Citrus Sinensis ID: 002623

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MAARASLSGVSLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS
ccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHcccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHcHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHccccccccccccHHHHHHHHHcccHHHHcccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccHHcHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccEEcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccHHHHcccccEEEEcHHHccccccHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHccccHHHcccccccccEEEcccccccccccccccc
cccEEEccccEEEEcccccccccEEccccccccccccccccccccccccccccccccccccccccccccEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHcccEccccccEEccHHHHHHHHHHHHHHHHccccEHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHcccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHEEccccccccccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHcHHEcccccHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHccHcHHcccccHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHcccHHcEEEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHHcccccccccccEEEcEcEEEEEEcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHcccccccccEccc
maaraslsgvslctpppsqkrnvvvfgqpqcllsfptranffkglnfnsvqlkkrnglfskghdKLFLIRCEatsgritqqdfTDMAWQAIVsspdvakenkHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGrqsvidqdpegKYEALEKYGKDLTAmasagkldpvigrddEIRRCIQILSRrtknnpvligepgvgKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVvgagatngamdagnllkpmlgrgelrcigATTLDEYRKYIEKDPALERRFQQvyvdqpnveDTISILRGLRERYelhhgvrisdsALVEAAILSdryisgrflpdkAIDLVDEAAAKLKMEitskptaldEINRSVLKLEMERLsltndtdkASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKsmlreevtgsDIAEIVSkwtgipvsklqQSEREKLLHLEEELHKrvvgqdpavKSVAEAIQRsraglsdphrpiasfmfmgptgvgKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRligappgyvgyeeggqltevvrrrpyAVILFDEIEKAHSDVFNVFLQIlddgrvtdsqgrtvSFTNTVIIMTSNVgsqyilnmddetfpkeTAYETIKQRVMDAARSIfrpefmnrvdeyivfqpldrdqiSSIVRLQVSFSKVswiyspwhFNYEMLVKFCYLAFTIRSIVS
maaraslsgvslctpppsqKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEkfiqrqpkvlgetagsmlgRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIeairgrqsvidqdpegKYEALEKYGKDLTAMASagkldpvigrddEIRRCIQilsrrtknnpvligEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERrfqqvyvdqpnveDTISILRGLRERYELHHgvrisdsalvEAAILSDRYISGRFLPDKAIDLVDEAAAKLKmeitskptaldeiNRSVLKLEMErlsltndtdkaskdRLNRLEAELSLLKERQAQlteqwehektvmTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISsgksmlreevTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELhkrvvgqdpavKSVAEAIQrsraglsdphrpIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILddgrvtdsqgrtvSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS
MAARASLSGVSLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSerekllhleeelhkrVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS
*********************NVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVI*********ALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEI*************************************************************TVMTRIQSIKEEIDRVNLEIQQ***EYDLNRAAELKYG*********************************SDIAEIVSKWTGIPV*************************************************IASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSI**
***********LCT****************************************************************TQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQR**************RDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRG***********KYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMER****************************************************IDRVNLEIQQAEREYDLNRAAELKYGSLNALQ***********************EVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMD***********TIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIV*
**********SLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS
****ASLSGVSLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNS***************KLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYI**GKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARASLSGVSLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATSGRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxWEHEKTVMTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query899 2.2.26 [Sep-21-2011]
Q9LF37968 Chaperone protein ClpB3, yes no 0.937 0.870 0.855 0.0
Q75GT3978 Chaperone protein ClpB2, yes no 0.887 0.815 0.870 0.0
Q0E3C8983 Chaperone protein ClpB3, no no 0.899 0.822 0.723 0.0
Q8VYJ7964 Chaperone protein ClpB4, no no 0.892 0.831 0.709 0.0
Q8YM56872 Chaperone protein ClpB 2 yes no 0.865 0.892 0.710 0.0
Q8DJ40871 Chaperone protein ClpB 1 yes no 0.858 0.886 0.727 0.0
Q7NFE9872 Chaperone protein ClpB OS yes no 0.867 0.894 0.706 0.0
P53533874 Chaperone protein ClpB 1 yes no 0.902 0.927 0.68 0.0
O87444873 Chaperone protein ClpB OS N/A no 0.863 0.888 0.706 0.0
P74361872 Chaperone protein ClpB 2 N/A no 0.865 0.892 0.692 0.0
>sp|Q9LF37|CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana GN=CLPB3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1488 bits (3853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/851 (85%), Positives = 790/851 (92%), Gaps = 8/851 (0%)

Query: 18  SQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKGHDKLFLIRCEATS-- 75
           ++ R +  F   Q   +FP + + FK     S++LK+   L  +   + F++RCEA+S  
Sbjct: 20  TETRRIYSFSHLQPSAAFPAKPSSFK-----SLKLKQSARLTRRLDHRPFVVRCEASSSN 74

Query: 76  GRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNT 135
           GR+TQQ+FT+MAWQ+IVSSPDVAKENK QIVETEHL+KALLEQKNGLARRIFSK+GVDNT
Sbjct: 75  GRLTQQEFTEMAWQSIVSSPDVAKENKQQIVETEHLMKALLEQKNGLARRIFSKIGVDNT 134

Query: 136 RLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQD 195
           ++LEATEKFIQRQPKV G+ AGSMLGRDLEAL QR+R++KK+  DS+VSVEHLVL F  D
Sbjct: 135 KVLEATEKFIQRQPKVYGDAAGSMLGRDLEALFQRARQFKKDLKDSYVSVEHLVLAFADD 194

Query: 196 QRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLD 255
           +RFGKQLF+DFQIS  +LKSAIE+IRG+QSVIDQDPEGKYEALEKYGKDLTAMA  GKLD
Sbjct: 195 KRFGKQLFKDFQISERSLKSAIESIRGKQSVIDQDPEGKYEALEKYGKDLTAMAREGKLD 254

Query: 256 PVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLI 315
           PVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLI
Sbjct: 255 PVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLI 314

Query: 316 SLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNL 375
           SLDMGALIAGAKYRGEFEDRLKAVLKEVT+SEGQIILFIDEIHTVVGAGATNGAMDAGNL
Sbjct: 315 SLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILFIDEIHTVVGAGATNGAMDAGNL 374

Query: 376 LKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYE 435
           LKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP VEDTISILRGLRERYE
Sbjct: 375 LKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVEDTISILRGLRERYE 434

Query: 436 LHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRS 495
           LHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDE++RS
Sbjct: 435 LHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDELDRS 494

Query: 496 VLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEE 555
           V+KLEMERLSLTNDTDKAS++RLNR+E EL LLKE+QA+LTEQWEHE++VM+R+QSIKEE
Sbjct: 495 VIKLEMERLSLTNDTDKASRERLNRIETELVLLKEKQAELTEQWEHERSVMSRLQSIKEE 554

Query: 556 IDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGS 615
           IDRVNLEIQQAEREYDLNRAAELKYGSLN+LQRQL  AEKELNEY+SSGKSM REEV GS
Sbjct: 555 IDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLNEAEKELNEYLSSGKSMFREEVLGS 614

Query: 616 DIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDP 675
           DIAEIVSKWTGIPVSKLQQSER+KLLHLEEELHKRVVGQ+PAV +VAEAIQRSRAGLSDP
Sbjct: 615 DIAEIVSKWTGIPVSKLQQSERDKLLHLEEELHKRVVGQNPAVTAVAEAIQRSRAGLSDP 674

Query: 676 HRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYV 735
            RPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYV
Sbjct: 675 GRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYV 734

Query: 736 GYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVI 795
           GYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNVFLQILDDGRVTDSQGRTVSFTNTVI
Sbjct: 735 GYEEGGQLTETVRRRPYSVILFDEIEKAHGDVFNVFLQILDDGRVTDSQGRTVSFTNTVI 794

Query: 796 IMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRD 855
           IMTSNVGSQ+ILN  D+    E +YETIK+RVM+AARSIFRPEFMNRVDEYIVF+PLDR+
Sbjct: 795 IMTSNVGSQFILNNTDDD-ANELSYETIKERVMNAARSIFRPEFMNRVDEYIVFKPLDRE 853

Query: 856 QISSIVRLQVS 866
           QI+ IVRLQ++
Sbjct: 854 QINRIVRLQLA 864
Molecular chaperone essential for chloroplast development and seedling viability. Mediates internal thylakoid membrane formation and confers thermotolerance to chloroplasts during heat stress.
Arabidopsis thaliana (taxid: 3702)
>sp|Q75GT3|CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPB2 PE=2 SV=1 Back     alignment and function description
>sp|Q0E3C8|CLPB3_ORYSJ Chaperone protein ClpB3, mitochondrial OS=Oryza sativa subsp. japonica GN=CLPB3 PE=2 SV=3 Back     alignment and function description
>sp|Q8VYJ7|CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana GN=CLPB4 PE=1 SV=1 Back     alignment and function description
>sp|Q8YM56|CLPB2_NOSS1 Chaperone protein ClpB 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpB2 PE=3 SV=2 Back     alignment and function description
>sp|Q8DJ40|CLPB1_THEEB Chaperone protein ClpB 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB1 PE=3 SV=1 Back     alignment and function description
>sp|Q7NFE9|CLPB_GLOVI Chaperone protein ClpB OS=Gloeobacter violaceus (strain PCC 7421) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|P53533|CLPB1_SYNE7 Chaperone protein ClpB 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB1 PE=2 SV=3 Back     alignment and function description
>sp|O87444|CLPB_PLEBO Chaperone protein ClpB OS=Plectonema boryanum GN=clpB PE=2 SV=2 Back     alignment and function description
>sp|P74361|CLPB2_SYNY3 Chaperone protein ClpB 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpB2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
356568712974 PREDICTED: chaperone protein ClpB3, chlo 0.919 0.849 0.904 0.0
356523596974 PREDICTED: chaperone protein ClpB3, chlo 0.933 0.861 0.896 0.0
225452950976 PREDICTED: chaperone protein ClpB3, chlo 0.953 0.878 0.886 0.0
357496641974 Chaperone protein clpB [Medicago truncat 0.915 0.844 0.9 0.0
357502203 1034 Chaperone protein clpB [Medicago truncat 0.880 0.765 0.938 0.0
224077716967 predicted protein [Populus trichocarpa] 0.923 0.858 0.890 0.0
356573524978 PREDICTED: chaperone protein ClpB3, chlo 0.958 0.881 0.869 0.0
255570232973 chaperone clpb, putative [Ricinus commun 0.945 0.873 0.874 0.0
356551074978 PREDICTED: chaperone protein ClpB3, chlo 0.958 0.881 0.870 0.0
350534488980 heat shock protein [Solanum lycopersicum 0.959 0.880 0.861 0.0
>gi|356568712|ref|XP_003552554.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score = 1552 bits (4019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/841 (90%), Positives = 803/841 (95%), Gaps = 14/841 (1%)

Query: 33  LSF--PTRANFFKGLNFNSVQLKKRNGLFSKGHDKL------FLIRCEATSGRITQQDFT 84
           LSF  P      + L FN     KR+  F+ G  ++      F++RCEA+SGRITQQ+FT
Sbjct: 32  LSFAKPISLKPLQSLPFN-----KRHP-FANGFQRIRRNSSPFIVRCEASSGRITQQEFT 85

Query: 85  DMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKF 144
           +MAWQAIVSSP+VAKENKHQIVETEHL+KALLEQKNGLARRIFSKVGVDNTRLLEAT+K+
Sbjct: 86  EMAWQAIVSSPEVAKENKHQIVETEHLMKALLEQKNGLARRIFSKVGVDNTRLLEATDKY 145

Query: 145 IQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQLFR 204
           IQRQPKVLGE++GSMLGRDLEALIQR+R++KK+YGDSFVSVEHLVL FTQDQRFGKQ FR
Sbjct: 146 IQRQPKVLGESSGSMLGRDLEALIQRARDHKKKYGDSFVSVEHLVLAFTQDQRFGKQFFR 205

Query: 205 DFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDDEI 264
           DFQIS P LKSAIE++RGRQSVIDQDPEGKYEALEKYGKDLTAMA AGKLDPVIGRDDEI
Sbjct: 206 DFQISEPALKSAIESVRGRQSVIDQDPEGKYEALEKYGKDLTAMAKAGKLDPVIGRDDEI 265

Query: 265 RRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIA 324
           RRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALM+R+LISLDMGALIA
Sbjct: 266 RRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMDRRLISLDMGALIA 325

Query: 325 GAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGE 384
           GAKYRGEFEDRLKAVLKEVTES+GQ ILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGE
Sbjct: 326 GAKYRGEFEDRLKAVLKEVTESDGQTILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGE 385

Query: 385 LRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISD 444
           LRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP VEDTISILRGLRERYELHHGVRISD
Sbjct: 386 LRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVEDTISILRGLRERYELHHGVRISD 445

Query: 445 SALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERL 504
           SALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERL
Sbjct: 446 SALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERL 505

Query: 505 SLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQ 564
           SL NDTDKASKDRLNRLEAELSLLKE+QA+LTEQWEHEK+VMTRIQSIKEEIDRVNLEIQ
Sbjct: 506 SLMNDTDKASKDRLNRLEAELSLLKEKQAELTEQWEHEKSVMTRIQSIKEEIDRVNLEIQ 565

Query: 565 QAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKW 624
           QAEREYDLNRAAELKYGSLN+LQRQLESAEKEL+EY++SGKSMLREEVTG+DIAEIVSKW
Sbjct: 566 QAEREYDLNRAAELKYGSLNSLQRQLESAEKELDEYMNSGKSMLREEVTGNDIAEIVSKW 625

Query: 625 TGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMF 684
           TGIPVSKLQQSEREKLLHLEE LHKRVVGQDPAVK++AEAIQRSRAGLSDPHRPIASFMF
Sbjct: 626 TGIPVSKLQQSEREKLLHLEEVLHKRVVGQDPAVKAIAEAIQRSRAGLSDPHRPIASFMF 685

Query: 685 MGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLT 744
           MGPTGVGKTELAKALA+Y+FNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLT
Sbjct: 686 MGPTGVGKTELAKALAAYLFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLT 745

Query: 745 EVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQ 804
           E+VRRRPYAVILFDEIEKAH+DVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQ
Sbjct: 746 EIVRRRPYAVILFDEIEKAHADVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQ 805

Query: 805 YILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQ 864
           YILN DD+T PKE AYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDR+QISSIVRLQ
Sbjct: 806 YILNTDDDTTPKELAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDREQISSIVRLQ 865

Query: 865 V 865
           +
Sbjct: 866 L 866

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356523596|ref|XP_003530423.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225452950|ref|XP_002284243.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357496641|ref|XP_003618609.1| Chaperone protein clpB [Medicago truncatula] gi|355493624|gb|AES74827.1| Chaperone protein clpB [Medicago truncatula] Back     alignment and taxonomy information
>gi|357502203|ref|XP_003621390.1| Chaperone protein clpB [Medicago truncatula] gi|355496405|gb|AES77608.1| Chaperone protein clpB [Medicago truncatula] Back     alignment and taxonomy information
>gi|224077716|ref|XP_002305376.1| predicted protein [Populus trichocarpa] gi|222848340|gb|EEE85887.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573524|ref|XP_003554908.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255570232|ref|XP_002526076.1| chaperone clpb, putative [Ricinus communis] gi|223534573|gb|EEF36270.1| chaperone clpb, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356551074|ref|XP_003543903.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|350534488|ref|NP_001234143.1| heat shock protein [Solanum lycopersicum] gi|68989120|dbj|BAE06227.1| heat shock protein [Solanum lycopersicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
TAIR|locus:2180922968 CLPB3 "casein lytic proteinase 0.951 0.883 0.830 0.0
UNIPROTKB|Q75GT3978 CLPB2 "Chaperone protein ClpB2 0.887 0.815 0.854 0.0
UNIPROTKB|Q0E3C8983 CLPB3 "Chaperone protein ClpB3 0.899 0.822 0.709 4.1e-310
TAIR|locus:2040159964 CLPB4 "casein lytic proteinase 0.916 0.854 0.681 4.2e-301
TIGR_CMR|BA_1177866 BA_1177 "ATP-dependent Clp pro 0.859 0.892 0.570 6.4e-234
TIGR_CMR|GSU_0658865 GSU_0658 "ClpB protein" [Geoba 0.873 0.907 0.549 7e-228
GENEDB_PFALCIPARUM|PF08_00631070 PF08_0063 "ClpB protein, putat 0.512 0.430 0.559 1.4e-227
UNIPROTKB|Q8IB031070 PF08_0063 "ClpB protein, putat 0.512 0.430 0.559 1.4e-227
TIGR_CMR|SPO_3276872 SPO_3276 "ATP-dependent Clp pr 0.859 0.886 0.530 1.5e-216
UNIPROTKB|Q9KU18857 clpB "Chaperone protein ClpB" 0.859 0.901 0.540 4e-216
TAIR|locus:2180922 CLPB3 "casein lytic proteinase B3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3568 (1261.1 bits), Expect = 0., P = 0.
 Identities = 719/866 (83%), Positives = 781/866 (90%)

Query:     3 ARASLSGVSLCTPPPSQKRNVVVFGQPQCLLSFPTRANFFKGLNFNSVQLKKRNGLFSKG 62
             A A+ SGV       ++ R +  F   Q   +FP + + FK     S++LK+   L  + 
Sbjct:     8 ATAAFSGV---VSVGTETRRIYSFSHLQPSAAFPAKPSSFK-----SLKLKQSARLTRRL 59

Query:    63 HDKLFLIRCEATS--GRITQQDFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKN 120
               + F++RCEA+S  GR+TQQ+FT+MAWQ+IVSSPDVAKENK QIVETEHL+KALLEQKN
Sbjct:    60 DHRPFVVRCEASSSNGRLTQQEFTEMAWQSIVSSPDVAKENKQQIVETEHLMKALLEQKN 119

Query:   121 GLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGD 180
             GLARRIFSK+GVDNT++LEATEKFIQRQPKV G+ AGSMLGRDLEAL QR+R++KK+  D
Sbjct:   120 GLARRIFSKIGVDNTKVLEATEKFIQRQPKVYGDAAGSMLGRDLEALFQRARQFKKDLKD 179

Query:   181 SFVSVEHLVLGFTQDQRFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEK 240
             S+VSVEHLVL F  D+RFGKQLF+DFQIS  +LKSAIE+IRG+QSVIDQDPEGKYEALEK
Sbjct:   180 SYVSVEHLVLAFADDKRFGKQLFKDFQISERSLKSAIESIRGKQSVIDQDPEGKYEALEK 239

Query:   241 YGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRI 300
             YGKDLTAMA  GKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRI
Sbjct:   240 YGKDLTAMAREGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRI 299

Query:   301 VQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTV 360
             VQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVT+SEGQIILFIDEIHTV
Sbjct:   300 VQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILFIDEIHTV 359

Query:   361 VGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNV 420
             VGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP V
Sbjct:   360 VGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTV 419

Query:   421 EDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKM 480
             EDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKM
Sbjct:   420 EDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKM 479

Query:   481 EITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWE 540
             EITSKPTALDE++RSV+KLEMERLSLTNDTDKAS++RLNR+E EL LLKE+QA+LTEQWE
Sbjct:   480 EITSKPTALDELDRSVIKLEMERLSLTNDTDKASRERLNRIETELVLLKEKQAELTEQWE 539

Query:   541 HEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEY 600
             HE++VM+R+QSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLN+LQRQL  AEKELNEY
Sbjct:   540 HERSVMSRLQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLNEAEKELNEY 599

Query:   601 ISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSXXXXXXXXXXXXXXXVVGQDPAVKS 660
             +SSGKSM REEV GSDIAEIVSKWTGIPVSKLQQS               VVGQ+PAV +
Sbjct:   600 LSSGKSMFREEVLGSDIAEIVSKWTGIPVSKLQQSERDKLLHLEEELHKRVVGQNPAVTA 659

Query:   661 VAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYME 720
             VAEAIQRSRAGLSDP RPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYME
Sbjct:   660 VAEAIQRSRAGLSDPGRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYME 719

Query:   721 KHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRV 780
             KHAVSRLIGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNVFLQILDDGRV
Sbjct:   720 KHAVSRLIGAPPGYVGYEEGGQLTETVRRRPYSVILFDEIEKAHGDVFNVFLQILDDGRV 779

Query:   781 TDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFM 840
             TDSQGRTVSFTNTVIIMTSNVGSQ+ILN  D+    E +YETIK+RVM+AARSIFRPEFM
Sbjct:   780 TDSQGRTVSFTNTVIIMTSNVGSQFILNNTDDD-ANELSYETIKERVMNAARSIFRPEFM 838

Query:   841 NRVDEYIVFQPLDRDQISSIVRLQVS 866
             NRVDEYIVF+PLDR+QI+ IVRLQ++
Sbjct:   839 NRVDEYIVFKPLDREQINRIVRLQLA 864
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0009408 "response to heat" evidence=IEA;IEP;ISS
GO:0016485 "protein processing" evidence=IEA
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0019538 "protein metabolic process" evidence=IEA
GO:0009532 "plastid stroma" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009658 "chloroplast organization" evidence=IMP
UNIPROTKB|Q75GT3 CLPB2 "Chaperone protein ClpB2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0E3C8 CLPB3 "Chaperone protein ClpB3, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2040159 CLPB4 "casein lytic proteinase B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1177 BA_1177 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0658 GSU_0658 "ClpB protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0063 PF08_0063 "ClpB protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IB03 PF08_0063 "ClpB protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3276 SPO_3276 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU18 clpB "Chaperone protein ClpB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8FM94CLPB_COREFNo assigned EC number0.54860.83310.8791yesno
Q72AW6CLPB_DESVHNo assigned EC number0.59310.85870.8924yesno
Q6MIV0CLPB_BDEBANo assigned EC number0.56320.86310.9076yesno
Q898C7CLPB_CLOTENo assigned EC number0.56490.85310.8867yesno
Q89YY3CLPB_BACTNNo assigned EC number0.54190.86540.9025yesno
Q98G96CLPB_RHILONo assigned EC number0.56310.84870.8790yesno
Q89UL2CLPB_BRAJANo assigned EC number0.55960.86310.8828yesno
Q74FF1CLPB_GEOSLNo assigned EC number0.57440.84200.8751yesno
Q7V8B1CLPB_PROMMNo assigned EC number0.66280.87090.9052yesno
Q9LF37CLPB3_ARATHNo assigned EC number0.85540.93770.8708yesno
Q81TT4CLPB_BACANNo assigned EC number0.58080.85870.8914yesno
O83110CLPB_TREPANo assigned EC number0.54910.87310.8940yesno
Q9A9T4CLPB_CAUCRNo assigned EC number0.54660.85870.8987yesno
Q929G7CLPB_LISINNo assigned EC number0.55660.86200.8949yesno
P74361CLPB2_SYNY3No assigned EC number0.69220.86540.8922N/Ano
P74459CLPB1_SYNY3No assigned EC number0.60850.86540.8663N/Ano
Q7NFE9CLPB_GLOVINo assigned EC number0.70660.86760.8944yesno
Q73T66CLPB_MYCPANo assigned EC number0.56060.81970.8691N/Ano
Q97KG0CLPB_CLOABNo assigned EC number0.56830.84640.8797yesno
Q8P6A0CLPB_XANCPNo assigned EC number0.54530.86420.9024yesno
Q7U637CLPB1_SYNPXNo assigned EC number0.65940.86980.9071yesno
Q8YM56CLPB2_NOSS1No assigned EC number0.71000.86540.8922yesno
Q826F2CLPB2_STRAWNo assigned EC number0.56960.86200.8816yesno
Q8VYJ7CLPB4_ARATHNo assigned EC number0.70910.89210.8319nono
Q75GT3CLPB2_ORYSJNo assigned EC number0.87090.88760.8159yesno
Q7NWN7CLPB_CHRVONo assigned EC number0.55320.85530.8952yesno
Q72IK9CLPB_THET2No assigned EC number0.58590.85310.8981yesno
Q81GM5CLPB_BACCRNo assigned EC number0.57700.85870.8914yesno
Q7VBL0CLPB_PROMANo assigned EC number0.58980.87090.9062yesno
Q7AMH5CLPB_SALTINo assigned EC number0.54700.85760.8996N/Ano
Q7X2S8CLPB_MEIRUNo assigned EC number0.57450.84870.8934yesno
Q8Y570CLPB_LISMONo assigned EC number0.56280.85980.8926yesno
Q8XZR0CLPB_RALSONo assigned EC number0.55850.85650.8932yesno
Q8RHQ8CLPB_FUSNNNo assigned EC number0.55030.88200.9253yesno
P44403CLPB_HAEINNo assigned EC number0.56030.85980.9030yesno
Q73BY1CLPB_BACC1No assigned EC number0.58080.85870.8914yesno
Q71XF9CLPB_LISMFNo assigned EC number0.56170.86200.8949yesno
Q73K92CLPB_TREDENo assigned EC number0.56190.86200.9022yesno
O87444CLPB_PLEBONo assigned EC number0.70610.86310.8888N/Ano
P53533CLPB1_SYNE7No assigned EC number0.680.90210.9279yesno
Q8DJ40CLPB1_THEEBNo assigned EC number0.72750.85870.8863yesno
Q0E3C8CLPB3_ORYSJNo assigned EC number0.72340.89980.8229nono
Q6N1H2CLPB_RHOPANo assigned EC number0.55710.86310.8828yesno
Q8PHQ4CLPB_XANACNo assigned EC number0.54520.86200.9001yesno
Q9RA63CLPB_THET8No assigned EC number0.58470.85310.8981yesno
G2K265CLPB_LISM4No assigned EC number0.56280.85980.8926yesno
Q7CQ01CLPB_SALTYNo assigned EC number0.54700.85760.8996yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00041061
hypothetical protein (967 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 0.0
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 0.0
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.0
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 1e-127
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 2e-96
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 2e-94
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 2e-91
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 4e-67
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 7e-22
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-17
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-13
pfam00004131 pfam00004, AAA, ATPase family associated with vari 1e-12
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 9e-12
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-10
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-08
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 5e-08
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-06
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-06
pfam13401124 pfam13401, AAA_22, AAA domain 1e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-05
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-05
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 3e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-04
TIGR00390 441 TIGR00390, hslU, ATP-dependent protease HslVU, ATP 4e-04
COG1220 444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 4e-04
PRK13342413 PRK13342, PRK13342, recombination factor protein R 4e-04
PRK01156895 PRK01156, PRK01156, chromosome segregation protein 5e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-04
PRK05201 443 PRK05201, hslU, ATP-dependent protease ATP-binding 6e-04
pfam13401124 pfam13401, AAA_22, AAA domain 0.001
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 0.001
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 0.001
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 0.001
PRK14970 367 PRK14970, PRK14970, DNA polymerase III subunits ga 0.002
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.003
TIGR03007498 TIGR03007, pepcterm_ChnLen, polysaccharide chain l 0.003
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information 
 Score = 1305 bits (3379), Expect = 0.0
 Identities = 492/784 (62%), Positives = 621/784 (79%), Gaps = 7/784 (0%)

Query: 83  FTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATE 142
           FT+   +A+ ++  +A    HQ +E EHLLKALL+Q+ GLARR+  K GV+   L +A E
Sbjct: 1   FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALE 60

Query: 143 KFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQL 202
           K +++ PKV G      L  +L  L+  + +  ++ GD F+S EHL+L    D+    +L
Sbjct: 61  KELEKLPKVSGPGGQVYLSPELNRLLNLAEKLAQKRGDEFISSEHLLLALLDDKGTLGKL 120

Query: 203 FRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDD 262
            ++   +   L++AI A+RG Q V   + E +YEALEKY +DLT  A  GKLDPVIGRD+
Sbjct: 121 LKEAGATADALEAAINAVRGGQKVTSANAEDQYEALEKYARDLTERAREGKLDPVIGRDE 180

Query: 263 EIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGAL 322
           EIRR IQ+LSRRTKNNPVLIGEPGVGKTAI EGLAQRIV GDVP++L N++L++LDMGAL
Sbjct: 181 EIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPESLKNKRLLALDMGAL 240

Query: 323 IAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGR 382
           IAGAKYRGEFE+RLKAVL EVT+SEGQIILFIDE+HT+VGAG   GAMDAGN+LKP L R
Sbjct: 241 IAGAKYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEGAMDAGNMLKPALAR 300

Query: 383 GELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRI 442
           GEL CIGATTLDEYRKYIEKD ALERRFQ V+VD+P VEDTISILRGL+ERYE+HHGVRI
Sbjct: 301 GELHCIGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILRGLKERYEVHHGVRI 360

Query: 443 SDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEME 502
           +D A+V AA LS RYI+ RFLPDKAIDL+DEAAA+++MEI SKP  LDE++R +++LE+E
Sbjct: 361 TDPAIVAAATLSHRYITDRFLPDKAIDLIDEAAARIRMEIDSKPEELDELDRRIIQLEIE 420

Query: 503 RLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLE 562
           R +L  + D+ASK+RL  LE EL+ L+E  A L EQW+ EK  +  IQ IKEEI++V LE
Sbjct: 421 REALKKEKDEASKERLEDLEKELAELEEEYADLEEQWKAEKAAIQGIQQIKEEIEQVRLE 480

Query: 563 IQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVS 622
           ++QAERE DL +AAEL+YG L  L+++L++AE +L E   +   +LREEVT  +IAE+VS
Sbjct: 481 LEQAEREGDLAKAAELQYGKLPELEKRLQAAEAKLGE--ETKPRLLREEVTAEEIAEVVS 538

Query: 623 KWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASF 682
           +WTGIPVSK+ + EREKLLH+EE LH+RVVGQD AV++V++AI+RSRAGLSDP+RPI SF
Sbjct: 539 RWTGIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSF 598

Query: 683 MFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQ 742
           +F+GPTGVGKTELAKALA ++F+ E+A+VRIDMSEYMEKH+V+RLIGAPPGYVGYEEGGQ
Sbjct: 599 LFLGPTGVGKTELAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQ 658

Query: 743 LTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVG 802
           LTE VRR+PY+V+LFDE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVIIMTSN+G
Sbjct: 659 LTEAVRRKPYSVVLFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLG 718

Query: 803 SQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVR 862
           SQ+I  +          YE +++ VM+  R+ FRPEF+NR+DE +VF PL R+QI+ IV 
Sbjct: 719 SQFIQEL-----AGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVVFHPLGREQIARIVE 773

Query: 863 LQVS 866
           +Q+ 
Sbjct: 774 IQLG 777

Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins [Protein fate, Protein folding and stabilization]. Length = 852
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 899
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.97
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.94
COG2204 464 AtoC Response regulator containing CheY-like recei 99.92
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.92
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.92
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.91
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.91
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.91
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.9
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.9
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.9
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.9
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.89
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.89
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.89
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.88
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.88
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.88
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.87
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.87
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 99.87
CHL00195489 ycf46 Ycf46; Provisional 99.87
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.85
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.85
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.85
CHL00095821 clpC Clp protease ATP binding subunit 99.85
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.84
PRK11608326 pspF phage shock protein operon transcriptional ac 99.84
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.83
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 99.83
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.83
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.83
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.83
PRK15424538 propionate catabolism operon regulatory protein Pr 99.82
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.82
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.82
COG1221 403 PspF Transcriptional regulators containing an AAA- 99.82
KOG2028554 consensus ATPase related to the helicase subunit o 99.82
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.81
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.81
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.81
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.81
CHL00195489 ycf46 Ycf46; Provisional 99.8
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.8
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.8
PRK13342413 recombination factor protein RarA; Reviewed 99.79
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.79
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.79
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.79
PRK03992389 proteasome-activating nucleotidase; Provisional 99.79
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.79
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.79
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.78
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.78
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.78
CHL00181287 cbbX CbbX; Provisional 99.78
CHL00181287 cbbX CbbX; Provisional 99.77
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.77
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.77
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.77
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.76
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.76
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.76
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.75
PLN03025319 replication factor C subunit; Provisional 99.75
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.75
PRK13341725 recombination factor protein RarA/unknown domain f 99.75
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.75
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.75
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.74
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.74
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.74
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.74
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.74
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.74
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.74
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.74
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.74
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.74
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.73
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.73
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.73
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.73
CHL00176638 ftsH cell division protein; Validated 99.73
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.73
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.73
PRK15115444 response regulator GlrR; Provisional 99.73
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.73
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.73
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.72
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.72
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.72
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.72
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.72
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.72
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.72
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.72
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.71
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.71
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.71
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.7
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.7
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.7
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.7
CHL002062281 ycf2 Ycf2; Provisional 99.7
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.69
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.69
PHA02544316 44 clamp loader, small subunit; Provisional 99.69
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.69
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.68
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.68
PRK10865857 protein disaggregation chaperone; Provisional 99.68
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.68
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.68
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.68
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 99.68
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.67
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.67
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.67
PRK03992389 proteasome-activating nucleotidase; Provisional 99.67
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.67
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 99.67
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.66
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.66
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.66
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.66
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.66
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.66
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.66
PRK04195482 replication factor C large subunit; Provisional 99.65
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.65
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.65
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.65
PRK12402337 replication factor C small subunit 2; Reviewed 99.65
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.64
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.64
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.64
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.64
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.64
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.63
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.63
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.63
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.62
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.62
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.62
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.62
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.62
PF00004132 AAA: ATPase family associated with various cellula 99.61
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.61
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.61
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.61
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.61
PRK00440319 rfc replication factor C small subunit; Reviewed 99.61
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.6
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.6
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.6
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.6
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.59
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.59
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.59
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.59
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.59
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.59
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.59
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.58
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.58
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.58
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.58
PLN03025 319 replication factor C subunit; Provisional 99.57
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.57
PRK04132 846 replication factor C small subunit; Provisional 99.57
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.57
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.57
CHL00176 638 ftsH cell division protein; Validated 99.56
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.56
PHA02244383 ATPase-like protein 99.56
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.55
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.55
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.55
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.55
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.55
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.55
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.55
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.54
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.54
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.54
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.53
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.53
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.53
PRK08084235 DNA replication initiation factor; Provisional 99.53
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.53
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.52
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.52
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.52
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.52
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.52
PHA02544 316 44 clamp loader, small subunit; Provisional 99.52
PRK13531 498 regulatory ATPase RavA; Provisional 99.51
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.51
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.51
PRK13342 413 recombination factor protein RarA; Reviewed 99.51
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.51
COG0714329 MoxR-like ATPases [General function prediction onl 99.51
PRK07940394 DNA polymerase III subunit delta'; Validated 99.5
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.5
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.5
PTZ001121164 origin recognition complex 1 protein; Provisional 99.49
PRK13341 725 recombination factor protein RarA/unknown domain f 99.49
CHL00206 2281 ycf2 Ycf2; Provisional 99.49
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.48
PRK06893229 DNA replication initiation factor; Validated 99.48
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.48
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.48
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.47
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.47
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.47
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.47
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.46
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.46
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.46
KOG2028 554 consensus ATPase related to the helicase subunit o 99.46
PRK12402 337 replication factor C small subunit 2; Reviewed 99.46
PRK04195 482 replication factor C large subunit; Provisional 99.45
PRK07399314 DNA polymerase III subunit delta'; Validated 99.45
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.45
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.44
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.44
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK09112351 DNA polymerase III subunit delta'; Validated 99.44
PRK05642234 DNA replication initiation factor; Validated 99.44
PF00004132 AAA: ATPase family associated with various cellula 99.44
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.43
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.43
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.42
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.42
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.42
PF07726131 AAA_3: ATPase family associated with various cellu 99.42
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.42
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.41
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.41
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.41
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.4
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.4
PRK09862506 putative ATP-dependent protease; Provisional 99.39
PRK05564 313 DNA polymerase III subunit delta'; Validated 99.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.39
PRK07471365 DNA polymerase III subunit delta'; Validated 99.39
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.39
PRK09112 351 DNA polymerase III subunit delta'; Validated 99.39
PRK08727233 hypothetical protein; Validated 99.39
PRK00149450 dnaA chromosomal replication initiation protein; R 99.39
PRK07471 365 DNA polymerase III subunit delta'; Validated 99.39
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.38
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.38
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.38
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.37
COG4650 531 RtcR Sigma54-dependent transcription regulator con 99.37
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 99.36
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.36
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.36
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.36
PRK00440 319 rfc replication factor C small subunit; Reviewed 99.35
PRK08058 329 DNA polymerase III subunit delta'; Validated 99.35
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.34
PRK06620214 hypothetical protein; Validated 99.34
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.34
smart00350509 MCM minichromosome maintenance proteins. 99.33
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.33
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.33
PRK12422445 chromosomal replication initiation protein; Provis 99.32
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.32
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.31
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.31
PRK14088440 dnaA chromosomal replication initiation protein; P 99.3
PRK06871 325 DNA polymerase III subunit delta'; Validated 99.3
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.3
PRK05564313 DNA polymerase III subunit delta'; Validated 99.3
KOG2035 351 consensus Replication factor C, subunit RFC3 [Cell 99.3
COG2204464 AtoC Response regulator containing CheY-like recei 99.29
PRK09087226 hypothetical protein; Validated 99.29
PRK14086617 dnaA chromosomal replication initiation protein; P 99.29
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.29
COG1221403 PspF Transcriptional regulators containing an AAA- 99.29
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.29
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.29
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.29
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.29
PRK08769319 DNA polymerase III subunit delta'; Validated 99.28
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 99.28
PRK14087450 dnaA chromosomal replication initiation protein; P 99.28
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 99.28
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.27
PRK07399314 DNA polymerase III subunit delta'; Validated 99.27
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.27
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.27
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.27
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.27
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.27
PRK13531498 regulatory ATPase RavA; Provisional 99.27
PRK04132846 replication factor C small subunit; Provisional 99.27
PRK11608326 pspF phage shock protein operon transcriptional ac 99.26
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.26
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 99.25
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.24
PRK06964 342 DNA polymerase III subunit delta'; Validated 99.24
PRK06090 319 DNA polymerase III subunit delta'; Validated 99.24
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.24
PRK07993 334 DNA polymerase III subunit delta'; Validated 99.24
PRK05707 328 DNA polymerase III subunit delta'; Validated 99.24
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.24
KOG1969877 consensus DNA replication checkpoint protein CHL12 99.23
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.23
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.22
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.22
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.22
PHA02244383 ATPase-like protein 99.22
PRK06893229 DNA replication initiation factor; Validated 99.22
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.22
COG0714329 MoxR-like ATPases [General function prediction onl 99.22
PRK13765 637 ATP-dependent protease Lon; Provisional 99.21
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.2
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.2
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.2
PRK15424538 propionate catabolism operon regulatory protein Pr 99.19
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.18
PRK08058329 DNA polymerase III subunit delta'; Validated 99.18
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.17
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 99.17
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.17
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.16
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.16
PRK08084235 DNA replication initiation factor; Provisional 99.16
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.15
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.15
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.15
PRK08727233 hypothetical protein; Validated 99.15
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.14
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.14
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.14
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.14
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.13
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.13
PRK05707328 DNA polymerase III subunit delta'; Validated 99.12
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.1
PRK08769319 DNA polymerase III subunit delta'; Validated 99.1
PRK05642234 DNA replication initiation factor; Validated 99.09
PRK05917290 DNA polymerase III subunit delta'; Validated 99.08
PF07726131 AAA_3: ATPase family associated with various cellu 99.08
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.07
COG0593408 DnaA ATPase involved in DNA replication initiation 99.07
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.06
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.05
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.05
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.03
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.03
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.03
PRK08699 325 DNA polymerase III subunit delta'; Validated 99.02
PRK07993334 DNA polymerase III subunit delta'; Validated 99.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.0
PRK12422 445 chromosomal replication initiation protein; Provis 99.0
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.0
smart00350509 MCM minichromosome maintenance proteins. 99.0
PRK06871325 DNA polymerase III subunit delta'; Validated 99.0
PRK07276290 DNA polymerase III subunit delta'; Validated 99.0
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.99
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.98
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.96
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.96
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 98.96
PRK06964342 DNA polymerase III subunit delta'; Validated 98.96
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.95
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.95
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.93
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.93
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.93
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.92
PRK12377248 putative replication protein; Provisional 98.92
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.92
PRK14087 450 dnaA chromosomal replication initiation protein; P 98.91
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 98.91
PRK06090319 DNA polymerase III subunit delta'; Validated 98.9
PRK05818261 DNA polymerase III subunit delta'; Validated 98.89
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.88
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.86
PRK08116268 hypothetical protein; Validated 98.86
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.86
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.85
PRK07132 299 DNA polymerase III subunit delta'; Validated 98.85
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.85
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.83
PRK13765637 ATP-dependent protease Lon; Provisional 98.81
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 98.81
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.8
PRK09087226 hypothetical protein; Validated 98.8
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.8
PRK06620214 hypothetical protein; Validated 98.8
smart00382148 AAA ATPases associated with a variety of cellular 98.78
PRK08699325 DNA polymerase III subunit delta'; Validated 98.76
PRK08181269 transposase; Validated 98.76
PRK09862506 putative ATP-dependent protease; Provisional 98.75
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.75
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.75
PF13173128 AAA_14: AAA domain 98.74
KOG0478 804 consensus DNA replication licensing factor, MCM4 c 98.73
PRK15115444 response regulator GlrR; Provisional 98.73
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.72
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.72
smart00382148 AAA ATPases associated with a variety of cellular 98.72
PRK15455 644 PrkA family serine protein kinase; Provisional 98.71
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.71
COG1241 682 MCM2 Predicted ATPase involved in replication cont 98.68
PRK08116268 hypothetical protein; Validated 98.68
PRK06526254 transposase; Provisional 98.68
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.67
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.65
PRK07952244 DNA replication protein DnaC; Validated 98.64
PRK06835329 DNA replication protein DnaC; Validated 98.63
PRK12377248 putative replication protein; Provisional 98.61
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.61
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.59
PRK05917290 DNA polymerase III subunit delta'; Validated 98.55
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.55
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.55
PRK06581263 DNA polymerase III subunit delta'; Validated 98.5
PF13173128 AAA_14: AAA domain 98.5
PRK07952244 DNA replication protein DnaC; Validated 98.5
PRK09183259 transposase/IS protein; Provisional 98.49
COG0593 408 DnaA ATPase involved in DNA replication initiation 98.49
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.48
PRK08181269 transposase; Validated 98.45
PRK07132299 DNA polymerase III subunit delta'; Validated 98.44
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.43
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.42
PF05729166 NACHT: NACHT domain 98.42
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.41
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.41
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 98.38
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.38
KOG0481 729 consensus DNA replication licensing factor, MCM5 c 98.38
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.38
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.37
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.36
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.36
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 98.35
PRK06921266 hypothetical protein; Provisional 98.34
PRK07276290 DNA polymerase III subunit delta'; Validated 98.34
PRK06835329 DNA replication protein DnaC; Validated 98.33
PHA00729226 NTP-binding motif containing protein 98.32
PRK08939306 primosomal protein DnaI; Reviewed 98.32
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.31
KOG0477 854 consensus DNA replication licensing factor, MCM2 c 98.29
PRK05818261 DNA polymerase III subunit delta'; Validated 98.29
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.27
PRK06526254 transposase; Provisional 98.26
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.23
PF05729166 NACHT: NACHT domain 98.22
PRK06921266 hypothetical protein; Provisional 98.21
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.21
PRK15455644 PrkA family serine protein kinase; Provisional 98.2
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.19
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.17
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.17
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.16
KOG0482 721 consensus DNA replication licensing factor, MCM7 c 98.16
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 98.16
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.16
PRK08939306 primosomal protein DnaI; Reviewed 98.15
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.14
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.1
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.09
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.07
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-122  Score=1060.07  Aligned_cols=726  Identities=58%  Similarity=0.931  Sum_probs=662.5

Q ss_pred             hccHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHHccCCcHHHHHHHHcCCCHHHHHHHHHHHhhcCCCCCCCCCCCcCC
Q 002623           82 DFTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATEKFIQRQPKVLGETAGSMLG  161 (899)
Q Consensus        82 ~~t~~a~~~l~~A~~~A~~~~~~~v~~eHlL~all~~~~~~~~~~l~~~gv~~~~l~~~~~~~~~~~~~~~~~~~~~~~s  161 (899)
                      +||++++.+|..|+.+|++++|+++++||||++|+.++++.  .++..+|++++.++..+...+.+.|...+.   +.+|
T Consensus         1 ~~~~~~~~~l~~a~~~a~~~~h~~~~~eHll~~ll~~~~~~--~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~---~~~s   75 (786)
T COG0542           1 KLTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGD--ELLNLCGIDLDKLRQELEEFIDKLPKVLGS---PYLS   75 (786)
T ss_pred             CcCHHHHHHHHHHHHHHHHhCCCcccHHHHHHHHHcCCchH--HHHHHcCCCHHHHHHHHHHHHhccCCCCCC---CCCC
Confidence            58999999999999999999999999999999999998887  999999999999999999999999877662   7889


Q ss_pred             hhHHHHHHHHHHHHHHcCCCccCHHHHHHHhhccC-chhhhHHHhcCCChhhHHHHHHHHhccccccCCCCCcchHHHHh
Q 002623          162 RDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQ-RFGKQLFRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEK  240 (899)
Q Consensus       162 ~~~~~~l~~A~~~a~~~g~~~I~~ehlllall~~~-~~~~~ll~~~gv~~~~l~~~i~~~~~~~~~~~~~~~~~~~~l~~  240 (899)
                      +.++++++.|+.+|+.++++||+++|+|++++.++ +.+..+|...+++...+.+.+..+.++.......++.....|.+
T Consensus        76 ~~~~~~~~~a~~~a~~~~~~~v~~~~llla~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~  155 (786)
T COG0542          76 PRLKRVLERAWLLAQSLGDEYVSTEHLLLALLNEPESVAAYILKKLGVTRKDVEELIEELRGGNEVDSKNAEEDQDALEK  155 (786)
T ss_pred             HHHHHHHHHHHHHHHhccCccccHHHHHHHHhcccchHHHHHHHhccCCHHHHHHHHHHHhcccccCCcccccchhhHHH
Confidence            99999999999999999999999999999999887 78889999999999999888888887655555555666689999


Q ss_pred             hcccHHHHHhcCCCCCCcCchHHHHHHHHHhhcCCCCCcEEEcCCCCcHHHHHHHHHHHhhcCCCccccCCCeEEEEEcc
Q 002623          241 YGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMG  320 (899)
Q Consensus       241 ~~~~l~~~~~~~~l~~iiG~~~~i~~~~~~l~~~~~~~~LL~Gp~G~GKT~la~~la~~l~~~~~p~~l~~~~~~~l~~~  320 (899)
                      |+.+|++.++.+++||+|||+++|++++++|+|+.++|++|+|+||||||++|++||+++..|+||+.|++..++++|++
T Consensus       156 y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g  235 (786)
T COG0542         156 YTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLG  235 (786)
T ss_pred             HhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCCHHHcCCEEEEecHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccchHHHHHHHHHHHHHhhCCCeEEEEccchhhccCCCCCc-hHHHHHHHhhhhcCCCeEEEEecChhHHHhh
Q 002623          321 ALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNG-AMDAGNLLKPMLGRGELRCIGATTLDEYRKY  399 (899)
Q Consensus       321 ~l~~~~~~~g~~~~~l~~l~~~~~~~~~~~IL~iDEi~~l~~~~~~~~-~~~~~~~L~~~l~~~~v~~I~at~~~~~~~~  399 (899)
                      ++++|++|+|+||++++.+++++...+ ++||||||||++++++...| ++|+.|+|+++|.+|.++||||||..+|++|
T Consensus       236 ~LvAGakyRGeFEeRlk~vl~ev~~~~-~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaLARGeL~~IGATT~~EYRk~  314 (786)
T COG0542         236 SLVAGAKYRGEFEERLKAVLKEVEKSK-NVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELRCIGATTLDEYRKY  314 (786)
T ss_pred             HHhccccccCcHHHHHHHHHHHHhcCC-CeEEEEechhhhcCCCcccccccchhhhhHHHHhcCCeEEEEeccHHHHHHH
Confidence            999999999999999999999999876 99999999999999998876 6999999999999999999999999999999


Q ss_pred             hccCHHHHccCceEEecCCCHHHHHHHHHHHHHHHhhhhCCCCCHHHHHHHHHhcccccCCCCChhhHHHHHHHHHHhhh
Q 002623          400 IEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLK  479 (899)
Q Consensus       400 ~~~d~al~~Rf~~i~~~~ps~ee~~~Il~~~~~~~~~~~~~~i~~~~l~~~~~ls~~~i~~~~~p~~a~~lld~a~~~~~  479 (899)
                      ++.|+||.|||++|.+.+|+.++...||+++.++|+.+|+|.|+|+++.+++.+|.|||++|++||||+|++|+||++++
T Consensus       315 iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~dR~LPDKAIDLiDeA~a~~~  394 (786)
T COG0542         315 IEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLPDKAIDLLDEAGARVR  394 (786)
T ss_pred             hhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhcccCCCCchHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCchhHHHHHHHHHHHHHHHHhcccCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002623          480 MEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRV  559 (899)
Q Consensus       480 ~~~~~~~~~l~~~~~~i~~~~~e~~~~~~~~~~~~~~~l~~~~~e~~~l~~~l~~l~~~~~~e~~~l~~~~~~~e~l~~~  559 (899)
                      +... .|..++.+++++.+++.|+..+.++.+                            .+++..+.....+++     
T Consensus       395 l~~~-~p~~l~~~~~~~~~l~~e~~~~~~e~~----------------------------~~~k~~~~~~~~~~~-----  440 (786)
T COG0542         395 LEID-KPEELDELERELAQLEIEKEALEREQD----------------------------EKEKKLIDEIIKLKE-----  440 (786)
T ss_pred             hccc-CCcchhHHHHHHHHHHHHHHHHhhhhh----------------------------HHHHHHHHHHHHHhh-----
Confidence            9988 999999999999999999988765543                            111111111111110     


Q ss_pred             hHHHHHHHHhhcHHHHHHhhhccHHHHHHHHHHHHHHHHHHhhcCcccccccCChhhHHHHHHHHhcCCcccchhhHHHH
Q 002623          560 NLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREK  639 (899)
Q Consensus       560 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~g~~~~~~~~~~~~~  639 (899)
                                           +....++.++..                  .|++++|++++++|+|+|+.++...+...
T Consensus       441 ---------------------~~~~~~~~~~~~------------------~v~~~~Ia~vv~~~TgIPv~~l~~~e~~k  481 (786)
T COG0542         441 ---------------------GRIPELEKELEA------------------EVDEDDIAEVVARWTGIPVAKLLEDEKEK  481 (786)
T ss_pred             ---------------------hhhhhHHHHHhh------------------ccCHHHHHHHHHHHHCCChhhhchhhHHH
Confidence                                 001111111111                  18999999999999999999999999999


Q ss_pred             HHhHHHhhccceeccchHHHHHHHHHHHHHcCCCCCCCCcceeEEeccCCCcHHHHHHHHHHHhcCCCCceEEeccccch
Q 002623          640 LLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYM  719 (899)
Q Consensus       640 l~~l~~~l~~~i~Gq~~~~~~l~~~l~~~~~~~~~~~~p~~~lLl~Gp~GtGKT~lA~~la~~l~~~~~~~~~i~~~~~~  719 (899)
                      +.++++.+.++|+||++|+..+..+|++.++|+.+|++|+|++||.||+|||||.+|++||..+|++...++++|||+|+
T Consensus       482 ll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~  561 (786)
T COG0542         482 LLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYM  561 (786)
T ss_pred             HHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhcCCCCCCcccccccchhHHHhhCCCeEEEEeCCCccChHHHHHHHHhhcCCeeecCCCceeeeCCEEEEEec
Q 002623          720 EKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTS  799 (899)
Q Consensus       720 ~~~~~~~l~g~~~~~~g~~~~~~l~~~~~~~~~~vl~lDEid~l~~~~~~~Ll~~le~g~~~~~~g~~~~~~~~iiI~tt  799 (899)
                      ++|++++++|+|||||||+++|.|++++++.||+||+||||+|+||+++|.|||+||+|+++|+.|++++|+|++|||||
T Consensus       562 EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTS  641 (786)
T COG0542         562 EKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTS  641 (786)
T ss_pred             HHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHHHhcCCeeecCCCCEEecceeEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhhccCCCCCCCcchHHHHHHHHHHHHHhcCChHHHhccceEEecCCCCHHHHHHHHHHHHHHHHhhcccCC--C
Q 002623          800 NVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSP--W  877 (899)
Q Consensus       800 N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~ll~R~d~~i~f~~l~~e~i~~I~~~~l~~~~~~~~~~~--~  877 (899)
                      |.|+..+.....+  .....++.+.+.++..++..|+|+|++|+|.+|+|.||+.+++.+|++.++.++...+....  .
T Consensus       642 N~Gs~~i~~~~~~--~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~l  719 (786)
T COG0542         642 NAGSEEILRDADG--DDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVLERIVDLQLNRLAKRLAERGITL  719 (786)
T ss_pred             ccchHHHHhhccc--cccchhhhHHHHHHHHHHhhCCHHHHhhcccEEeccCCCHHHHHHHHHHHHHHHHHHHHhCCceE
Confidence            9999988764211  22234677888899999999999999999999999999999999999999999998887543  5


Q ss_pred             ccCHHHHHHhh
Q 002623          878 HFNYEMLVKFC  888 (899)
Q Consensus       878 ~~~~~~l~~~~  888 (899)
                      .+++++...+.
T Consensus       720 ~~s~~a~~~l~  730 (786)
T COG0542         720 ELSDEAKDFLA  730 (786)
T ss_pred             EECHHHHHHHH
Confidence            67777754443

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 0.0
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-143
4hse_A397 Crystal Structure Of Clpb Nbd1 In Complex With Guan 1e-141
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 7e-92
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 4e-85
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 5e-82
1jbk_A195 Crystal Structure Of The First Nucelotide Binding D 2e-81
2p65_A187 Crystal Structure Of The First Nucleotide Binding D 4e-81
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 6e-80
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 2e-56
1khy_A148 The Crystal Structure Of Clpb N Terminal Domain, Im 4e-05
3fes_A145 Crystal Structure Of The Atp-Dependent Clp Protease 3e-04
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure 
Iteration: 1

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/785 (56%), Positives = 572/785 (72%), Gaps = 18/785 (2%)
Query: 83  FTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATE 142
           +T  A +A+  +  +A+  KHQ ++  HL   LL+ +  LA R+  K G D   L E  E
Sbjct: 6   WTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGADPKALKELQE 65
Query: 143 KFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQL 202
           + + R PKV G   G  L   L   + R+    +E  D +V+V+ LVL   +        
Sbjct: 66  RELARLPKVEGAEVGQYLTSRLSGALNRAEGLMEELKDRYVAVDTLVLALAEAT------ 119
Query: 203 FRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDD 262
                  L  LK A++ +RG ++V  +  E  Y ALE+YG DLT +A+ GKLDPVIGRD+
Sbjct: 120 --PGLPGLEALKGALKELRGGRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDE 177
Query: 263 EIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGAL 322
           EIRR IQIL RRTKNNPVLIGEPGVGKTAI EGLAQRIV+GDVP+ L  ++++SL MG+L
Sbjct: 178 EIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSL 237
Query: 323 IAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGR 382
           +AGAKYRGEFE+RLKAV++EV +S+G++ILFIDE+HTVVGAG   GA+DAGN+LKP L R
Sbjct: 238 LAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALAR 297
Query: 383 GELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRI 442
           GELR IGATTLDEYR+ IEKDPALERRFQ VYVD+P VE+TISILRGL+E+YE+HHGVRI
Sbjct: 298 GELRLIGATTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRI 356
Query: 443 SDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEME 502
           SDSA++ AA LS RYI+ R LPDKAIDL+DEAAA+L+M + S P  +D + R  L+LE+E
Sbjct: 357 SDSAIIAAATLSHRYITERRLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIE 416
Query: 503 RLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLE 562
           R +L  + D  S++RL  +EAE++ L E  A+L  +WE E+ ++ +++  +  +D V  E
Sbjct: 417 REALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRRE 476
Query: 563 IQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVS 622
           I+ AER+YDLNRAAEL+YG L  L+ ++E+  ++L      G   +R EVT  DIAEIVS
Sbjct: 477 IELAERQYDLNRAAELRYGELPKLEAEVEALSEKLR-----GARFVRLEVTEEDIAEIVS 531
Query: 623 KWTGIPVSKLQQSXXXXXXXXXXXXXXXVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASF 682
           +WTGIPVSKL +                VVGQD A+++VA+AI+R+RAGL DP+RPI SF
Sbjct: 532 RWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSF 591
Query: 683 MFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQ 742
           +F+GPTGVGKTELAK LA+ +F+TEEA++RIDM+EYMEKHAVSRLIGAPPGYVGYEEGGQ
Sbjct: 592 LFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQ 651
Query: 743 LTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVG 802
           LTE VRRRPY+VILFDEIEKAH DVFN+ LQILDDGR+TDS GRTV F NTVII+TSN+G
Sbjct: 652 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLG 711
Query: 803 SQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVR 862
           S  IL    + +P    YE I+  V    +  FRPEF+NR+DE +VF+PL ++QI  IV 
Sbjct: 712 SPLILEGLQKGWP----YERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVE 767
Query: 863 LQVSF 867
           +Q+S+
Sbjct: 768 IQLSY 772
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|4HSE|A Chain A, Crystal Structure Of Clpb Nbd1 In Complex With Guanidinium Chloride And Adp Length = 397 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|1JBK|A Chain A, Crystal Structure Of The First Nucelotide Binding Domain Of Clpb Length = 195 Back     alignment and structure
>pdb|2P65|A Chain A, Crystal Structure Of The First Nucleotide Binding Domain Of Chaperone Clpb1, Putative, (Pv089580) From Plasmodium Vivax Length = 187 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KHY|A Chain A, The Crystal Structure Of Clpb N Terminal Domain, Implication To The Peptide Binding Function Of Clpb Length = 148 Back     alignment and structure
>pdb|3FES|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Clpc From Clostridium Difficile Length = 145 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 0.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 0.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 2e-06
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 0.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-178
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-140
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 1e-161
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 1e-140
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 1e-129
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 9e-77
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 1e-39
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 7e-26
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 3e-23
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 2e-18
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 4e-09
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 2e-08
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 5e-05
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-08
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-04
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-06
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 3e-06
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 3e-05
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-05
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 4e-05
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 3e-04
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-04
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 6e-04
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 6e-04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 7e-04
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 8e-04
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
 Score = 1418 bits (3673), Expect = 0.0
 Identities = 459/783 (58%), Positives = 583/783 (74%), Gaps = 18/783 (2%)

Query: 83  FTDMAWQAIVSSPDVAKENKHQIVETEHLLKALLEQKNGLARRIFSKVGVDNTRLLEATE 142
           +T  A +A+  +  +A+  KHQ ++  HL   LL+ +  LA R+  K G D   L E  E
Sbjct: 6   WTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGADPKALKELQE 65

Query: 143 KFIQRQPKVLGETAGSMLGRDLEALIQRSREYKKEYGDSFVSVEHLVLGFTQDQRFGKQL 202
           + + R PKV G   G  L   L   + R+    +E  D +V+V+ LVL   +       L
Sbjct: 66  RELARLPKVEGAEVGQYLTSRLSGALNRAEGLMEELKDRYVAVDTLVLALAEATPGLPGL 125

Query: 203 FRDFQISLPTLKSAIEAIRGRQSVIDQDPEGKYEALEKYGKDLTAMASAGKLDPVIGRDD 262
                     LK A++ +RG ++V  +  E  Y ALE+YG DLT +A+ GKLDPVIGRD+
Sbjct: 126 --------EALKGALKELRGGRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDE 177

Query: 263 EIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGAL 322
           EIRR IQIL RRTKNNPVLIGEPGVGKTAI EGLAQRIV+GDVP+ L  ++++SL MG+L
Sbjct: 178 EIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSL 237

Query: 323 IAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGR 382
           +AGAKYRGEFE+RLKAV++EV +S+G++ILFIDE+HTVVGAG   GA+DAGN+LKP L R
Sbjct: 238 LAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALAR 297

Query: 383 GELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRI 442
           GELR IGATTLDEYR+ IEKDPALERRFQ VYVD+P VE+TISILRGL+E+YE+HHGVRI
Sbjct: 298 GELRLIGATTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRI 356

Query: 443 SDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEME 502
           SDSA++ AA LS RYI+ R LPDKAIDL+DEAAA+L+M + S P  +D + R  L+LE+E
Sbjct: 357 SDSAIIAAATLSHRYITERRLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIE 416

Query: 503 RLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLE 562
           R +L  + D  S++RL  +EAE++ L E  A+L  +WE E+ ++ +++  +  +D V  E
Sbjct: 417 REALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRRE 476

Query: 563 IQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVS 622
           I+ AER+YDLNRAAEL+YG L  L+ ++E+  ++L      G   +R EVT  DIAEIVS
Sbjct: 477 IELAERQYDLNRAAELRYGELPKLEAEVEALSEKL-----RGARFVRLEVTEEDIAEIVS 531

Query: 623 KWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASF 682
           +WTGIPVSKL + EREKLL LEEELHKRVVGQD A+++VA+AI+R+RAGL DP+RPI SF
Sbjct: 532 RWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSF 591

Query: 683 MFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQ 742
           +F+GPTGVGKTELAK LA+ +F+TEEA++RIDM+EYMEKHAVSRLIGAPPGYVGYEEGGQ
Sbjct: 592 LFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQ 651

Query: 743 LTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVG 802
           LTE VRRRPY+VILFDEIEKAH DVFN+ LQILDDGR+TDS GRTV F NTVII+TSN+G
Sbjct: 652 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLG 711

Query: 803 SQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVR 862
           S  IL    E   K   YE I+  V    +  FRPEF+NR+DE +VF+PL ++QI  IV 
Sbjct: 712 SPLIL----EGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVE 767

Query: 863 LQV 865
           +Q+
Sbjct: 768 IQL 770
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Length = 468 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Length = 195 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Length = 187 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Length = 148 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Length = 145 Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Length = 150 Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Length = 146 Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Length = 143 Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Length = 143 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Length = 120 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Length = 250 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 899
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 1e-154
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 1e-100
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 1e-89
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 7e-86
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 4e-70
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 7e-45
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 7e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 1e-33
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-33
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 9e-05
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-31
d1qvra1145 a.174.1.1 (A:4-148) N-terminal domain of ClpB (hea 5e-30
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 3e-26
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 1e-06
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 3e-21
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 5e-06
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 6e-14
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 1e-08
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 9e-13
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 6e-12
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-11
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 3e-04
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 4e-10
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 2e-05
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-09
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-06
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 0.002
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-08
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-06
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-06
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 4e-05
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 5e-05
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 6e-04
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.004
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.004
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score =  457 bits (1177), Expect = e-154
 Identities = 245/392 (62%), Positives = 312/392 (79%), Gaps = 6/392 (1%)

Query: 235 YEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISE 294
           Y ALE+YG DLT +A+ GKLDPVIGRD+EIRR IQIL RRTKNNPVLIGEPGVGKTAI E
Sbjct: 2   YNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVE 61

Query: 295 GLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFI 354
           GLAQRIV+GDVP+ L  ++++SL MG+L+AGAKYRGEFE+RLKAV++EV +S+G++ILFI
Sbjct: 62  GLAQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFI 121

Query: 355 DEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVY 414
           DE+HTVVGAG   GA+DAGN+LKP L RGELR IGATTLDEYR+   KDPALERRFQ VY
Sbjct: 122 DELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYREIE-KDPALERRFQPVY 180

Query: 415 VDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEA 474
           VD+P VE+TISILRGL+E+YE+HHGVRISDSA++ AA LS RYI+ R LPDKAIDL+DEA
Sbjct: 181 VDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEA 240

Query: 475 AAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQ 534
           AA+L+M + S P  +D + R  L+LE+ER +L  + D  S++RL  +EAE++ L E  A+
Sbjct: 241 AARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAK 300

Query: 535 LTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAE 594
           L  +WE E+ ++ +++  +  +D V  EI+ AER+YDLNRAAEL+YG L  L+ ++E+  
Sbjct: 301 LRAEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALS 360

Query: 595 KELNEYISSGKSMLREEVTGSDIAEIVSKWTG 626
           ++L      G   +R EVT  DIAEIVS+WTG
Sbjct: 361 EKLR-----GARFVRLEVTEEDIAEIVSRWTG 387
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query899
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.97
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.94
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.93
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.92
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.91
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 99.9
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 99.88
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.88
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.88
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.88
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.87
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.87
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.86
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.84
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.83
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.82
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.82
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.81
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.81
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 99.81
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.8
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.8
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.8
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.79
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.77
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.77
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.76
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.76
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.75
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.75
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.74
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.74
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.7
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.69
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.68
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.68
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.65
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.64
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.62
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.62
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.6
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.54
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.52
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.5
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.48
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.43
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.41
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.4
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.37
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.36
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.29
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.19
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.17
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.15
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.05
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 98.69
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 98.62
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.61
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.55
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.31
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 98.31
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.31
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.28
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.99
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.79
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.72
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.7
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.63
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.6
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.53
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.53
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.51
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.47
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.47
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.45
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.44
d2qy9a2211 GTPase domain of the signal recognition particle r 97.25
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.22
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.22
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.22
d1okkd2207 GTPase domain of the signal recognition particle r 97.21
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.17
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.15
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.15
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.15
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.13
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.12
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.11
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.11
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.08
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.07
d2qy9a2211 GTPase domain of the signal recognition particle r 97.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.04
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.04
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.02
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.01
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.98
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.98
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.96
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.95
d1vmaa2213 GTPase domain of the signal recognition particle r 96.95
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.94
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.93
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.92
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.9
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.9
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.88
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.88
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.87
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.87
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.87
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.84
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.84
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.84
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.81
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.8
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.79
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.78
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.78
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.77
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.77
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.77
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.77
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.75
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.71
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.71
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.69
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.69
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.67
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.64
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.63
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.62
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.61
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.6
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.59
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.56
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.54
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.54
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.54
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.53
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.53
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.49
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.49
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.46
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.46
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.45
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.45
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.45
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.45
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.44
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.44
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.43
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.43
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.42
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.41
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.41
d1vmaa2213 GTPase domain of the signal recognition particle r 96.38
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.37
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.36
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.36
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.35
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.35
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.35
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.35
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.3
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 96.28
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.27
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.26
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.26
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.25
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.23
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.23
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.21
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.19
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.19
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.15
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.14
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.12
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.12
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.12
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.12
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.06
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.05
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.05
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.98
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.98
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.97
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.95
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.93
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.93
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.89
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.89
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.88
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.82
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.76
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.76
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.72
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.69
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.63
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.6
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.59
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.54
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.54
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.52
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.5
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.49
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.49
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.43
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.4
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.39
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.38
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.34
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.31
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.25
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.09
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.02
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.98
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.98
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.87
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.81
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.8
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.71
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.69
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.63
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.6
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.51
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.46
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.4
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.4
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.38
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.32
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.31
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.29
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.18
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 94.17
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.13
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.09
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.02
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.98
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.96
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 93.89
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.88
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.82
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.82
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 93.8
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.72
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.64
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.57
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.55
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.48
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.45
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.44
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.43
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 93.42
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.39
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.3
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.28
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.24
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.17
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.15
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.14
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.12
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.12
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.11
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.03
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.01
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.96
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.75
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.74
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.72
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.65
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.58
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.55
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.53
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.53
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.49
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.49
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.49
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.49
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.48
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.46
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.41
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.39
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.39
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.39
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.35
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 92.34
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.32
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.31
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.27
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.25
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.25
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.24
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.21
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.2
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.18
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.17
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.14
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.11
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.08
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.04
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.04
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.02
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.02
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.0
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.99
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.97
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.96
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.96
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.92
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.92
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.83
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.76
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.72
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.71
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.67
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.65
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.64
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.61
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.58
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 91.49
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.47
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 91.43
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 91.39
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 91.38
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.36
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.33
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 91.17
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.06
d1g2912240 Maltose transport protein MalK, N-terminal domain 90.86
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.8
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.74
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.66
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.63
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.62
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.57
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 90.52
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.4
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.23
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 90.2
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.2
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.11
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.06
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.97
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.96
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.93
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.78
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.61
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.56
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.52
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 89.5
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.46
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.43
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.32
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.29
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.24
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.22
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.19
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 89.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.96
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.88
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.87
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.85
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.75
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.64
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 88.63
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 88.62
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 88.6
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 88.6
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 88.43
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.38
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.35
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.35
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 88.32
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 88.23
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 88.17
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.12
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 88.08
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.01
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.95
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 87.89
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 87.88
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.74
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.74
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.65
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.61
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.57
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.43
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.38
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.35
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.15
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 87.12
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.11
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 87.07
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.03
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 86.95
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.91
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.77
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.76
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 86.72
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.72
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.68
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 86.64
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.63
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 86.55
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.41
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.2
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.14
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.08
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.01
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.93
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.89
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.82
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.7
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.69
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 85.68
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 85.59
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.58
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 85.53
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.48
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.45
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.44
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.4
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 85.31
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.29
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.24
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.21
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.16
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.02
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.99
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.97
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.91
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.86
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.77
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.58
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 84.48
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 84.38
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.26
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.24
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.21
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 84.18
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.16
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.08
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.77
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 83.58
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.42
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.99
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.91
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 82.9
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.77
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 82.71
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 82.58
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.36
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 82.16
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 82.05
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.98
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 81.72
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 81.62
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.34
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 81.08
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.01
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.73
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.69
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 80.69
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=0  Score=466.97  Aligned_cols=386  Identities=64%  Similarity=1.035  Sum_probs=368.8

Q ss_pred             HHHHHHHCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEE
Q ss_conf             37887310229988865999997675499999999960079998488869999299999999999645998644589729
Q 002623          235 YEALEKYGKDLTAMASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKL  314 (899)
Q Consensus       235 ~~~l~~~~~~l~~~~~~~~l~~ivg~~~~i~~~~~~l~~~~~~~~LL~Gp~G~GKT~la~~la~~l~~~~vp~~l~~~~~  314 (899)
                      |+.|++||.+|++.++.+++||++||+.++++++++|+|+.++|+||+||||||||+++++||+++..+++|..|.+..+
T Consensus         2 ~~~l~~~~~~l~~~a~~g~ld~~~gr~~ei~~~~~~L~r~~k~n~llvG~~GvGKtaiv~~la~~i~~~~vp~~l~~~~i   81 (387)
T d1qvra2           2 YNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRI   81 (387)
T ss_dssp             CSHHHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEE
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCCHHHCCCEE
T ss_conf             37799997988999985999987480899999999982488999768799998899999999999980899978869668


Q ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             99976310113554540799999999999860898499982510100289888437899988421318986999821716
Q 002623          315 ISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLD  394 (899)
Q Consensus       315 ~~i~~~~l~~~~~~~g~~~~~l~~l~~~~~~~~~~~ILfiDEi~~l~~~~~~~~~~~~~~~L~~~l~~g~i~iI~at~~~  394 (899)
                      +++|++.+++|++|+|+++.+++.++.++....+++||||||+|.+++.+.+.|+.++.++|+++|.+|.+++|++||+.
T Consensus        82 ~~ld~~~l~ag~~~~g~~e~r~~~i~~~~~~~~~~~ilfide~h~l~~~g~~~g~~d~a~~Lkp~L~rg~~~~I~~tT~~  161 (387)
T d1qvra2          82 VSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLD  161 (387)
T ss_dssp             EEECC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC-------------------HHHHHTTCCCEEEEECHH
T ss_pred             EEEEHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCHH
T ss_conf             99557666526674136899999999985058996698724088884277787741389999999737885166636899


Q ss_pred             HHHHHHCCCHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             88864105988873675088338998989999999999995440998899999999970001248998925699999999
Q 002623          395 EYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEA  474 (899)
Q Consensus       395 ~~~~~~~~~~~l~~Rf~~i~i~~p~~ee~~~Il~~~~~~~~~~~~v~i~~~al~~~~~ls~~~~~~~~~p~~a~~lld~a  474 (899)
                      +|+. ++.|++|.+||+.|.|.+|+.++...|++.+...|+.+|++.++++++..++.+|.+|++++++||||+|++|++
T Consensus       162 ey~~-~e~d~al~rrF~~v~v~ep~~~~~~~il~~~~~~~e~~h~v~~~~~ai~~~v~ls~ryi~~r~~PdKAidlld~a  240 (387)
T d1qvra2         162 EYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEA  240 (387)
T ss_dssp             HHHH-HTTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHH
T ss_pred             HHHH-HCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             9987-633679998246112799867889999999999987404774669999999985023666566704688999999


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98623510699115999999999999999750137433239999999999999999999999999999999999999999
Q 002623          475 AAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKE  554 (899)
Q Consensus       475 ~~~~~~~~~~~~~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~e~~~l~~~l~~l~~~~~~e~~~l~~~~~~~e  554 (899)
                      |+++++...+.|..++.+++.+..++.+...+.++.+..+..++.....++..+++++..+..+|..+...+...+..++
T Consensus       241 ~a~~~i~~~s~P~el~~ler~I~qLe~E~~aL~ke~d~~s~~rl~~le~el~~lee~~~~L~~~w~~ek~~l~~i~~Lk~  320 (387)
T d1qvra2         241 AARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQH  320 (387)
T ss_dssp             HHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998641589588999999999999999998740145788887653323567999999999999888879999999999


Q ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             999975999999983308888986104689999999999999999762186533456774339999998816
Q 002623          555 EIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTG  626 (899)
Q Consensus       555 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~v~~~~i~~~i~~~~g  626 (899)
                      +++.+...++.+++..++.+++++.|+.++.++.++......+     ....+++..|+..+|+.++++|||
T Consensus       321 ~Le~lr~~le~A~r~gd~e~AaeL~y~~ip~le~el~~l~~~~-----~~~~lvr~~VteedIA~VVSrWTG  387 (387)
T d1qvra2         321 RLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEKL-----RGARFVRLEVTEEDIAEIVSRWTG  387 (387)
T ss_dssp             HHHHHHHHHHHHTTTTCHHHHHHHHTTHHHHHHHHHHHHHHHS-----SSCSSCCSEECHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHCHHHHHHHHHHHHHHHH-----CCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             9999999999999764688788875250799999999999873-----579877686398999999976109
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure