Citrus Sinensis ID: 002620

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQVLYGS
ccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccEEEEccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccEEEEEEcccccHHHHHHcccEEEEEcccccEEEEEHHHcccccccHHHHHHHHcccccccccccccEEcEEEcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEccccEEEEEccEEEcccEEEEEEEEEEHHHHHHHHHHHHHHHHccEEEEEcEEEEEEccHHccccccEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHcccEEcccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEccccEEEEEEcccccHHHHHcccEEEEEEcccccHHHHHHHHccccccccccccEEEEcccccccccccccccEEEEEEcccccccccccccEEEEEEcccccHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEccccccEEEccEEEEEEEEEEEEEEEccHHHHHHHHHHHcccEEccEEEEEEcccccccccEEEEccccHHHHHHHccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHccccHHccccccccccccEEcccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHccEEEEEccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEccccEEEEEEEEEHcHHHHHHccEEEEEEcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccHEEEEEEHEcccccEEEEEcccccccccccEEEEEcccccccccccccEEEEEccccEEEEEEEccEEccccEEEEccEEEEEEHHHHHHHHHHccEEEEEEEEccEEEEccEEEEEEEHHHHccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccEEEEcccccEEcccccccHHHccccccccccccccccEEEEEEEEccccccccccEcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHccEEEEEccccccHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEEcEEccccccEEEEEcccccEEEEEHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEEEccccccEHHHHHHHHHHHHccccHHHHHHHHccccccccccccEEEEEcccccccccccccccEEEEEccccEEEEEEEEEcccccEEEEccEEEEEEHHHHHHHHHHHHHEEHEEEcccEEEEccEEEEEEcHHHcccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccc
MDDGVVQRVFEeggrdyfqqqpstsssspsilqslpvhasfdhGYYLLVKSIQELRekkggivtvgiggpsgsgkTSLAEKLASVIGCTLismenyrvgvdegndldsiDFDALVQNLQDltegkdtlipmfdyqqknrigskvikgassgvviVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVqydigdscsldsliDSIFPLFrkhiepdlhhAQIRINNRFVSSFREAIYKLKcrseapgacsisafqgneaqtdnfiemylrppsateeARINDWIKMRQSGIRYYLSigdqrivdknfiirpkaefeVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLrgtnrktvGAEALRmgingpwiTKSYLEMVLekkgvprlntpplfpntpttsnqesviaaprpirtnpnlvmkledlsqpwtrsptkskmepvlATWHfissdpshagssvigsssfrdtvklvpmpdsydfdrGLLLSVQAIQALLEnkglpvivgiggpsgsgktsLAHKMANIVGCEVVSLesyfkseqvkdfkyddfssldLSLLSKNisdirngrrtkvpifdletgarsgfkelevsedcgviIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVqrdksrmgcfmsqndimmtVFPMFQQHIEPHLVHAHLKirndfdpvlspesslfvlksnkqVAYQDILKIldpakfcssAQNFIDMYlrlpgiptngqltesdcIRVRICEGRFALLireplregnfiiqpkvdfdisISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVdhlqdapspylqikgvdKEAVAAAGStlkldgsyttKSYLQIILEKlpaversssgihTQQAARLQELVDFIQSQVLYGS
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGivtvgiggpsgsgKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQqknrigskvikgassgvvIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLsigdqrivdKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGtnrktvgaealrmgingpwITKSYLEMVLEKKGVPRLNTPplfpntpttsnqesviaaprpirtnpnLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLsknisdirngrrtkvpifdletgarsgfkelevSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLIsrvqrdksrmGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIptngqltesdcIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGstlkldgsytTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQVLYGS
MDDGVVQRVFEEGGRDYFqqqpstsssspsilqslpVHASFDHGYYLLVKSIQELREKkggivtvgiggpsgsgktSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYdigdscsldslidsiFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRlntpplfpntpttSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPshagssvigsssFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLpvivgiggpsgsgKTSLAHKMANIVGCEVVSLESYFKSEQVkdfkyddfssldlsllskNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQVLYGS
**********************************LPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGG*******SLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGV********************************************************VLATWHFI****************FRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAV***********AARLQELVDFIQSQVL***
******Q*********************************FDHGYYLLVKSI******KGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGS*VIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAP***************DNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKK********************************************************************************************PDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNK******************SAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKL*******************ELVDFIQSQVLYG*
MDDGVVQRVFEEGGRDY**************LQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPS********EKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAV**********QAARLQELVDFIQSQVLYGS
**DGVVQRVFEEGGRDY*QQ********PSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGI*****ARLQELVDFIQSQVLYGS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKGGIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQDLTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVHFSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKCRSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQRIVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDETFMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQESVIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQVLYGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query899 2.2.26 [Sep-21-2011]
Q54R62449 Uridine-cytidine kinase C yes no 0.437 0.875 0.369 6e-70
Q9GNF0492 Uridine-cytidine kinase D no no 0.417 0.762 0.311 8e-45
B5ZBE2207 Uridine kinase OS=Ureapla yes no 0.191 0.830 0.320 7e-14
Q9PQF9207 Uridine kinase OS=Ureapla yes no 0.191 0.830 0.315 2e-12
B1AIX1207 Uridine kinase OS=Ureapla yes no 0.191 0.830 0.315 2e-12
Q9Z7H0222 Uridine kinase OS=Chlamyd yes no 0.202 0.819 0.269 9e-11
Q38VV6211 Uridine kinase OS=Lactoba yes no 0.190 0.810 0.297 1e-10
O74427454 Uridine kinase OS=Schizos yes no 0.149 0.295 0.331 1e-10
P44533213 Uridine kinase OS=Haemoph yes no 0.184 0.779 0.306 2e-10
A5UFT8213 Uridine kinase OS=Haemoph yes no 0.184 0.779 0.306 2e-10
>sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 Back     alignment and function desciption
 Score =  266 bits (680), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 149/403 (36%), Positives = 245/403 (60%), Gaps = 10/403 (2%)

Query: 482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLE-NKGLPVIVGIGGPSGSGKTSLAHKMANI 540
           R T+K  P+ D+  FD+G  L+V+AIQ++ + ++G  ++VGI GPSG+GKTS+A K+ ++
Sbjct: 17  RYTIK--PLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGKTSIAQKIVSV 74

Query: 541 VGCEV-VSLESYF-KSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGAR 598
           +   + +SL++Y   S Q+ +  YDD+  +D  LL KNISD+ + + T +P++D     R
Sbjct: 75  LPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDLPLYDFTKSGR 134

Query: 599 SGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGC-- 656
             +K ++  E   V++ EG+YALH EIR  LDL +++ GGVH  LI R+ RD  R G   
Sbjct: 135 YAYKRVQPPE-SKVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFRDVHRTGQQP 193

Query: 657 FMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDIL- 715
             S   I  TV+PM++  IEP L  A +++ N F+P     + +++LKS KQ    D++ 
Sbjct: 194 HESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVKQGVTVDMIH 253

Query: 716 KILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFI 775
            +L+ +    +   + D+YL +P   T    +  D IRVR  +G+++++  E ++EG FI
Sbjct: 254 SVLNKSTIQENTARYYDIYL-IPPNTTFANSSSCDWIRVRNADGQYSIMFSEEIKEGPFI 312

Query: 776 IQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGV 835
           I P+VDF + ++ + GL++LGYQ VA I   + I++DGKI+I  D L++    ++QIKG 
Sbjct: 313 ISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELGQTFVQIKGF 372

Query: 836 DKEAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHT 878
           D  +V  AG  L L+ +Y  KSY+++  +K       +S + T
Sbjct: 373 DATSVQEAGKKLGLENNYLQKSYIELYQDKYKKSLSDNSTVTT 415
Catalyzes the conversion of uridine into uridine monophosphate and cytidine into cytidine monophosphate in the pyrimidine salvage pathway.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9GNF0|UCKD_DICDI Uridine-cytidine kinase D OS=Dictyostelium discoideum GN=udkD PE=2 SV=1 Back     alignment and function description
>sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9Z7H0|URK_CHLPN Uridine kinase OS=Chlamydia pneumoniae GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q38VV6|URK_LACSS Uridine kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 Back     alignment and function description
>sp|P44533|URK_HAEIN Uridine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|A5UFT8|URK_HAEIG Uridine kinase OS=Haemophilus influenzae (strain PittGG) GN=udk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
356519766945 PREDICTED: uncharacterized protein LOC10 0.981 0.933 0.838 0.0
356577089964 PREDICTED: uncharacterized protein LOC10 0.986 0.920 0.817 0.0
297737698981 unnamed protein product [Vitis vinifera] 0.993 0.910 0.840 0.0
449445419955 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.985 0.927 0.819 0.0
359472620951 PREDICTED: uncharacterized protein LOC10 0.975 0.922 0.839 0.0
334184093955 P-loop containing nucleoside triphosphat 0.977 0.920 0.811 0.0
297814378945 hypothetical protein ARALYDRAFT_322489 [ 0.975 0.928 0.811 0.0
334184095954 P-loop containing nucleoside triphosphat 0.976 0.920 0.799 0.0
224111502842 predicted protein [Populus trichocarpa] 0.880 0.940 0.769 0.0
255570128975 uridine cytidine kinase I, putative [Ric 0.934 0.861 0.755 0.0
>gi|356519766|ref|XP_003528540.1| PREDICTED: uncharacterized protein LOC100778905 [Glycine max] Back     alignment and taxonomy information
 Score = 1503 bits (3892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/897 (83%), Positives = 819/897 (91%), Gaps = 15/897 (1%)

Query: 1   MDDGVVQRVFEEGGRDYFQQQPSTSSSSPSILQSLPVHASFDHGYYLLVKSIQELREKKG 60
           MDD VVQRVF EGGRDYFQQQPSTSSSS SILQSLP+H SFDHGYYLLVKSIQELREKK 
Sbjct: 1   MDDEVVQRVFHEGGRDYFQQQPSTSSSSSSILQSLPLHVSFDHGYYLLVKSIQELREKKD 60

Query: 61  GIVTVGIGGPSGSGKTSLAEKLASVIGCTLISMENYRVGVDEGNDLDSIDFDALVQNLQD 120
           G+VTVGIGGPSGSGKTSL EK+ASVIGCT+ISMENYR GVDEGND+DSIDFD L++NL+D
Sbjct: 61  GLVTVGIGGPSGSGKTSLTEKVASVIGCTVISMENYRDGVDEGNDVDSIDFDTLIKNLED 120

Query: 121 LTEGKDTLIPMFDYQQKNRIGSKVIKGASSGVVIVDGTYALDARLRSLLDIRVAVVGGVH 180
           LT+G DT IP FDYQQK R+G K IK  SS VVIVDGTYAL A+LRSLLDIRVAVVGGVH
Sbjct: 121 LTKGNDTSIPEFDYQQKRRVGYKAIKSPSS-VVIVDGTYALHAKLRSLLDIRVAVVGGVH 179

Query: 181 FSLISKVQYDIGDSCSLDSLIDSIFPLFRKHIEPDLHHAQIRINNRFVSSFREAIYKLKC 240
           FSL+SKV+YDIGDSCSLD LIDSIFPLFRKHIEPDLHHAQIRINN FVSSFREA+YK+KC
Sbjct: 180 FSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHAQIRINNSFVSSFREAVYKVKC 239

Query: 241 RSEAPGACSISAFQGNEAQTDNFIEMYLRPPSATEEARINDWIKMRQSGIRYYLSIGDQR 300
           RS+    CS  AFQGNEAQTDNFIEMYLRPPSA+EEARINDWIK+RQSGIRYYLS+GDQR
Sbjct: 240 RSKV---CS--AFQGNEAQTDNFIEMYLRPPSASEEARINDWIKVRQSGIRYYLSLGDQR 294

Query: 301 IVDKNFIIRPKAEFEVGRMTLGGLLDLGYSVVASYKRASTYVVYGNLSVSFETIDTLDET 360
           IVDKNFIIRPKAEFEVGRMTLGGLL LGY VV SYKRAST V  G +S+SFETID L ET
Sbjct: 295 IVDKNFIIRPKAEFEVGRMTLGGLLALGYIVVVSYKRASTTVNNGKVSMSFETIDVLGET 354

Query: 361 FMVLRGTNRKTVGAEALRMGINGPWITKSYLEMVLEKKGVPRLNTPPLFPNTPTTSNQES 420
           FMV+RGTNRKTVG EALRMGINGPWITKSYLEM+LE+KGVPRL+TPPL  NT    +QE+
Sbjct: 355 FMVMRGTNRKTVGTEALRMGINGPWITKSYLEMILERKGVPRLSTPPLVSNTTVPGSQET 414

Query: 421 VIAAPRPIRTNPNLVMKLEDLSQPWTRSPTKSKMEPVLATWHFISSDPSHAGSSVIGS-- 478
           VIAAP+PIR  PNLV  L+DL QPWTRSPTKSKMEPV+A WHFISSD S   +SV+ +  
Sbjct: 415 VIAAPKPIRVTPNLVTGLDDLPQPWTRSPTKSKMEPVVAEWHFISSDSSLPDNSVLATTD 474

Query: 479 -SSFRDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKM 537
            SSFRD+V+L PMPDS+D DRGLLL+VQAIQALLENKG+PVIVGIGGPSGSGKTSLAHKM
Sbjct: 475 PSSFRDSVRLAPMPDSFDLDRGLLLAVQAIQALLENKGVPVIVGIGGPSGSGKTSLAHKM 534

Query: 538 ANIVGCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGA 597
           ANI+GCEVVSLESY+K  QVKDFKYDDFS+LDLSLLSKNI DIRNG+RTKVPIFDLE+GA
Sbjct: 535 ANIIGCEVVSLESYYK--QVKDFKYDDFSALDLSLLSKNIDDIRNGQRTKVPIFDLESGA 592

Query: 598 RSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCF 657
           RSGFKELEVSEDCGVIIFEG+YALHP+IR SLDLWIAVVGGVHSHLISRVQRDKSR+GCF
Sbjct: 593 RSGFKELEVSEDCGVIIFEGIYALHPDIRISLDLWIAVVGGVHSHLISRVQRDKSRVGCF 652

Query: 658 MSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKI 717
           +SQN+IMMTVFPMFQQ IEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNK+VAYQDI+ I
Sbjct: 653 ISQNEIMMTVFPMFQQLIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKKVAYQDIVAI 712

Query: 718 LDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQ 777
           LD AKFCSS Q FID+Y+RLPGIP+NGQL +SDCIRVRICEGRFALLIREP++EGNFIIQ
Sbjct: 713 LDSAKFCSSVQKFIDIYIRLPGIPSNGQLRDSDCIRVRICEGRFALLIREPIKEGNFIIQ 772

Query: 778 PKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDK 837
           PKVDFDI ISTVAGLLNLGYQAVAYIEASAFIYQDGK    VDHLQD P PY+QIKGV+K
Sbjct: 773 PKVDFDIGISTVAGLLNLGYQAVAYIEASAFIYQDGK----VDHLQDVPGPYIQIKGVNK 828

Query: 838 EAVAAAGSTLKLDGSYTTKSYLQIILEKLPAVERSSSGIHTQQAARLQELVDFIQSQ 894
           +AVAAAGS LKLDGSYTTKSYL+IILE+LPA+ER+S GIH+QQ+ARL E+V+FIQSQ
Sbjct: 829 DAVAAAGSMLKLDGSYTTKSYLEIILERLPAIERTSGGIHSQQSARLLEIVEFIQSQ 885

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356577089|ref|XP_003556660.1| PREDICTED: uncharacterized protein LOC100787760 [Glycine max] Back     alignment and taxonomy information
>gi|297737698|emb|CBI26899.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445419|ref|XP_004140470.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101220584 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359472620|ref|XP_002280757.2| PREDICTED: uncharacterized protein LOC100261233 [Vitis vinifera] Back     alignment and taxonomy information
>gi|334184093|ref|NP_178255.5| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|330250362|gb|AEC05456.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297814378|ref|XP_002875072.1| hypothetical protein ARALYDRAFT_322489 [Arabidopsis lyrata subsp. lyrata] gi|297320910|gb|EFH51331.1| hypothetical protein ARALYDRAFT_322489 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334184095|ref|NP_001189495.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|330250363|gb|AEC05457.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224111502|ref|XP_002315881.1| predicted protein [Populus trichocarpa] gi|222864921|gb|EEF02052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570128|ref|XP_002526026.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223534673|gb|EEF36366.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
DICTYBASE|DDB_G0283371449 udkC "adenylate cyclase domain 0.422 0.846 0.338 9.6e-57
TAIR|locus:2028809 674 AT1G26190 [Arabidopsis thalian 0.421 0.562 0.293 2e-48
TAIR|locus:2031541 643 AT1G73980 [Arabidopsis thalian 0.417 0.583 0.303 1.6e-46
DICTYBASE|DDB_G0271146492 udkD "adenylate cyclase domain 0.413 0.756 0.277 5.8e-35
CGD|CAL0002407545 URK1 [Candida albicans (taxid: 0.074 0.122 0.394 0.00023
SGD|S000005295501 URK1 "Uridine/cytidine kinase" 0.107 0.193 0.350 0.00055
DICTYBASE|DDB_G0283371 udkC "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 584 (210.6 bits), Expect = 9.6e-57, P = 9.6e-57
 Identities = 132/390 (33%), Positives = 220/390 (56%)

Query:   482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLE-NKGLXXXXXXXXXXXXXKTSLAHKMANI 540
             R T+K  P+ D+  FD+G  L+V+AIQ++ + ++G              KTS+A K+ ++
Sbjct:    17 RYTIK--PLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGKTSIAQKIVSV 74

Query:   541 VGCEV-VSLESYF-KSEQVXXXXXXXXXXXXXXXXXXNISDIRNGRRTKVPIFDLETGAR 598
             +   + +SL++Y   S Q+                  NISD+ + + T +P++D     R
Sbjct:    75 LPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDLPLYDFTKSGR 134

Query:   599 SGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGC-- 656
               +K ++  E   V++ EG+YALH EIR  LDL +++ GGVH  LI R+ RD  R G   
Sbjct:   135 YAYKRVQPPES-KVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFRDVHRTGQQP 193

Query:   657 FMSQNDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDIL- 715
               S   I  TV+PM++  IEP L  A +++ N F+P     + +++LKS KQ    D++ 
Sbjct:   194 HESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVKQGVTVDMIH 253

Query:   716 KILDPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFI 775
              +L+ +    +   + D+YL +P   T    +  D IRVR  +G+++++  E ++EG FI
Sbjct:   254 SVLNKSTIQENTARYYDIYL-IPPNTTFANSSSCDWIRVRNADGQYSIMFSEEIKEGPFI 312

Query:   776 IQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGV 835
             I P+VDF + ++ + GL++LGYQ VA I   + I++DGKI+I  D L++    ++QIKG 
Sbjct:   313 ISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELGQTFVQIKGF 372

Query:   836 DKEAVAAAGSTLKLDGSYTTKSYLQIILEK 865
             D  +V  AG  L L+ +Y  KSY+++  +K
Sbjct:   373 DATSVQEAGKKLGLENNYLQKSYIELYQDK 402
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004849 "uridine kinase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0016740 "transferase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0044211 "CTP salvage" evidence=IEA
GO:0044206 "UMP salvage" evidence=IEA
TAIR|locus:2028809 AT1G26190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031541 AT1G73980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271146 udkD "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0002407 URK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000005295 URK1 "Uridine/cytidine kinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030501001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (952 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00020734001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (423 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
PLN02318 656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 1e-72
PLN02318656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 7e-66
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 3e-54
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 1e-53
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 6e-26
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 3e-23
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 3e-22
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 4e-22
TIGR00235207 TIGR00235, udk, uridine kinase 2e-20
TIGR00235207 TIGR00235, udk, uridine kinase 3e-19
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 2e-17
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 2e-17
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 7e-17
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 9e-13
PRK06696223 PRK06696, PRK06696, uridine kinase; Validated 1e-08
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 5e-08
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 2e-06
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 3e-06
pfam13207114 pfam13207, AAA_17, AAA domain 4e-06
PRK06547172 PRK06547, PRK06547, hypothetical protein; Provisio 5e-06
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 2e-05
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 2e-05
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 4e-05
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 6e-05
pfam13207114 pfam13207, AAA_17, AAA domain 1e-04
PRK06696223 PRK06696, PRK06696, uridine kinase; Validated 2e-04
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 2e-04
COG1437178 COG1437, CyaB, Adenylate cyclase, class 2 (thermop 2e-04
PRK06547172 PRK06547, PRK06547, hypothetical protein; Provisio 3e-04
COG1763161 COG1763, MobB, Molybdopterin-guanine dinucleotide 4e-04
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 7e-04
PRK00091307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp 7e-04
COG0378202 COG0378, HypB, Ni2+-binding GTPase involved in reg 7e-04
PRK04182180 PRK04182, PRK04182, cytidylate kinase; Provisional 8e-04
pfam13238128 pfam13238, AAA_18, AAA domain 0.001
cd03116159 cd03116, MobB, Molybdenum is an essential trace el 0.002
COG0324308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph 0.003
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information 
 Score =  252 bits (644), Expect = 1e-72
 Identities = 133/392 (33%), Positives = 223/392 (56%), Gaps = 15/392 (3%)

Query: 482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIV 541
            D  ++VP+ D   F++G  + ++A Q L +     ++VG+ GPSG+GKT    K+ N +
Sbjct: 30  SDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKTVFTEKVLNFM 89

Query: 542 -GCEVVSLESYFKSEQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSG 600
               V+S+++Y  S ++ D  +DD    D   L  NI D++ G+  +VPI+D ++ +R G
Sbjct: 90  PSIAVISMDNYNDSSRIIDGNFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVG 149

Query: 601 FKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQ 660
           ++ LEV     VII EG+YAL  ++R  LDL ++V GGVH  L+ RV RD  R G     
Sbjct: 150 YRTLEVPSSRIVII-EGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAG--QEP 206

Query: 661 NDIMM----TVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILK 716
            +I+     TV+PM++  IEP L  AH+KI N F+P    ++  ++LKS++ V  + I  
Sbjct: 207 EEIIHQISETVYPMYKAFIEPDLQTAHIKIVNKFNPFSGFQNPTYILKSSRSVTVEQIKA 266

Query: 717 ILDPAKFCSSAQNFIDMYLRLPG-IPTNGQLTESDCIRVRICEGRFALLIREPLREGNFI 775
           +L       + +   D+YL  PG  P   Q      +R+R  +G+++L+  E + +  FI
Sbjct: 267 VLS-EDHTETTEETYDIYLLPPGEDPETCQ----SYLRMRNRDGKYSLMFEEWVTDEPFI 321

Query: 776 IQPKVDFDISISTVAGLLNLGYQAVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGV 835
           I P++ F++S+  + GL+ LGY     ++ S+ ++ D K+ +++D L+     Y+Q++G 
Sbjct: 322 ISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGK 381

Query: 836 DKEAVAAAGSTLKLDGSYTTKSYL-QIILEKL 866
           D+  V      L L+GSY  ++Y+ QI LEKL
Sbjct: 382 DRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKL 413

Length = 656
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|180660 PRK06696, PRK06696, uridine kinase; Validated Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235825 PRK06547, PRK06547, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|180660 PRK06696, PRK06696, uridine kinase; Validated Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|224354 COG1437, CyaB, Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235825 PRK06547, PRK06547, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224677 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>gnl|CDD|223455 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>gnl|CDD|235244 PRK04182, PRK04182, cytidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|222000 pfam13238, AAA_18, AAA domain Back     alignment and domain information
>gnl|CDD|239390 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 899
PLN02318 656 phosphoribulokinase/uridine kinase 100.0
PLN02318656 phosphoribulokinase/uridine kinase 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 100.0
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.97
PTZ00301210 uridine kinase; Provisional 99.96
KOG2878282 consensus Predicted kinase [General function predi 99.96
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.96
PRK05439311 pantothenate kinase; Provisional 99.95
PLN03046460 D-glycerate 3-kinase; Provisional 99.94
PLN02796347 D-glycerate 3-kinase 99.94
PLN02348395 phosphoribulokinase 99.94
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.94
PRK05439311 pantothenate kinase; Provisional 99.94
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.94
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.94
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.93
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.93
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.92
PRK15453290 phosphoribulokinase; Provisional 99.92
COG4240300 Predicted kinase [General function prediction only 99.91
PRK05480209 uridine/cytidine kinase; Provisional 99.91
PTZ00301210 uridine kinase; Provisional 99.91
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.9
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.9
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.89
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.88
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.88
PRK07429327 phosphoribulokinase; Provisional 99.88
PLN02348395 phosphoribulokinase 99.87
PRK06696223 uridine kinase; Validated 99.87
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.86
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.86
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.86
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.85
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.85
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.85
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.84
PRK05480209 uridine/cytidine kinase; Provisional 99.84
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.83
PRK07667193 uridine kinase; Provisional 99.83
PRK06696223 uridine kinase; Validated 99.82
PRK15453290 phosphoribulokinase; Provisional 99.81
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.81
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.8
PRK07429327 phosphoribulokinase; Provisional 99.8
PRK07667193 uridine kinase; Provisional 99.79
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.79
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.77
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.76
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.76
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.76
PRK06547172 hypothetical protein; Provisional 99.75
PRK06547172 hypothetical protein; Provisional 99.75
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 99.72
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.72
PTZ00451244 dephospho-CoA kinase; Provisional 99.71
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.71
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.71
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.71
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.69
PLN02422232 dephospho-CoA kinase 99.67
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.66
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.63
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.63
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.62
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.62
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.61
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.56
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 99.54
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.54
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 99.52
PRK08233182 hypothetical protein; Provisional 99.5
PRK08233182 hypothetical protein; Provisional 99.47
KOG3308225 consensus Uncharacterized protein of the uridine k 99.46
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.45
KOG3308225 consensus Uncharacterized protein of the uridine k 99.43
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.41
PLN03046460 D-glycerate 3-kinase; Provisional 99.39
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.36
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.35
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.33
PLN02796347 D-glycerate 3-kinase 99.33
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.33
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.32
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.29
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 99.28
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.25
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.22
PLN02422232 dephospho-CoA kinase 99.21
PTZ00451244 dephospho-CoA kinase; Provisional 99.18
PRK01184184 hypothetical protein; Provisional 99.18
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.15
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 99.14
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.14
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.13
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.09
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 99.07
PRK06217183 hypothetical protein; Validated 99.07
COG4240300 Predicted kinase [General function prediction only 99.06
PRK04182180 cytidylate kinase; Provisional 99.06
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.06
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.05
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.04
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 99.02
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 99.0
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.0
PRK06217183 hypothetical protein; Validated 98.97
PRK00023225 cmk cytidylate kinase; Provisional 98.96
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.95
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 98.95
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.95
PRK08118167 topology modulation protein; Reviewed 98.95
PRK06762166 hypothetical protein; Provisional 98.95
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.94
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.9
PRK07261171 topology modulation protein; Provisional 98.88
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 98.86
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.85
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 98.83
PRK08118167 topology modulation protein; Reviewed 98.83
PRK08356195 hypothetical protein; Provisional 98.82
PRK07261171 topology modulation protein; Provisional 98.82
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 98.8
PRK13949169 shikimate kinase; Provisional 98.79
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.77
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.77
PLN02200234 adenylate kinase family protein 98.75
PRK00131175 aroK shikimate kinase; Reviewed 98.73
PRK05541176 adenylylsulfate kinase; Provisional 98.72
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 98.71
PRK01184184 hypothetical protein; Provisional 98.69
PRK04182180 cytidylate kinase; Provisional 98.67
PRK00625173 shikimate kinase; Provisional 98.66
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 98.65
PRK00023225 cmk cytidylate kinase; Provisional 98.64
PRK03839180 putative kinase; Provisional 98.62
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.62
KOG2878282 consensus Predicted kinase [General function predi 98.61
PRK04040188 adenylate kinase; Provisional 98.6
PRK05057172 aroK shikimate kinase I; Reviewed 98.59
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.59
PRK06762166 hypothetical protein; Provisional 98.56
PRK14737186 gmk guanylate kinase; Provisional 98.55
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.53
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.51
PRK14528186 adenylate kinase; Provisional 98.51
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.51
PRK13946184 shikimate kinase; Provisional 98.5
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.49
PRK14527191 adenylate kinase; Provisional 98.48
PRK12269863 bifunctional cytidylate kinase/ribosomal protein S 98.48
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.47
PRK03731171 aroL shikimate kinase II; Reviewed 98.47
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.46
PRK13947171 shikimate kinase; Provisional 98.45
PRK04040188 adenylate kinase; Provisional 98.44
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.43
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.42
PRK00131175 aroK shikimate kinase; Reviewed 98.42
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.41
PRK03839180 putative kinase; Provisional 98.41
PRK08356195 hypothetical protein; Provisional 98.41
PRK02496184 adk adenylate kinase; Provisional 98.4
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.4
PRK14531183 adenylate kinase; Provisional 98.4
PRK14530215 adenylate kinase; Provisional 98.39
PRK13948182 shikimate kinase; Provisional 98.38
PRK14532188 adenylate kinase; Provisional 98.37
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.37
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 98.37
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.36
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.36
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.34
PLN02200234 adenylate kinase family protein 98.33
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.31
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.31
PLN02199303 shikimate kinase 98.3
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.29
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 98.28
PRK00279215 adk adenylate kinase; Reviewed 98.28
PRK05541176 adenylylsulfate kinase; Provisional 98.28
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.27
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.25
PTZ00088229 adenylate kinase 1; Provisional 98.25
PHA02530300 pseT polynucleotide kinase; Provisional 98.23
PRK03846198 adenylylsulfate kinase; Provisional 98.23
PLN02840421 tRNA dimethylallyltransferase 98.23
PRK00625173 shikimate kinase; Provisional 98.22
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.22
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.21
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.21
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.19
PRK13808333 adenylate kinase; Provisional 98.19
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.18
PLN02165334 adenylate isopentenyltransferase 98.18
PRK13949169 shikimate kinase; Provisional 98.16
PRK12338319 hypothetical protein; Provisional 98.15
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.15
PRK14527191 adenylate kinase; Provisional 98.14
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.13
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 98.12
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 98.11
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.11
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.09
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.09
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 98.09
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.08
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 98.07
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.07
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.06
PRK14737186 gmk guanylate kinase; Provisional 98.05
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 98.04
PLN02674244 adenylate kinase 98.03
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.02
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.02
PRK12339197 2-phosphoglycerate kinase; Provisional 98.01
PRK14530215 adenylate kinase; Provisional 98.0
PRK12338319 hypothetical protein; Provisional 97.99
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.99
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.99
PRK14528186 adenylate kinase; Provisional 97.99
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 97.98
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.98
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.98
PRK00300205 gmk guanylate kinase; Provisional 97.97
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.96
PRK00889175 adenylylsulfate kinase; Provisional 97.95
PRK03731171 aroL shikimate kinase II; Reviewed 97.95
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.92
PLN02748468 tRNA dimethylallyltransferase 97.91
PRK14531183 adenylate kinase; Provisional 97.9
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.9
PRK13946184 shikimate kinase; Provisional 97.9
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.89
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.89
PRK14526211 adenylate kinase; Provisional 97.88
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.88
PRK13975196 thymidylate kinase; Provisional 97.88
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.86
PRK14532188 adenylate kinase; Provisional 97.86
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.85
PRK05057172 aroK shikimate kinase I; Reviewed 97.85
PRK02496184 adk adenylate kinase; Provisional 97.85
PRK00279215 adk adenylate kinase; Reviewed 97.84
PRK04220301 2-phosphoglycerate kinase; Provisional 97.84
COG3954289 PrkB Phosphoribulokinase [Energy production and co 97.82
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.82
PTZ00088229 adenylate kinase 1; Provisional 97.8
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.8
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.79
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 97.79
PRK00698205 tmk thymidylate kinase; Validated 97.79
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.78
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.76
PLN02459261 probable adenylate kinase 97.74
PRK14529223 adenylate kinase; Provisional 97.72
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.72
PRK09825176 idnK D-gluconate kinase; Provisional 97.72
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 97.7
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.69
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 97.68
PRK12339197 2-phosphoglycerate kinase; Provisional 97.65
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.63
PRK13808333 adenylate kinase; Provisional 97.62
PLN02842505 nucleotide kinase 97.61
PRK13947171 shikimate kinase; Provisional 97.59
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.58
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.58
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.57
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.57
PRK11545163 gntK gluconate kinase 1; Provisional 97.57
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.56
PLN02674244 adenylate kinase 97.55
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 97.55
PRK03846198 adenylylsulfate kinase; Provisional 97.55
PRK00300205 gmk guanylate kinase; Provisional 97.53
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.53
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.52
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.51
PRK12337475 2-phosphoglycerate kinase; Provisional 97.51
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.5
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.5
PHA00729226 NTP-binding motif containing protein 97.49
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.49
PHA02530300 pseT polynucleotide kinase; Provisional 97.48
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.48
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 97.47
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.45
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.45
PRK13948182 shikimate kinase; Provisional 97.45
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.45
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.44
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.43
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.4
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 97.39
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.38
PRK14738206 gmk guanylate kinase; Provisional 97.37
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.35
PRK09825176 idnK D-gluconate kinase; Provisional 97.34
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.33
PHA00729226 NTP-binding motif containing protein 97.32
COG0645170 Predicted kinase [General function prediction only 97.31
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.29
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.28
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.24
PRK04220301 2-phosphoglycerate kinase; Provisional 97.24
PLN02459261 probable adenylate kinase 97.22
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.22
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.22
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.22
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.21
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 97.21
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.19
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.17
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.17
PRK13973213 thymidylate kinase; Provisional 97.17
PRK14526211 adenylate kinase; Provisional 97.16
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.14
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.13
PRK14529223 adenylate kinase; Provisional 97.12
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.12
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 97.1
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.09
PRK13975196 thymidylate kinase; Provisional 97.08
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.08
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 97.04
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 97.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.0
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 96.97
PLN02840421 tRNA dimethylallyltransferase 96.96
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.95
PLN02165334 adenylate isopentenyltransferase 96.94
COG4639168 Predicted kinase [General function prediction only 96.92
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.92
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.87
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.87
PRK09435332 membrane ATPase/protein kinase; Provisional 96.82
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 96.8
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 96.79
COG1660286 Predicted P-loop-containing kinase [General functi 96.78
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.77
PLN02842 505 nucleotide kinase 96.76
PRK14738206 gmk guanylate kinase; Provisional 96.75
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 96.75
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 96.75
PRK09435332 membrane ATPase/protein kinase; Provisional 96.71
PRK07933213 thymidylate kinase; Validated 96.66
PF00004132 AAA: ATPase family associated with various cellula 96.63
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 96.63
PLN02748468 tRNA dimethylallyltransferase 96.62
COG4639168 Predicted kinase [General function prediction only 96.59
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.59
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.56
PLN02924220 thymidylate kinase 96.53
PRK00889175 adenylylsulfate kinase; Provisional 96.46
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 96.46
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.45
PF00004132 AAA: ATPase family associated with various cellula 96.42
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.4
PRK13973213 thymidylate kinase; Provisional 96.33
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.32
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.31
PRK11545163 gntK gluconate kinase 1; Provisional 96.3
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.21
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 96.2
PLN02772398 guanylate kinase 96.18
PRK13974212 thymidylate kinase; Provisional 96.16
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.14
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.11
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.09
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.08
PRK13976209 thymidylate kinase; Provisional 96.07
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 96.05
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 96.05
COG4619223 ABC-type uncharacterized transport system, ATPase 96.01
COG4619223 ABC-type uncharacterized transport system, ATPase 95.98
COG3025432 Uncharacterized conserved protein [Function unknow 95.96
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.96
PLN02199303 shikimate kinase 95.96
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 95.93
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.88
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 95.88
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.87
PRK12337475 2-phosphoglycerate kinase; Provisional 95.86
PHA03132580 thymidine kinase; Provisional 95.85
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 95.83
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.78
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 95.77
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.77
smart00382148 AAA ATPases associated with a variety of cellular 95.76
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.74
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.73
TIGR00064272 ftsY signal recognition particle-docking protein F 95.68
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.68
PRK06761282 hypothetical protein; Provisional 95.66
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.66
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.64
TIGR00101199 ureG urease accessory protein UreG. This model rep 95.61
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.61
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 95.6
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.6
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.59
smart00382148 AAA ATPases associated with a variety of cellular 95.59
PRK06761282 hypothetical protein; Provisional 95.58
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.57
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.55
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.54
COG2954156 Uncharacterized protein conserved in bacteria [Fun 95.54
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.53
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.51
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 95.5
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.49
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.49
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.48
PRK10416318 signal recognition particle-docking protein FtsY; 95.47
COG3709192 Uncharacterized component of phosphonate metabolis 95.45
PRK10416318 signal recognition particle-docking protein FtsY; 95.45
TIGR00064272 ftsY signal recognition particle-docking protein F 95.43
cd03115173 SRP The signal recognition particle (SRP) mediates 95.42
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.42
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.41
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 95.4
PF1355562 AAA_29: P-loop containing region of AAA domain 95.4
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.39
PRK00698205 tmk thymidylate kinase; Validated 95.39
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.36
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.36
PF1355562 AAA_29: P-loop containing region of AAA domain 95.34
PRK14974336 cell division protein FtsY; Provisional 95.31
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.3
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.28
TIGR00101199 ureG urease accessory protein UreG. This model rep 95.26
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.24
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.23
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.23
PRK14974336 cell division protein FtsY; Provisional 95.23
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.18
cd03116159 MobB Molybdenum is an essential trace element in t 95.17
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 95.15
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.15
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.14
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 95.13
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.13
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 95.11
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.06
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.02
PRK10867433 signal recognition particle protein; Provisional 95.01
cd03115173 SRP The signal recognition particle (SRP) mediates 95.0
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 94.95
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.94
PRK08099399 bifunctional DNA-binding transcriptional repressor 94.94
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.94
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.93
TIGR00959428 ffh signal recognition particle protein. This mode 94.9
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 94.89
PF13173128 AAA_14: AAA domain 94.89
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 94.88
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.88
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 94.87
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.86
PRK10867433 signal recognition particle protein; Provisional 94.85
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.83
COG0645170 Predicted kinase [General function prediction only 94.83
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.82
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.82
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.81
PRK13768253 GTPase; Provisional 94.81
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 94.76
PRK10646153 ADP-binding protein; Provisional 94.76
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.75
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 94.75
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.74
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.72
PRK10646153 ADP-binding protein; Provisional 94.7
PRK00771437 signal recognition particle protein Srp54; Provisi 94.7
COG0802149 Predicted ATPase or kinase [General function predi 94.69
KOG3062281 consensus RNA polymerase II elongator associated p 94.69
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 94.68
PF13173128 AAA_14: AAA domain 94.68
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.67
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 94.67
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 94.67
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.65
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.64
cd03116159 MobB Molybdenum is an essential trace element in t 94.64
COG1117253 PstB ABC-type phosphate transport system, ATPase c 94.63
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.6
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.59
COG1117253 PstB ABC-type phosphate transport system, ATPase c 94.59
KOG4235244 consensus Mitochondrial thymidine kinase 2/deoxygu 94.57
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 94.57
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 94.56
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.55
CHL00195489 ycf46 Ycf46; Provisional 94.53
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.53
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.52
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.49
PF00005137 ABC_tran: ABC transporter This structure is on hol 94.49
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information 
Probab=100.00  E-value=4.5e-77  Score=680.04  Aligned_cols=383  Identities=33%  Similarity=0.624  Sum_probs=356.1

Q ss_pred             ccceeeecCCCCcccchhhHHHHHHHHHHHHcCCCCEEEeeeCCCCccHHHHHHHHHHHh-CCcccccccccchhhcccc
Q 002620          482 RDTVKLVPMPDSYDFDRGLLLSVQAIQALLENKGLPVIVGIGGPSGSGKTSLAHKMANIV-GCEVVSLESYFKSEQVKDF  560 (899)
Q Consensus       482 ~~~~~~~~~~~~l~~~e~~~~~i~~~~~l~~~~~~~~iIgI~G~sGSGKTTla~~L~~~l-~~~vislDdfy~~~~~~~~  560 (899)
                      .++++++|+|+.++|++||++.+++++.+..+.+.+++|||+||+||||||||+.|+..+ ++.+|++|+|+.......+
T Consensus        30 ~~~~~i~~~~~~~sfd~g~~~~ira~qlL~~~~~~riIIGIaGpSGSGKTTLAk~LaglLp~vgvIsmDdy~~~~~~i~~  109 (656)
T PLN02318         30 SDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVISMDNYNDSSRIIDG  109 (656)
T ss_pred             CCceEEEeCCCccccccchhhhhHHHHHHHhcCCCeEEEEEECCCCCcHHHHHHHHHhhCCCcEEEEEcceecchhhhCc
Confidence            579999999999999999999999999999988889999999999999999999999988 4679999999876544567


Q ss_pred             cCCCcccccHHHHHHHHHHHhcCCceecccccccccccCCccceeeccCCcEEEEEeecccchhhhhcCCEEEEEEcCch
Q 002620          561 KYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHPEIRKSLDLWIAVVGGVH  640 (899)
Q Consensus       561 ~~d~p~t~D~~lL~~~L~~L~~g~~v~~P~yD~~~~~r~~~~~~~~~~~~dVVIvEG~~~~~~~l~~~~D~~I~vd~~~d  640 (899)
                      +|++|.++|++.+.++|..|++|+.+.+|.||+.++++.+... ....+.+|||+||+|++++.+++++|++|||++|.+
T Consensus       110 nfD~P~a~D~d~L~enL~~Lr~GksV~iPiYDf~t~~r~~~~~-i~v~p~~VVIVEGIyaL~~~Lr~LlDlkIFVDtdvD  188 (656)
T PLN02318        110 NFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRT-LEVPSSRIVIIEGIYALSEKLRPLLDLRVSVTGGVH  188 (656)
T ss_pred             cCCChhhcchhHHHHHHHHHhCCCceecCccccccCcccCCce-eecCCCcEEEEechhhccHhHHhhCCEEEEEcCCcc
Confidence            8999999999999999999999999999999999998874322 334678999999999999999999999999999999


Q ss_pred             hhHHHHhhcCccccccccch--hhHHhhccchhhhhcccccCcccEEEcCCCCCCCCccchhhhhccccchhhHHHhhcC
Q 002620          641 SHLISRVQRDKSRMGCFMSQ--NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFDPVLSPESSLFVLKSNKQVAYQDILKIL  718 (899)
Q Consensus       641 ~rl~Rri~RD~~~rg~~~~~--~q~~~~v~p~~~~~I~p~~~~ADivI~n~~~~rl~qe~~~~~~k~~~~~~~~~~~~~m  718 (899)
                      .++.||+.||..++|++.+.  .++...++|+|..||+|++++||++|+|+|+|+-..+++.+++++.+++.+|+|++.|
T Consensus       189 irL~RRI~RD~~eRGrs~EsVi~q~~~~VkP~y~~FIeP~kk~ADIII~n~f~P~~g~~np~~Ilk~~~~~~~~~i~~~L  268 (656)
T PLN02318        189 FDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNKFNPFSGFQNPTYILKSSRSVTVEQIKAVL  268 (656)
T ss_pred             HHHHHHHHHHHHHhCCCHHHHHHHHHHhhcchHHHHhCcchhcceEEEecCCCCCCCCCCCeEEecCCccccHHHHHHHh
Confidence            99999999999999998875  6888899999999999999999999999999999999999999999999999999999


Q ss_pred             ChhhhhccccccccccccCCCCCCCCCcCCCceEEEEeeCCEEEEEEeccccccCcccccceeEEehhhHHHHHHHcCce
Q 002620          719 DPAKFCSSAQNFIDMYLRLPGIPTNGQLTESDCIRVRICEGRFALLIREPLREGNFIIQPKVDFDISISTVAGLLNLGYQ  798 (899)
Q Consensus       719 ~~~~v~~fv~~y~d~Y~~~~~l~~~~~~~~~~~irir~~~~~~~l~~~~~~~d~~~~~~~~~~~~v~~~~~~~l~~lg~~  798 (899)
                      +.+ .+..+.+|+||||++|+.+.   .++++|||||+|+|+|+|||++|++|++|||+|+++|||++++++|||+|||+
T Consensus       269 ~~~-~~~~~~~~~DiYl~~P~~d~---~~~~e~LRvR~~~Gk~~Ltyke~i~dgp~ii~pk~~fEv~v~~~~gL~aLGy~  344 (656)
T PLN02318        269 SED-HTETTEETYDIYLLPPGEDP---ETCQSYLRMRNRDGKYSLMFEEWVTDEPFIISPRITFEVSVRLLGGLMALGYT  344 (656)
T ss_pred             hhc-cccccceeeEEEecCCCCCc---hhccceEEEEecCCEEEEEEecccccCCeecCcceeEEEeeehHhHHHHcCCc
Confidence            864 77788999999999995442   35567999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeeeeeEEeecCcEEEEEecccCCCCceEEEecccHHHHHHHHhhCCCCCCccchhHHHH-HHhhCccc
Q 002620          799 AVAYIEASAFIYQDGKILIEVDHLQDAPSPYLQIKGVDKEAVAAAGSTLKLDGSYTTKSYLQI-ILEKLPAV  869 (899)
Q Consensus       799 ~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~syle~-~~~~~~~~  869 (899)
                      ++++++|.|++|++|+|+|++||||+||++|+||+|.+|+.|.++|++|||+|+|+|+||||| +||||++.
T Consensus       345 ~~a~vkk~r~iy~~g~v~i~lD~ve~Lg~~FvqIeg~~r~~V~~~a~kLGl~g~~i~~SYlE~i~~~~~~~~  416 (656)
T PLN02318        345 IATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKLVNE  416 (656)
T ss_pred             eEEEEEEEEEEEecCCEEEEeehhhccCCeeEEEehhHHHHHHHHHHHcCCCCCcccccHHHHHHHHHhHHH
Confidence            999999999999999999999999999999999999999999999999999999999999995 68888753

>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3025 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2954 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 7e-39
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 9e-26
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 5e-33
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 1e-27
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 5e-29
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 6e-25
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 5e-26
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 7e-24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 7e-24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 6e-18
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-19
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-14
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 2e-17
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 2e-16
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 5e-13
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 4e-11
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-10
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 7e-10
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 2e-09
1yem_A179 Hypothetical protein; structural genomics, southea 3e-08
1yem_A179 Hypothetical protein; structural genomics, southea 7e-06
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 1e-05
2hf9_A226 Probable hydrogenase nickel incorporation protein 2e-05
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 1e-04
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 3e-04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 4e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 4e-04
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 4e-04
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 5e-04
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
 Score =  144 bits (364), Expect = 7e-39
 Identities = 50/211 (23%), Positives = 94/211 (44%), Gaps = 24/211 (11%)

Query: 503 SVQAIQALLE-NKGLPVIVGIGGPSGSGKTSLAHKMANIVGCE----------VVSLESY 551
           S Q +Q   + N G P ++G+ G + SGK+S+  K+  ++G            ++S +S+
Sbjct: 7   SEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSF 66

Query: 552 FKS--------EQVKDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFKE 603
           ++              F +D   + D  L+ K + +I  G+  ++P++D  + +R    E
Sbjct: 67  YRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKE--E 124

Query: 604 LEVSEDCGVIIFEGVYALH-PEIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQ-- 660
                   V++FEG+ A +  E+R    + + V     + L  RV RD S  G  + Q  
Sbjct: 125 TVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQIL 184

Query: 661 NDIMMTVFPMFQQHIEPHLVHAHLKIRNDFD 691
           +  +  V P F++   P   +A + I    D
Sbjct: 185 SQYITFVKPAFEEFCLPTKKYADVIIPRGAD 215
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Length = 179 Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Length = 179 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Length = 221 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Length = 226 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Length = 183 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Length = 230 Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 899
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 7e-24
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 2e-17
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 5e-18
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 1e-11
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 4e-15
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 5e-11
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 3e-11
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 6e-06
d1ckea_225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 3e-06
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 3e-05
d2acaa1174 d.63.1.2 (A:8-181) Putative adenylate cyclase VP17 1e-04
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 3e-04
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 3e-04
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 9e-04
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.001
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.004
d1q3ta_223 c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae 0.002
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.003
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.003
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.003
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.003
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 0.004
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  100 bits (250), Expect = 7e-24
 Identities = 30/249 (12%), Positives = 83/249 (33%), Gaps = 48/249 (19%)

Query: 517 PVIVGIGGPSGSGKTSLAHKMANIVGCE-----VVSLESYFKS--------------EQV 557
             I+ + G SG+G +++ H    I   E      +  +++ +                  
Sbjct: 4   HPIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRYAAGD 63

Query: 558 KDFKYDDFSSLDLSLLSKNISDIRNGRRTKVPIFDLETGARSGFK--------ELEVSED 609
             F +  + + +L  L +   +     + +   +  +    +             +   D
Sbjct: 64  ATFSHFSYEANELKELERVFREYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSD 123

Query: 610 CGVIIFEGVYALHP----EIRKSLDLWIAVVGGVHSHLISRVQRDKSRMGCFMSQNDIMM 665
             ++ +EG++         I    DL I VV  ++   I ++ RD++  G   +   +  
Sbjct: 124 SHLLFYEGLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQKIHRDRATRG--YTTEAVTD 181

Query: 666 TVF---PMFQQHIEPHLVHAHLKIR--------NDFDP--VLSPESSLFVL--KSNKQVA 710
            +      +   I P      +  +        N F    + + + S+ V+  ++ + + 
Sbjct: 182 VILRRMHAYVHCIVPQFSQTDINFQRVPVVDTSNPFIARWIPTADESVVVIRFRNPRGID 241

Query: 711 YQDILKILD 719
           +  +  ++ 
Sbjct: 242 FPYLTSMIH 250
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Length = 174 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query899
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 100.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 100.0
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.97
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.97
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.94
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.93
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.87
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.81
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.8
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.77
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.76
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.75
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.75
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.69
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 99.66
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.65
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.55
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.52
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.47
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.46
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 99.06
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 99.03
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.0
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.96
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.94
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.93
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.83
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.82
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.75
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.73
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.69
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.68
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.67
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.65
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.62
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.61
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.6
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.59
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.57
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.57
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.56
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.48
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.48
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.48
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.44
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.44
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.44
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.43
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.42
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.41
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.39
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.35
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.35
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.33
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.33
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.29
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.28
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 98.27
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.26
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.26
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.26
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.24
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.23
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.16
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.16
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.15
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 98.15
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.08
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.03
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.03
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.03
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.03
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.01
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.0
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.99
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.99
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.97
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.97
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.94
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.89
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.87
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.86
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.84
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.83
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.83
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 97.82
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.82
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.79
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.79
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.76
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.74
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.69
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.69
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.64
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 97.64
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.64
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.62
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.6
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.58
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.56
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.53
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.52
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.47
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.43
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.27
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.27
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 97.26
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.26
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.24
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.23
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.21
d1vmaa2213 GTPase domain of the signal recognition particle r 97.18
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.17
d2qy9a2211 GTPase domain of the signal recognition particle r 97.16
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.15
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.12
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.11
d2qy9a2211 GTPase domain of the signal recognition particle r 97.03
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.02
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.99
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.99
d1vmaa2213 GTPase domain of the signal recognition particle r 96.96
d1okkd2207 GTPase domain of the signal recognition particle r 96.92
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.9
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.9
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 96.89
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.8
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.78
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.73
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.72
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.71
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.67
d1okkd2207 GTPase domain of the signal recognition particle r 96.66
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.63
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.6
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.56
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.55
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.51
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.45
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.42
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.4
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.36
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.36
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.35
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.27
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.25
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.24
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.22
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.18
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.14
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.12
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.08
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.02
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.01
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.0
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.97
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.94
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.92
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.91
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.9
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.88
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.85
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.8
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.79
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.78
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.75
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.75
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.74
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.74
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.72
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.72
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.71
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.7
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.7
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.7
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.67
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.64
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.64
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.57
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.55
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.53
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.49
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.46
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.45
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.45
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.44
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.43
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.43
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.42
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.36
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.36
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.36
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.33
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.29
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.25
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.22
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.22
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.15
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.06
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.02
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.01
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.96
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.96
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.94
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.85
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.85
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.85
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.85
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.83
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.79
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.79
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.76
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.71
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.67
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.62
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.49
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.48
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.46
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.43
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.42
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.35
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.27
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.24
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.05
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.04
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.87
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.74
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.69
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.54
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.53
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.4
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 93.4
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.3
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.25
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.25
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.24
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.1
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.89
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 92.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.77
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.77
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.46
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.4
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.3
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.27
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.23
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.21
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.14
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.05
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 92.04
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.9
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.89
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.74
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.71
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.7
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.61
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.56
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.48
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.43
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.36
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.34
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.3
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.22
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.18
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.14
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.08
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.08
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.02
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.94
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.82
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.8
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.7
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.67
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.66
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.51
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.51
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 90.49
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.49
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.49
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.44
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.29
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.19
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.13
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.91
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.79
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 89.73
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.69
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.6
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.59
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.57
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.54
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 89.44
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 89.44
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 89.43
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.36
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.35
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.33
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.22
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.19
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.15
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.1
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.08
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.05
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.98
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.96
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.9
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.9
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 88.88
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.81
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 88.76
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 88.72
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.71
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.68
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.57
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.53
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.52
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.52
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 88.49
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.47
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.46
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.44
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.4
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 88.38
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.32
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.29
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.23
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.23
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 88.16
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.15
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.1
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 88.08
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.93
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.92
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.87
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.84
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 87.79
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.76
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 87.69
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 87.67
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 87.65
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.6
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.59
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.57
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.52
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.48
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.48
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 87.45
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.27
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 87.24
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.2
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 87.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.03
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 87.03
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.01
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.0
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 87.0
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.92
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.86
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 86.84
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.79
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.51
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.41
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.35
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 86.31
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 86.12
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 86.09
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.04
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.93
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 85.8
d2fh5b1207 Signal recognition particle receptor beta-subunit 85.77
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 85.64
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.59
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.55
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 85.54
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 85.54
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 85.54
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 85.47
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.44
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.42
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.41
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.33
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 85.27
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 85.26
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.24
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.2
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 85.17
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.09
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.96
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 84.95
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 84.93
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 84.77
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 84.64
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 84.63
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 84.61
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 84.54
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 84.47
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 84.47
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.45
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 84.44
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.42
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 84.4
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.38
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 84.31
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 84.22
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.16
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 84.0
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.99
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.9
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.72
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 83.56
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 83.35
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 83.32
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.3
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 83.21
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 83.15
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 83.14
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 83.02
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.96
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.89
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 82.78
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.66
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 82.52
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.41
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 82.35
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 82.14
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 82.05
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.84
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 81.77
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.42
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.13
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 80.96
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 80.87
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 80.82
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 80.61
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 80.22
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.9e-35  Score=248.55  Aligned_cols=233  Identities=15%  Similarity=0.184  Sum_probs=179.7

Q ss_pred             CCCCCCCCEECCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCHH----------HHHHHHHHHHHH---------HCC
Q ss_conf             4222233100345888678753358876662100017998410024----------589999999998---------728
Q 002620          454 MEPVLATWHFISSDPSHAGSSVIGSSSFRDTVKLVPMPDSYDFDRG----------LLLSVQAIQALL---------ENK  514 (899)
Q Consensus       454 ~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~e~----------~~~~i~~i~~l~---------~~~  514 (899)
                      .+.+..+|+.++.+.++++|+       .+--.+.++.+.++..|.          +.+.+++.+.+.         ...
T Consensus         5 ~~~~~~~w~~l~~~~~~~l~~-------~~~~~~~~~~~~~~~~~v~~iylpl~~l~~~~~~~~~~~~~~~~~fl~~~~~   77 (308)
T d1sq5a_           5 LQFDRNQWAALRDSVPMTLSE-------DEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQ   77 (308)
T ss_dssp             EEEEHHHHHHTCC---C-CCH-------HHHHHHHHHCTTCCHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTCC-C
T ss_pred             CEECHHHHHHHCCCCCCCCCH-------HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             550899998654589988999-------9999872778766699999999999999999999999999999998534478


Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHC-------CCCCCCCCCCCHHHC-----CCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9988994308888538999999998929-------931045441130100-----1246789561119999999998864
Q 002620          515 GLPVIVGIGGPSGSGKTSLAHKMANIVG-------CEVVSLESYFKSEQV-----KDFKYDDFSSLDLSLLSKNISDIRN  582 (899)
Q Consensus       515 ~~~~iIGI~G~sGSGKTTla~~L~~~l~-------~~vislDdfy~~~~~-----~~~~~d~p~t~D~~lL~~~L~~L~~  582 (899)
                      +.|++|||+|++||||||+|+.|+..|.       +.++|+||||++.+.     ...+++.|++||+++|.++|..+++
T Consensus        78 k~P~iIGIaG~sgSGKSTla~~L~~lL~~~~~~~~v~~Is~D~F~~~~~~l~~~~~~~~~g~Pes~D~~~L~~~L~~lk~  157 (308)
T d1sq5a_          78 RIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKS  157 (308)
T ss_dssp             CCCEEEEEEECTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHHTCTTCTTSGGGBCHHHHHHHHHHHTT
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             99889999689999876899999999730468996599952156898458888368766881676319999999999975


Q ss_pred             CC-CEECCCCCCCCCCCCCCCCEEECCCCCEEEEEEECCCCH-H----------HHHCCCEEEEEECCCHHHHHHHHHCC
Q ss_conf             99-410244562235457864202216872899992114506-5----------65019879999949046578986507
Q 002620          583 GR-RTKVPIFDLETGARSGFKELEVSEDCGVIIFEGVYALHP-E----------IRKSLDLWIAVVGGVHSHLISRVQRD  650 (899)
Q Consensus       583 g~-~v~~P~yD~~~~dr~~~~~~~~~~~~dVVIvEG~~~~~~-~----------l~~~~D~~I~v~~~~d~rL~Rri~RD  650 (899)
                      |+ .+.+|.||+.++++.+.. .....+.+|||+||++++.+ .          +++++|++||++++.+.++.|++.|+
T Consensus       158 g~~~v~~P~yd~~~~d~~~~~-~~~~~~~dIlIvEGi~vL~~~~~~~~~~~~~~l~d~~D~~Ifvda~~~~~~~r~i~R~  236 (308)
T d1sq5a_         158 GVPNVTAPVYSHLIYDVIPDG-DKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRF  236 (308)
T ss_dssp             TCSCEEECCEETTTTEECTTC-CEEEC-CCEEEEECTTTTCCGGGCTTSCCSSCGGGGCSEEEEEECCHHHHHHHHHHHH
T ss_pred             CCCCCEEECCCHHHCCCCCCC-CEEECCCCEEEECCHHHCCCCCCCCCCCCCCHHHHHHHEEEEECCCHHHHHHHHHHHH
T ss_conf             998642105300102557787-3682799989970402115743332222310002112223321599999999998788


Q ss_pred             CCCCCCCCCH--------------------HHHHH-HCCCHHHHHCCCCCCCCCEEECCCCCCCC
Q ss_conf             4222544433--------------------23775-20303553014556755299819999877
Q 002620          651 KSRMGCFMSQ--------------------NDIMM-TVFPMFQQHIEPHLVHAHLKIRNDFDPVL  694 (899)
Q Consensus       651 ~~~rg~~~~~--------------------~q~~~-~v~p~~~~~I~p~~~~ADivI~n~~~~rl  694 (899)
                      ...+|.+...                    .++|. ...|++.+||.|++..||+||+.+.+..+
T Consensus       237 ~~~r~~a~~d~~~~~~~y~~~~~~ea~~~a~~~w~~i~~~nl~~~I~Ptk~rADlIi~~~~dh~v  301 (308)
T d1sq5a_         237 LKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAV  301 (308)
T ss_dssp             HHHHHTTTTCTTSTTHHHHTSCHHHHHHHHHHHHHHTHHHHHHHTTGGGGGGCSEEEEECGGGCE
T ss_pred             HHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHCCCCHHCCEEEEECCCCCCE
T ss_conf             88750111276889998840689999999999998702221877374544323699975999707
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure