTQLKELSLSGTGISSTIPTWFWNLTS 527

Query: 535 QYVYLNLSTNQIYGEIPNC---------------DRPLPLVPSPGL-LDLSNNALSGSIF 578
           Q  YLNLS NQ+YG+I N                   LP+VP+  + LDLSN++ SGS+F
Sbjct: 528 QVEYLNLSRNQLYGQIQNIVAVPFSTVDLSSNQFTGALPIVPTSLMWLDLSNSSFSGSVF 587

Query: 579 HLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLG---------------- 622
           H  C R +E    YV L L  N+ +G +PDCWM+W +L  LNL                 
Sbjct: 588 HFFCDRPDEPKQHYV-LHLGNNFLTGKVPDCWMSWSSLEFLNLENNNLTGNVPMSMGYLQ 646

Query: 623 -LSILNLRSNKLHGSLPIQL---------------------------------------- 641
            L  L+LR+N L+G LP  L                                        
Sbjct: 647 YLGSLHLRNNHLYGELPHSLQNCTWLSVVDLSENGFSGSIPTWIGNSLLNVLILRSNKFE 706

Query: 642 -------CRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRG-GVS-- 691
                  C L SLQILD+AHN LSG+IPRC ++ +AMA     D   + S  RG G S  
Sbjct: 707 GDIPNEVCYLTSLQILDLAHNKLSGMIPRCFHDLSAMA-----DFSESFSPTRGFGTSAH 761

Query: 692 --DVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLF 749
             ++ ++A +V KG  +EY+ IL  V+ MD+S N   GE+P+ELT L+ LQSLN S+N F
Sbjct: 762 MFELSDNAILVKKGIEMEYSKILGFVKGMDLSCNFMYGEIPEELTGLLALQSLNLSNNRF 821

Query: 750 TGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQS 809
           TG+IP  IGNM  +ESLDFSMNQL G++PQSM++L+FL+HLNLSYNNLTG+IP STQLQ 
Sbjct: 822 TGRIPSKIGNMAWLESLDFSMNQLDGEIPQSMTNLTFLSHLNLSYNNLTGRIPESTQLQL 881

Query: 810 MDASSFAGNNLCGAPLPNCPEKNALVPEDRNENGNED-----EDEVDWLLYVSMALGFVL 864
           +D SSF GN LCGAPL      N ++P    E    D     EDE  W  YVS+ +GF  
Sbjct: 882 LDQSSFVGNELCGAPLHKHCSANGVIPPATVEQDGGDGYRLLEDE--W-FYVSLGVGFFT 938

Query: 865 GFWCFMGPLLINRRWRYKYCYFLDGCV 891
           GFW  +G LLIN  W       L+  V
Sbjct: 939 GFWIVLGSLLINMPWSILLSQLLNRIV 965

Source: Malus x domestica

Species: Malus x domestica

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|350284747|gb|AEQ27745.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284771|gb|AEQ27757.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284759|gb|AEQ27751.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284743|gb|AEQ27743.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284739|gb|AEQ27741.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284741|gb|AEQ27742.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|14330714|emb|CAC40825.1| HcrVf1 protein [Malus floribunda] Back     alignment and taxonomy information
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query902
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.776 0.773 0.350 6.3e-92
TAIR|locus:2094613784 RLP38 "receptor like protein 3 0.546 0.628 0.312 1.7e-66
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.828 0.598 0.289 2.9e-62
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.829 0.597 0.275 3.1e-58
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.723 0.664 0.309 2.7e-57
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.898 0.909 0.280 4.3e-57
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.789 0.743 0.290 7.1e-55
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.774 0.595 0.288 9.7e-55
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.808 0.847 0.276 3.7e-53
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.830 0.794 0.286 8.6e-52
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 916 (327.5 bits), Expect = 6.3e-92, P = 6.3e-92
 Identities = 268/765 (35%), Positives = 390/765 (50%)

Query:    36 CVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPN- 94
             C+ +ERQALL  +  L+D S+RL SW+ G  DCC W GV+C+  T HV++++L NP+ + 
Sbjct:    33 CISTERQALLTFRAALTDLSSRLFSWS-GP-DCCNWPGVLCDARTSHVVKIDLRNPSQDV 90

Query:    95 ----YGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEF 150
                 Y  GS L GKI+PSL  LK L +LDLS NDF  ++ P ++G + +LRYLNLS + F
Sbjct:    91 RSDEYKRGS-LRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSF 149

Query:   151 AGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTI 210
             +G IP  LGN+S L+ LDL   Y E            SF +   LSL    ++S+ L  +
Sbjct:   150 SGEIPTSLGNLSKLESLDL---YAE------------SFGDSGTLSL----RASN-LRWL 189

Query:   211 NSLPS-LKVLKLSYCELHHFPSLPSTNFS---SLKALDLSGNHFNNSLFQYSSWVFGLRN 266
             +SL S LK L + Y  L         +FS   +LK L L  +   N     SS    L+ 
Sbjct:   190 SSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSA-DLKL 248

Query:   267 LVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRE---L 323
             L   DLS+N  +  IP+ L  LT LR L L  +    +IP     L  LE L L     L
Sbjct:   249 LEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLAL 308

Query:   324 GGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQ 383
              G+IP+    L +L  +D+S  +L   +   LD FS     +L  L LS   + G L   
Sbjct:   309 QGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPES 368

Query:   384 LGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDL 443
             LG  ++L TL+L  NS +G +P ++G ++S+K LDL NN ++G I  SLGQL+ L  L+L
Sbjct:   369 LGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNL 428

Query:   444 SNNRLNGTLSEIHFVNLTKLTSFSAFGN---SLIFKVNQSWVPPFQLEKLRLRSCHLGPQ 500
               N   G L + HFVNL  L S         SL+FK+  +W+PPF+LE +++ +C +G  
Sbjct:   429 MANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIG-L 487

Query:   501 FPSWLRSQKHLFILDISNTRISDTIP-RWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPL 559
             FP WL+ Q  L  + + NT I DTIP  WF    S+  YL L+ N+I G +P   + L  
Sbjct:   488 FPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLP---QKLAF 544

Query:   560 VPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMXXXXXXXX 619
              P    +DLS+N   G+ F L      E       L+L +N FSG +P            
Sbjct:   545 -PKLNTIDLSSNNFEGT-FPLWSTNATE-------LRLYENNFSGSLPQ------NIDVL 589

Query:   620 XXXXXXXXXRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQ 679
                       SN   G++P  LC ++ LQIL +  N  SG  P+C +    +   + S+ 
Sbjct:   590 MPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSEN 649

Query:   680 D--NAISYIRG---GVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELT 734
             +    I    G    +S +  + + +             L  I D+  N  +G++P  + 
Sbjct:   650 NLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNI-DLGGNKLTGKLPSWVG 708

Query:   735 NLMGLQSLNFSHNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQ 779
              L  L  L    N FTG+IP+++ N+ ++  LD S N++SG +P+
Sbjct:   709 KLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPK 753
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00031679
hypothetical protein (1024 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query902
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-59
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  224 bits (573), Expect = 3e-61
 Identities = 207/719 (28%), Positives = 302/719 (42%), Gaps = 164/719 (22%)

Query: 40  ERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGS 99
           E + LL  K  ++DP   L++WN    D C W G+ CNN +  V+ ++L        +G 
Sbjct: 30  ELELLLSFKSSINDPLKYLSNWN-SSADVCLWQGITCNNSS-RVVSIDL--------SGK 79

Query: 100 KLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLG 159
            + GKI+ ++F L ++  ++LS+N   G        +  +LRYLNLS   F G IP   G
Sbjct: 80  NISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--G 137

Query: 160 NISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKSSDGLVTINSLPSLKVL 219
           +I NL+ LDLS +           LSG    +                  I S  SLKVL
Sbjct: 138 SIPNLETLDLSNNM----------LSGEIPND------------------IGSFSSLKVL 169

Query: 220 KLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHG 279
            L    L        TN +SL+ L L+ N       Q    +  +++L +  L  N   G
Sbjct: 170 DLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVG---QIPRELGQMKSLKWIYLGYNNLSG 226

Query: 280 KIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRE--LGGQIPTSFVRLCKL 337
           +IP  +G LT L HLDL  N     IP  L  L +L++L L +  L G IP S   L KL
Sbjct: 227 EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKL 286

Query: 338 TSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRD 397
            S+D+S            D   S                 G +   + Q ++L  L L  
Sbjct: 287 ISLDLS------------DNSLS-----------------GEIPELVIQLQNLEILHLFS 317

Query: 398 NSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQLSHLELLDLSNNRLNGTLSE--I 455
           N+ +G +P AL  L  ++ L L++N   G IP +LG+ ++L +LDLS N L G + E   
Sbjct: 318 NNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC 377

Query: 456 HFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILD 515
              NL KL  FS   NSL  ++ +S      L ++RL+      + PS       ++ LD
Sbjct: 378 SSGNLFKLILFS---NSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD 434

Query: 516 ISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSG 575
           ISN  +   I    W+ +     L+L+ N+ +G +P+         S G   L N     
Sbjct: 435 ISNNNLQGRINSRKWD-MPSLQMLSLARNKFFGGLPD---------SFGSKRLEN----- 479

Query: 576 SIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHG 635
                              L LS+N FSG +P    +   L+ L L         NKL G
Sbjct: 480 -------------------LDLSRNQFSGAVPRKLGSLSELMQLKLS-------ENKLSG 513

Query: 636 SLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVFE 695
            +P +L     L  LD++HN LSG IP                               F 
Sbjct: 514 EIPDELSSCKKLVSLDLSHNQLSGQIP-----------------------------ASFS 544

Query: 696 DASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIP 754
           +  V+++               +D+S N  SGE+PK L N+  L  +N SHN   G +P
Sbjct: 545 EMPVLSQ---------------LDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP 588

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 902
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PLN03150623 hypothetical protein; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
PLN03150623 hypothetical protein; Provisional 99.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
PRK15386 426 type III secretion protein GogB; Provisional 97.51
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.41
PRK15386426 type III secretion protein GogB; Provisional 97.37
KOG4341483 consensus F-box protein containing LRR [General fu 97.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.26
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
KOG4341483 consensus F-box protein containing LRR [General fu 97.23
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.1
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.74
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.85
KOG4308478 consensus LRR-containing protein [Function unknown 94.84
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.56
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.55
KOG4308478 consensus LRR-containing protein [Function unknown 93.14
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.38
smart0037026 LRR Leucine-rich repeats, outliers. 86.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.51
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.08
smart0037026 LRR Leucine-rich repeats, outliers. 81.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.71
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.2e-71  Score=691.09  Aligned_cols=583  Identities=33%  Similarity=0.558  Sum_probs=389.2

Q ss_pred             CHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCccccceeecCCCCcEEEEEcCCCCCCCCCCccccccccccccCCCCCC
Q 002600           37 VDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPNYGTGSKLVGKINPSLFDLKHLI  116 (902)
Q Consensus        37 ~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~~c~w~gv~c~~~~g~v~~L~L~~~~~~~~~~~~l~g~~~~~l~~l~~L~  116 (902)
                      .++|++||++||+++.+|.+.+.+|+. +.+||.|.||+|++ .++|+.|+|+++        .+.|.+++.+..+++|+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~-~~~~c~w~gv~c~~-~~~v~~L~L~~~--------~i~~~~~~~~~~l~~L~   96 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNS-SADVCLWQGITCNN-SSRVVSIDLSGK--------NISGKISSAIFRLPYIQ   96 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCC-CCCCCcCcceecCC-CCcEEEEEecCC--------CccccCChHHhCCCCCC
Confidence            458999999999999888888899974 67999999999985 679999999985        67888888999999999


Q ss_pred             eEeCCCCCCCCCCCCcccc-CCCCCCEEeccCCcCCCCCCCCCCCCCCCcEEeccCCccccccccccccCCCCCCCEEeC
Q 002600          117 HLDLSDNDFQGIQTPSYLG-SLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDL  195 (902)
Q Consensus       117 ~L~Ls~n~l~~~~~~~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L~~L~L  195 (902)
                      +|+|++|.+++. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++|.                      
T Consensus        97 ~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~----------------------  151 (968)
T PLN00113         97 TINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNM----------------------  151 (968)
T ss_pred             EEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCc----------------------
Confidence            999999999873 676544 889999999999998887774  345556666655553                      


Q ss_pred             CCCcCCCCCCcccccCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCeEecCCCcCCCccccccccccCCCCccEEEccCC
Q 002600          196 SLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDN  275 (902)
Q Consensus       196 s~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~L~~n  275 (902)
                          +++  ..+..++.+++|++|++++|.+.+..+..+.++++|++|++++|.+.+.+|.   .++++++|++|++++|
T Consensus       152 ----~~~--~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~---~l~~l~~L~~L~L~~n  222 (968)
T PLN00113        152 ----LSG--EIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR---ELGQMKSLKWIYLGYN  222 (968)
T ss_pred             ----ccc--cCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCCh---HHcCcCCccEEECcCC
Confidence                221  1122344555555555555555554444455555555555555555544444   4444555555555555


Q ss_pred             cCCCCCCcCCCCCCCCCEEEccCCcCCCCCchhccCCCCCCeeeccccCCCCCccccCCCCccEEEccCcccCCcchHHH
Q 002600          276 EFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVKLGQDLSQVL  355 (902)
Q Consensus       276 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~  355 (902)
                      .+++.+|..++++++|++|++++|.++                      +.+|..++++++|+.|++++           
T Consensus       223 ~l~~~~p~~l~~l~~L~~L~L~~n~l~----------------------~~~p~~l~~l~~L~~L~L~~-----------  269 (968)
T PLN00113        223 NLSGEIPYEIGGLTSLNHLDLVYNNLT----------------------GPIPSSLGNLKNLQYLFLYQ-----------  269 (968)
T ss_pred             ccCCcCChhHhcCCCCCEEECcCceec----------------------cccChhHhCCCCCCEEECcC-----------
Confidence            555445544555555555555554444                      23333444444444444444           


Q ss_pred             HhhcccccccccEEEccCcccCCcccccccCCCCCCEEECCCCcCCCCCcccccCCCCCCEEEccCCcCCCCcchhhcCC
Q 002600          356 DIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDGAIPMSLGQL  435 (902)
Q Consensus       356 ~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l  435 (902)
                                        |.+.+.+|..+..+++|++|++++|.+.+.+|..+.++++|+.|++++|.+++.+|..+..+
T Consensus       270 ------------------n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l  331 (968)
T PLN00113        270 ------------------NKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL  331 (968)
T ss_pred             ------------------CeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcC
Confidence                              44444444444455555555555555555555555555555555555555555555555555


Q ss_pred             CCCCeEEcccccCccccchhhhccCccccEEEccCceeeEEeCCCCCCcccccccccccccCCCCCChhhcCCCCccEEE
Q 002600          436 SHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFILD  515 (902)
Q Consensus       436 ~~L~~L~Ls~N~l~~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~  515 (902)
                      ++|+.|++++|.+++.+|. .+..+++|+.|++++|++.+.                        .|.++..+++|+.|+
T Consensus       332 ~~L~~L~L~~n~l~~~~p~-~l~~~~~L~~L~Ls~n~l~~~------------------------~p~~~~~~~~L~~L~  386 (968)
T PLN00113        332 PRLQVLQLWSNKFSGEIPK-NLGKHNNLTVLDLSTNNLTGE------------------------IPEGLCSSGNLFKLI  386 (968)
T ss_pred             CCCCEEECcCCCCcCcCCh-HHhCCCCCcEEECCCCeeEee------------------------CChhHhCcCCCCEEE
Confidence            5555555555555544444 444444444444444444333                        333344444555555


Q ss_pred             ccCCcCCCcCChhHHhccCCCcEEecccccceeeCCCCCCCCCCCCCCcEEEccCCccccccchhHhhhcccccccceEE
Q 002600          516 ISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALSGSIFHLICKRENEADNIYVYL  595 (902)
Q Consensus       516 Ls~N~l~~~~p~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~~~ll~~L  595 (902)
                      +++|.+.+.+|..+. .+++|+.|++++|++++.+|..+..+   +.|                             +.+
T Consensus       387 l~~n~l~~~~p~~~~-~~~~L~~L~L~~n~l~~~~p~~~~~l---~~L-----------------------------~~L  433 (968)
T PLN00113        387 LFSNSLEGEIPKSLG-ACRSLRRVRLQDNSFSGELPSEFTKL---PLV-----------------------------YFL  433 (968)
T ss_pred             CcCCEecccCCHHHh-CCCCCCEEECcCCEeeeECChhHhcC---CCC-----------------------------CEE
Confidence            555555555554432 24555555555555555554433222   123                             333


Q ss_pred             EccCCcceecCCccccCCCccceecccccEEEeecCccccccCCCcCCCCCCCEEEeecccccccccccccccccccccC
Q 002600          596 KLSKNYFSGDIPDCWMNWPNLLVLNLGLSILNLRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAAN  675 (902)
Q Consensus       596 ~Ls~N~l~g~~p~~~~~l~~L~~l~l~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~~~  675 (902)
                      ++++|.+++.+|..+..+++|       +.|++++|++.+.+|..+ ..++|+.||+++|++++.+|..+.++++|    
T Consensus       434 ~Ls~N~l~~~~~~~~~~l~~L-------~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L----  501 (968)
T PLN00113        434 DISNNNLQGRINSRKWDMPSL-------QMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL----  501 (968)
T ss_pred             ECcCCcccCccChhhccCCCC-------cEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhcc----
Confidence            333333333334333334432       345566666666665544 34789999999999999999888887777    


Q ss_pred             CCCCccccccccCCccccceeeEEEeccceeehhhhccceEEEECCCCcccccCCccccccCCCCeEeccCCccccccCC
Q 002600          676 SSDQDNAISYIRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGKIPE  755 (902)
Q Consensus       676 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~ip~  755 (902)
                                                              +.|+|++|++++.+|+.++++++|++|+|++|+++|.+|.
T Consensus       502 ----------------------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  541 (968)
T PLN00113        502 ----------------------------------------MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPA  541 (968)
T ss_pred             ----------------------------------------CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCCh
Confidence                                                    8899999999999999999999999999999999999999


Q ss_pred             CCcccCCCceEeCCCCcccccCCccccCCCCCCeEECcCCcccccCCCCCcCCCCCccccCCC-CCCCCC
Q 002600          756 NIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSSTQLQSMDASSFAGN-NLCGAP  824 (902)
Q Consensus       756 ~l~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~N-~lcg~~  824 (902)
                      .++++++|+.|||++|+++|.+|..+..+++|++|++++|+++|.+|..+++.++...+|.|| .+||.+
T Consensus       542 ~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        542 SFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999 899865

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query902
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-28
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-28
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-10
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-07
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 3e-07
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 4e-06
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 9e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 186/706 (26%), Positives = 287/706 (40%), Gaps = 86/706 (12%)
Query: 162 SNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLS--LVDLTKSSDGLVTINSLPSLKVL 219
           ++L  LDLS++     V +++ L   S L+ L++S   +D      G + +NSL  L + 
Sbjct: 97  ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLS 156
Query: 220 KLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFDLSDNEFHG 279
             S    +    + S     LK L +SGN  +  +   S  V    NL F D+S N F  
Sbjct: 157 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDV-DVSRCV----NLEFLDVSSNNFST 211
Query: 280 KIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSL--RELGGQIPTSFVRLCKL 337
            IP  LG+ + L+HLD+S N+ +      +S   +L+ L++   +  G IP        L
Sbjct: 212 GIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIP-------PL 263
Query: 338 TSIDVSYVKLGQD-LSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELR 396
               + Y+ L ++  +  +  F S     L  L LSG H  G +    G    L +L L 
Sbjct: 264 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS 323
Query: 397 DNSLSGPLP-PALGELSSMKNLDLFNNTLDGAIPMSLGQLS-HLELLDLSNNRLNGTLSE 454
            N+ SG LP   L ++  +K LDL  N   G +P SL  LS  L  LDLS+N  +G +  
Sbjct: 324 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI-- 381
Query: 455 IHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRSQKHLFIL 514
               NL +                    P   L++L L++     + P  L +   L  L
Sbjct: 382 --LPNLCQ-------------------NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL 420
Query: 515 DISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLDLSNNALS 574
            +S   +S TIP     S+S+   L L  N + GEIP   + L  V +   L L  N L+
Sbjct: 421 HLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIP---QELMYVKTLETLILDFNDLT 476
Query: 575 GSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMXXXXXXXXXXXXXXXXXRSNKLH 634
           G I   +    N       ++ LS N  +G+IP  W+                  +N   
Sbjct: 477 GEIPSGLSNCTN-----LNWISLSNNRLTGEIPK-WIGRLENLAILKL------SNNSFS 524
Query: 635 GSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAANSSDQDNAISYIRGGVSDVF 694
           G++P +L    SL  LD+  N  +G IP  +   +   AAN       +     G+    
Sbjct: 525 GNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC 584
Query: 695 EDAS--VVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFSHNLFTGK 752
             A   +  +G   E    L+     +I++  + G       N   +  L+ S+N+ +G 
Sbjct: 585 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 644
Query: 753 IPENIGNM------------------------RSIESLDFSMNQLSGKVPQXXXXXXXXX 788
           IP+ IG+M                        R +  LD S N+L G++PQ         
Sbjct: 645 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 704
Query: 789 XXXXXXXXXTGKIPSSTQLQSMDASSFAGN-NLCGAPLPNCPEKNA 833
                    +G IP   Q ++   + F  N  LCG PLP C   NA
Sbjct: 705 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNA 750
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query902
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-168
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-101
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-51
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-17
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-38
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  508 bits (1310), Expect = e-168
 Identities = 216/833 (25%), Positives = 338/833 (40%), Gaps = 121/833 (14%)

Query: 35  GCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFTGHVLQLNLGNPNPN 94
             +  E   L+  K  L D  N L  W+  + + C +DGV C +    V  ++L +   N
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWS-SNKNPCTFDGVTCRD--DKVTSIDLSSKPLN 63

Query: 95  YGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVI 154
            G  +     ++ SL  L  L  L LS++   G  + S      +L  L+LS    +G +
Sbjct: 64  VGFSA-----VSSSLLSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPV 116

Query: 155 P--HQLGNISNLQYLDLSKSYYELQVESISWLSGLSFLEHLDLSLVDLTKS-SDGLVTIN 211
                LG+ S L++L++S +  +     +S    L+ LE LDLS   ++ +   G V  +
Sbjct: 117 TTLTSLGSCSGLKFLNVSSNTLDFPG-KVSGGLKLNSLEVLDLSANSISGANVVGWVLSD 175

Query: 212 SLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNLVFFD 271
               LK L +S  ++     +  +   +L+ LD+S N+F+  +     ++     L   D
Sbjct: 176 GCGELKHLAISGNKISG--DVDVSRCVNLEFLDVSSNNFSTGI----PFLGDCSALQHLD 229

Query: 272 LSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDLEFLSLRE--LGGQIPT 329
           +S N+  G     +   T L+ L++SSN+F   IP     L  L++LSL E    G+IP 
Sbjct: 230 ISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIP--PLPLKSLQYLSLAENKFTGEIPD 287

Query: 330 SFVRLCKLTSIDVSYVKLGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKS 389
                C                              L  L LSG H  G +    G    
Sbjct: 288 FLSGACD----------------------------TLTGLDLSGNHFYGAVPPFFGSCSL 319

Query: 390 LHTLELRDNSLSGPLPP-ALGELSSMKNLDLFNNTLDGAIPMSLGQLS-HLELLDLSNNR 447
           L +L L  N+ SG LP   L ++  +K LDL  N   G +P SL  LS  L  LDLS+N 
Sbjct: 320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 379

Query: 448 LNGTLSEIHFVNLTKLTSFSAFGNSLIFKVNQSWVPPFQLEKLRLRSCHLGPQFPSWLRS 507
            +G +                   +          P   L++L L++     + P  L +
Sbjct: 380 FSGPI-------------LPNLCQN----------PKNTLQELYLQNNGFTGKIPPTLSN 416

Query: 508 QKHLFILDISNTRISDTIPRWFWNSISQYVYLNLSTNQIYGEIPNCDRPLPLVPSPGLLD 567
              L  L +S   +S TIP    + +S+   L L  N + GEIP     L  V +   L 
Sbjct: 417 CSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQE---LMYVKTLETLI 472

Query: 568 LSNNALSGSIFHLICKRENEADNIYVYLKLSKNYFSGDIPDCWMNWPNLLVLNLGLSILN 627
           L  N L+G I   +    N       ++ LS N  +G+IP       N       L+IL 
Sbjct: 473 LDFNDLTGEIPSGLSNCTN-----LNWISLSNNRLTGEIPKWIGRLEN-------LAILK 520

Query: 628 LRSNKLHGSLPIQLCRLNSLQILDVAHNSLSGIIPRCINNFTAMAAAN--SSDQDNAISY 685
           L +N   G++P +L    SL  LD+  N  +G IP  +   +   AAN  +  +   I  
Sbjct: 521 LSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKN 580

Query: 686 IRGGVSDVFEDASVVTKGFMVEYNTILNLVRIMDISNNNFSGEVPKELTNLMGLQSLNFS 745
                        +  +G   E    L+     +I++  + G       N   +  L+ S
Sbjct: 581 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS 640

Query: 746 HNLFTGKIPENIGNMRSIESLDFSMNQLSGKVPQSMSSLSFLNHLNLSYNNLTGKIPSS- 804
           +N+ +G IP+ IG+M  +  L+   N +SG +P  +  L  LN L+LS N L G+IP + 
Sbjct: 641 YNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAM 700

Query: 805 -----------------------TQLQSMDASSFAGN-NLCGAPLPNCPEKNA 833
                                   Q ++   + F  N  LCG PLP C   NA
Sbjct: 701 SALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNA 753
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 902
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 6e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 84.8 bits (208), Expect = 2e-18
 Identities = 69/305 (22%), Positives = 106/305 (34%), Gaps = 29/305 (9%)

Query: 36  CVDSERQALLKLKQDLSDPSNRLASWNIGDGDCC--AWDGVVCNN--FTGHVLQLNLGNP 91
           C   ++QALL++K+DL +P+  L+SW     DCC   W GV+C+    T  V  L+L   
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT-LSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSG- 59

Query: 92  NPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYLNLSGAEFA 151
                        I  SL +L +L  L +   +      P  +  L  L YL ++    +
Sbjct: 60  --LNLPKP---YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 152 GVIPHQLGNISNLQYLDLSKSYYELQVES---------ISWLSGLSFLEHLDLSLVDLTK 202
           G IP  L  I  L  LD S +     +                G      +  S    +K
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK 174

Query: 203 S-------SDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLF 255
                    + L          +         +     ++            +   NSL 
Sbjct: 175 LFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLA 234

Query: 256 QYSSWVFGLRNLVFFDLSDNEFHGKIPSGLGNLTFLRHLDLSSNEFNSAIPGWLSKLNDL 315
                V   +NL   DL +N  +G +P GL  L FL  L++S N     IP     L   
Sbjct: 235 FDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRF 293

Query: 316 EFLSL 320
           +  + 
Sbjct: 294 DVSAY 298
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query902
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.86
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.78
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.78
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.65
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.6
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.96
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.98
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=0  Score=281.82  Aligned_cols=293  Identities=32%  Similarity=0.480  Sum_probs=170.2

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC--CCCEEECCCC--CCEEEEECCCCCCCCCCCCCCCC--CCCCC
Q ss_conf             899898999998442088999998999999999944--3332426999--96899986999999998764343--01355
Q 002600           35 GCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCA--WDGVVCNNFT--GHVLQLNLGNPNPNYGTGSKLVG--KINPS  108 (902)
Q Consensus        35 ~~~~~~~~~ll~~~~~~~~~~~~~~~W~~~~~~~c~--w~gv~c~~~~--g~v~~L~L~~~~~~~~~~~~~~g--~l~~~  108 (902)
                      .|.++|++||++||+++.||. .+++|.. ++|||.  |.||+|+..+  +||++|+|++.        .+.|  .+|++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~-~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~--------~l~g~~~lp~~   71 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP-TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL--------NLPKPYPIPSS   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT-TSCTTTTCSTTEEECCSSSCCCEEEEEEECC--------CCSSCEECCGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-CCCCCCC-CCCCCCCCCCCEEEECCCCCEEEEEEECCCC--------CCCCCCCCCHH
T ss_conf             989899999999999779998-6778899-9999889488969748999479889989899--------88888879847


Q ss_pred             CCCCCCCCEEECCC-CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             43777898686989-99999988833568998987734588478989877889998758965578533233553324899
Q 002600          109 LFDLKHLIHLDLSD-NDFQGIQTPSYLGSLKNLRYLNLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQVESISWLSGL  187 (902)
Q Consensus       109 l~~l~~L~~L~L~~-n~l~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l  187 (902)
                      ++++++|++|++++ |++.+. +|..++++++|++|++++|.+.+..+..+..+.+|+++++++|..             
T Consensus        72 l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~-------------  137 (313)
T d1ogqa_          72 LANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL-------------  137 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE-------------
T ss_pred             HHCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCC-------------
T ss_conf             846753352020265433300-243114542001102035643443322222011100111122455-------------


Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99997867887577888721014899999799788988999999898788888957668986999663344323688776
Q 002600          188 SFLEHLDLSLVDLTKSSDGLVTINSLPSLKVLKLSYCELHHFPSLPSTNFSSLKALDLSGNHFNNSLFQYSSWVFGLRNL  267 (902)
Q Consensus       188 ~~L~~L~Ls~~~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~L  267 (902)
                                                                                     .+.+|.   .+..++.+
T Consensus       138 ---------------------------------------------------------------~~~~p~---~l~~l~~L  151 (313)
T d1ogqa_         138 ---------------------------------------------------------------SGTLPP---SISSLPNL  151 (313)
T ss_dssp             ---------------------------------------------------------------ESCCCG---GGGGCTTC
T ss_pred             ---------------------------------------------------------------CCCCCH---HHCCCCCC
T ss_conf             ---------------------------------------------------------------556851---22067400


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCC-CEEECCCCCCCCCCCHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             699844885887798678898988-7998569968998920005999898110366688897132378776599835854
Q 002600          268 VFFDLSDNEFHGKIPSGLGNLTFL-RHLDLSSNEFNSAIPGWLSKLNDLEFLSLRELGGQIPTSFVRLCKLTSIDVSYVK  346 (902)
Q Consensus       268 ~~L~L~~n~~~~~~p~~l~~l~~L-~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~l~~L~~L~l~~n~  346 (902)
                      +.+++++|.+.+.+|..+..+..+ +.+++++|.+++..+..                      +..+            
T Consensus       152 ~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~----------------------~~~l------------  197 (313)
T d1ogqa_         152 VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPT----------------------FANL------------  197 (313)
T ss_dssp             CEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGG----------------------GGGC------------
T ss_pred             CEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----------------------CCCC------------
T ss_conf             000023553356203121443112323102246435332433----------------------2222------------


Q ss_pred             CCCCCHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             68860577874202454663389802851477643001389998899877886889895233699999999843885798
Q 002600          347 LGQDLSQVLDIFSSCGAYALESLVLSGCHICGHLTNQLGQFKSLHTLELRDNSLSGPLPPALGELSSMKNLDLFNNTLDG  426 (902)
Q Consensus       347 l~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  426 (902)
                                        ....+++..+...+.++..+..+++++.++++++.+.+.++ .+..+++|+.|++++|++++
T Consensus       198 ------------------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g  258 (313)
T d1ogqa_         198 ------------------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYG  258 (313)
T ss_dssp             ------------------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEE
T ss_pred             ------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEECC
T ss_conf             ------------------22233333343322222222222221112222222222222-22245544444476570666


Q ss_pred             CCCHHHCCCCCCCEEECCCCCCCCCCCHHHHCCCCCCCEEECCCCE
Q ss_conf             8511104999787697426647420153434067644689736962
Q 002600          427 AIPMSLGQLSHLELLDLSNNRLNGTLSEIHFVNLTKLTSFSAFGNS  472 (902)
Q Consensus       427 ~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~l~~n~  472 (902)
                      .+|..+..+++|++|++++|.++|.+|.  +..+++|+.+++.+|+
T Consensus       259 ~iP~~l~~L~~L~~L~Ls~N~l~g~iP~--~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         259 TLPQGLTQLKFLHSLNVSFNNLCGEIPQ--GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCCGGGGGCTTCCEEECCSSEEEEECCC--STTGGGSCGGGTCSSS
T ss_pred             CCCHHHHCCCCCCEEECCCCCCCCCCCC--CCCCCCCCHHHHCCCC
T ss_conf             0876884799999897958835166898--6667998978868895
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure