Citrus Sinensis ID: 002754

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880----
MACNFSFPSSLSLDIFPTKPKSKNPKNTQKFQFCTPFSCKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPAFAATKVASGKKKKSQKKTQEALTPEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASMLSTFRPKKESKRAAEIRRAREELKRQRKEELEKMREESEMMEKAMDMQKKEEERRRKKEIRLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKDYEDRLKIEKAEREERKKLRQLERELEGLEGADDEIEQGEAEQNPHLKMAMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQNVTSIGSNA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEEccccccHHHHHHHHccccccHHHHHHcccccHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccEEEEEEccEEEEEEcccccccHHHHHHHHccccccEEEccccccccccccccccEEEEccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHEEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHcccccccccHHHHHHHHcccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHccccHHHHHcccccccccEEEccccccHHHHHHHHHcccccccEEcccccEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccEEEEcccccccccccccHHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccccccccc
cccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEccEEEEEEEccccccHHHHHHHHHccccccccccccccccHHHHHHHHccccEEcccccHHHHHHHHHccccEEEEcccccccccccEEEEEEEccccEEEEEccccccccHHHHHHHHccEcEEEEEccccccccccccccHHHHHcccHHHHHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHEEEEEEHHEEEEHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccccccccccHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcHHEEEEcccccccEEEEEEEcccccccEEEEEcccccccccccccHHHHHHHHHHHHccHHHHHHEcccccccccccHHHHHHHHHHHHHHHHccccHcccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
macnfsfpsslsldifptkpksknpkntqkfqfctpfscknqnfnpqnedrnknqnskrphlglltIPVTLTIISTslaqkpafaatkvasgkkkksqkktqealtpeqlkkwskdlpivsdriAYTEIFSlkdegklkhvikspsgslrqkaepvLVVLEDSRvlrtvlpsldsnrKFWESWDElkidslcvnaytpplkkpevpnpylgflwrvpasmlstfrpkkeSKRAAEIRRAREELKRQRKEELEKMREESEMMEKAMDMQKKEEERRRKKEIRLQKYEESLQDARDNYRYMANVWENLAkdstvatgLGIVFFVIFYRTVVLNYRRQKKDYEDRLKIEKAEREERKKLRQLERELEglegaddeieqgeaeqnpHLKMAMQFMKSGARVRRAYgkglpqylergvdvkfsdvaglgKIRLELEEIVKFFTHGemyrrrgvripggillcgppgvgkTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEakdnapsvvfIDELDAVgrerglikgsggqerdATLNQLLVCLdgfegrgnvitiastnrpdildpalvrpgrfdrkifipkpgligRMEILKVHarkkpmaddvDYLAVASMTDGMVGAELANIVEVAAINMmrdgrteittdDLLQAAQIEERGmldrkersSETWRQVAINEAAMAVVAvnfpdlkniefVTIAPRAGRELGYVRMKMDhmkfkegmlsrQSLLDHITVqlapraadelwcgegqlsTIWAETADNARSAARTFVLGglsdkhfglsnfWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELhgslepmppsiVDIRAAKHSEIQEIMtnqnvtsigsna
macnfsfpsslsldifptkpksknpKNTQKFQFCTPFSCKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPAFAatkvasgkkkksqkktqealtpeqlkkwskdlpivSDRIAYTEifslkdegklkhvikspsgslrqkaepvlvvledsrvlrtvlpsldsnrkFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASmlstfrpkkeskraAEIRRAReelkrqrkeelekmreesemmekamdmqkkeEERRRKKEIRLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVlnyrrqkkdyedrlkiekaereerkkLRQLERELeglegaddeieqgeaeqnphLKMAMQFMKSGARVRRAYGKGlpqylergvdvkfsdvaglgkirLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYqeakdnapsvvFIDELDAVGRERGLIkgsggqerdaTLNQLLVCLDGFEGRGNVItiastnrpdildpalvrpgrfdrkifipkpgligRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIeergmldrkerSSETWRQVAINEAAMAVVAvnfpdlkniefvtiapragrelgYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVElhgslepmpPSIVDIRAAKHSEIQeimtnqnvtsigsna
MACNFSFPSSLSLDIFptkpksknpkntqkFQFCTPFSCKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPAFAatkvasgkkkksqkktqEALTPEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASMLSTFRPkkeskraaeirrareelkrqrkeelekmreesemmekamDMQkkeeerrrkkeirLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKDYEDrlkiekaereerkklrqlereleglegaddeieQGEAEQNPHLKMAMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRipggillcgppgvgKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQNVTSIGSNA
********************************FCTP*************************LGLLTIPVTLTIISTSLAQ********************************WSKDLPIVSDRIAYTEIFSLKDEGKLKHVI***********EPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASML************************************************************************DNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQ***********************************************************ARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGG*ERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQA*****************TWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSL*******V**************************
*********SLSLDI****************QFCT*************************HLGLLTIPVTLTIISTSLAQK*******************************WSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKS*****RQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTP******VPNPYLGFLWRVPASM******************************************************************************MANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKD******************************************NPH*****************************VDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEER**************QVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLS*K***********RINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLV****************************************
********SSLSLDIFPTKPKSKNPKNTQKFQFCTPFSCKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPA***********************PEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASMLSTF************RRAREEL************************************IRLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKDYEDRLKIEKAEREERKKLRQLERELEGLEGADDEIEQGEAEQNPHLKMAMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERG************RQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQNVTSIGSNA
***********SLDIFPTKPKSKNPKNTQKFQFCTPFSCKNQNFN********NQ*SKRPHLGLLTIPVTLTIISTSLAQKPAFAATK***************ALTPEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASMLSTFRPKKESKR*AEIRRAREELKRQRKEELEKMREESEMMEKAMDMQKKEEERRRKKEIRLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKDYEDRLKIEKAEREERKKLRQLERELEGLEGADDEIEQGEA****************************QY*ERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERG*IK*SGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELH*************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACNFSFPSSLSLDIFPTKPKSKNPKNTQKFQFCTPFSCKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPAFAATKVASGKKKKSQKKTQEALTPEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPVLVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRVPASMLSTFRPKKESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQNPHLKMAMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQNVTSIGSNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query884 2.2.26 [Sep-21-2011]
Q2JNP0638 ATP-dependent zinc metall no no 0.510 0.706 0.422 9e-92
P72991616 ATP-dependent zinc metall N/A no 0.505 0.725 0.421 6e-91
B8D065630 ATP-dependent zinc metall yes no 0.511 0.717 0.414 6e-90
Q8YMZ8656 ATP-dependent zinc metall no no 0.502 0.676 0.418 8e-90
Q67JH0626 ATP-dependent zinc metall yes no 0.470 0.664 0.434 1e-87
Q9WZ49610 ATP-dependent zinc metall yes no 0.475 0.688 0.432 2e-87
Q10ZF7667 ATP-dependent zinc metall no no 0.519 0.688 0.398 2e-87
D4HA34717 ATP-dependent zinc metall yes no 0.464 0.573 0.437 4e-87
B4U7U4636 ATP-dependent zinc metall yes no 0.510 0.709 0.404 9e-87
C7N1I1783 ATP-dependent zinc metall yes no 0.471 0.532 0.412 1e-86
>sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 Back     alignment and function desciption
 Score =  338 bits (868), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 206/487 (42%), Positives = 287/487 (58%), Gaps = 36/487 (7%)

Query: 380 QNPHLKMAMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTH 439
           QN     A+ F KS ARV+          +E    + F+DVAG+ + +LEL E+V F  +
Sbjct: 141 QNGPGSQALNFGKSRARVQ----------MEPKTQITFNDVAGIDQAKLELAEVVDFLKN 190

Query: 440 GEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRV 499
            E +   G +IP G+LL GPPG GKTLLA+AVAGEAGV FFSIS S+FVE++VGVGASRV
Sbjct: 191 SERFTALGAKIPRGVLLVGPPGTGKTLLARAVAGEAGVPFFSISGSEFVEMFVGVGASRV 250

Query: 500 RSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVIT 559
           R L+++AK NAP +VFIDE+DAVGR+RG   G G  ER+ TLNQLL  +DGFEG   +I 
Sbjct: 251 RDLFEQAKQNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNSGIIV 310

Query: 560 IASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMT 619
           IA+TNRPD+LD AL+RPGRFDR++ + +P   GR+EILKVHAR K ++ DVD   +A  T
Sbjct: 311 IAATNRPDVLDAALLRPGRFDRQVTVDRPDFQGRLEILKVHARGKTLSADVDLEKLARRT 370

Query: 620 DGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQ--VA 677
            G  GA+LAN++  AAI   R   TEI+ D++  A      G  ++K+R     R+  VA
Sbjct: 371 PGFTGADLANLLNEAAILAARRNLTEISMDEINDAVDRVLAGP-EKKDRLMSERRKELVA 429

Query: 678 INEAAMAVVAVNFPDLKNIEFVTIAPRA-GRELGYVRMKMDHMKFKEGMLSRQSLLDHIT 736
            +EA  A+V    P+   I+ VTI PR     L +     D M    G+ +R  L + +T
Sbjct: 430 YHEAGHALVGSLLPNYDPIQKVTIIPRGQAGGLTWFMPSDDDM----GLTTRAHLKNMMT 485

Query: 737 VQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVLG-GLSDKHFGL------SNFWV 789
           V L  R A+E+  GE +++T  A         AR  V   G+SD+   +      +N ++
Sbjct: 486 VALGGRVAEEVVYGESEITTGAASDLQQVARIARNMVTRFGMSDRLGNVALGRQYANIFL 545

Query: 790 ADRINE-----------IDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQ 838
              I             ID E  R++N  Y+RA  +++ NR LLD +   LVE +++  +
Sbjct: 546 GREIAAERDFSEETAALIDEEVRRLVNEAYQRATYLIRENRALLDRIARRLVEAETIDGE 605

Query: 839 EFFHLVE 845
           E   +++
Sbjct: 606 ELQAIID 612
Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.
Synechococcus sp. (strain JA-2-3B'a(2-13)) (taxid: 321332)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 Back     alignment and function description
>sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 Back     alignment and function description
>sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 Back     alignment and function description
>sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query884
224070955844 predicted protein [Populus trichocarpa] 0.950 0.995 0.795 0.0
255549872884 Cell division protein ftsH, putative [Ri 0.980 0.980 0.771 0.0
18401080876 AAA-type ATPase family protein [Arabidop 0.983 0.992 0.765 0.0
9279712976 cell division protein FtsH-like [Arabido 0.989 0.896 0.758 0.0
297834500874 EMB2083 [Arabidopsis lyrata subsp. lyrat 0.979 0.990 0.758 0.0
225442523888 PREDICTED: ATP-dependent zinc metallopro 0.980 0.976 0.754 0.0
356557300883 PREDICTED: ATP-dependent zinc metallopro 0.981 0.983 0.731 0.0
449447797886 PREDICTED: ATP-dependent zinc metallopro 0.988 0.986 0.719 0.0
356550510887 PREDICTED: ATP-dependent zinc metallopro 0.928 0.925 0.755 0.0
297743224904 unnamed protein product [Vitis vinifera] 0.915 0.894 0.714 0.0
>gi|224070955|ref|XP_002303302.1| predicted protein [Populus trichocarpa] gi|222840734|gb|EEE78281.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1360 bits (3519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/844 (79%), Positives = 762/844 (90%), Gaps = 4/844 (0%)

Query: 39  CKNQNFNPQNEDRNKNQNSKRPHLGLLTIPVTLTIISTSLAQKPAFAATKV--ASGKKKK 96
           CK Q+   +N+++ +N N K+ H   L++P+TLTIISTSL   PAFAAT       KKK 
Sbjct: 2   CKKQDPILENDNKTENTN-KKTHFSFLSLPITLTIISTSLTPHPAFAATPTPKTYHKKKT 60

Query: 97  SQKKTQEALTPEQLKKWSKDLPIVSDRIAYTEIFSLKDEGKLKHVIKSPSGSLRQKAEPV 156
            +K  QEALTP+QLK+WS++LP+VS+RI YT++  LK+  KLKHVIK+P+ SL+Q+ E V
Sbjct: 61  LKKTQQEALTPDQLKQWSQNLPVVSNRIPYTQVLILKENNKLKHVIKAPNASLKQRPEAV 120

Query: 157 LVVLEDSRVLRTVLPSLDSNRKFWESWDELKIDSLCVNAYTPPLKKPEVPNPYLGFLWRV 216
           LVVL+D++V RTVLPSL+SNR+FW+SWDE KID+LCVNAY+PP+K+PE+P PYLGFLW+V
Sbjct: 121 LVVLDDNQVFRTVLPSLESNRRFWDSWDEFKIDALCVNAYSPPVKRPELPKPYLGFLWKV 180

Query: 217 PASMLSTFRPKKESKRAAEIRRAREELKRQRKEELEKMREESEMMEKAMDMQKKEEERRR 276
           P  MLS  +PKKESKRA E+R AREE KRQRKEEL+KMREE E++EKA+ MQKK+E+RRR
Sbjct: 181 PEFMLSRLKPKKESKRAMELRMAREEFKRQRKEELKKMREEREIIEKAIKMQKKDEDRRR 240

Query: 277 KKEIRLQKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQK 336
           K+E R +KYEESL+DAR NY  MA++W NLA+DS V T LG+VFFVIFYRTVVL+YR+QK
Sbjct: 241 KRETRTKKYEESLRDARKNYTRMASMWANLAQDSNVTTLLGLVFFVIFYRTVVLSYRKQK 300

Query: 337 KDYEDRLKIEKAEREERKKLRQLERELEGLEGADDEIE-QGEAEQNPHLKMAMQFMKSGA 395
           KDY+DRLKIEKA+ EERKK+R+LEREL G+E  +++    G+AEQNP+LKMAMQFMKSGA
Sbjct: 301 KDYDDRLKIEKADAEERKKMRELERELMGIEEEEEDESVPGKAEQNPYLKMAMQFMKSGA 360

Query: 396 RVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGIL 455
           RVRRA+ K LPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGV+IPGGIL
Sbjct: 361 RVRRAHNKRLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVKIPGGIL 420

Query: 456 LCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVF 515
           LCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVR+LYQEAK+NAPSVVF
Sbjct: 421 LCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRALYQEAKENAPSVVF 480

Query: 516 IDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVR 575
           IDELDAVGRERGLIKGSGGQERDATLNQLLV LDGFEGRG VITIASTNRPDILDPALVR
Sbjct: 481 IDELDAVGRERGLIKGSGGQERDATLNQLLVSLDGFEGRGEVITIASTNRPDILDPALVR 540

Query: 576 PGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAA 635
           PGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDY+AVASMTDGMVGAELANI+EVAA
Sbjct: 541 PGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYMAVASMTDGMVGAELANIIEVAA 600

Query: 636 INMMRDGRTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKN 695
           INMMRDGRTEITTDDLLQAAQIEERGMLDRKERS ETW+QVAINEAAMAVVAVNFPDL+N
Sbjct: 601 INMMRDGRTEITTDDLLQAAQIEERGMLDRKERSPETWKQVAINEAAMAVVAVNFPDLRN 660

Query: 696 IEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLS 755
           IEFVTIAPRAGRELGYVRMKMDH+KFKEGMLSRQSLLDHITVQLAPRAADELW GEGQLS
Sbjct: 661 IEFVTIAPRAGRELGYVRMKMDHVKFKEGMLSRQSLLDHITVQLAPRAADELWYGEGQLS 720

Query: 756 TIWAETADNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEIL 815
           TIWAETADNARSAAR++VLGGLS+KH GLSNFW ADRINEID EALR++N CY+ AKEIL
Sbjct: 721 TIWAETADNARSAARSYVLGGLSEKHHGLSNFWAADRINEIDLEALRVMNFCYDGAKEIL 780

Query: 816 QRNRNLLDAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQ 875
           Q+NR L+DAVV+ELV KKSLTKQEFF+LVELHG ++PMPPSI+ IR AK ++ QE++ +Q
Sbjct: 781 QQNRKLMDAVVDELVRKKSLTKQEFFNLVELHGVIKPMPPSILYIRVAKRAQFQEMLVHQ 840

Query: 876 NVTS 879
           N T+
Sbjct: 841 NETT 844

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255549872|ref|XP_002515987.1| Cell division protein ftsH, putative [Ricinus communis] gi|223544892|gb|EEF46407.1| Cell division protein ftsH, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18401080|ref|NP_566541.1| AAA-type ATPase family protein [Arabidopsis thaliana] gi|332642273|gb|AEE75794.1| AAA-type ATPase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9279712|dbj|BAB01269.1| cell division protein FtsH-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834500|ref|XP_002885132.1| EMB2083 [Arabidopsis lyrata subsp. lyrata] gi|297330972|gb|EFH61391.1| EMB2083 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225442523|ref|XP_002278786.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356557300|ref|XP_003546955.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449447797|ref|XP_004141654.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356550510|ref|XP_003543629.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Glycine max] Back     alignment and taxonomy information
>gi|297743224|emb|CBI36091.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query884
TAIR|locus:2094892876 EMB2083 "embryo defective 2083 0.675 0.681 0.777 1.8e-302
UNIPROTKB|Q3AFJ8619 ftsH "ATP-dependent zinc metal 0.518 0.739 0.403 1.5e-79
TIGR_CMR|CHY_0214619 CHY_0214 "cell division protei 0.518 0.739 0.403 1.5e-79
TAIR|locus:2157637704 VAR1 "VARIEGATED 1" [Arabidops 0.481 0.605 0.384 7.1e-78
TIGR_CMR|BA_0064633 BA_0064 "cell division protein 0.526 0.734 0.406 4.3e-77
TIGR_CMR|GSU_1809610 GSU_1809 "cell division protei 0.505 0.732 0.405 9.3e-75
UNIPROTKB|P37476637 ftsH "ATP-dependent zinc metal 0.513 0.712 0.405 1.2e-74
UNIPROTKB|Q5LNU8639 ftsH "ATP-dependent zinc metal 0.501 0.693 0.402 1.6e-73
TIGR_CMR|SPO_3105639 SPO_3105 "ATP-dependent metall 0.501 0.693 0.402 1.6e-73
UNIPROTKB|P0C5C0 760 ftsH "ATP-dependent zinc metal 0.514 0.598 0.394 3.7e-71
TAIR|locus:2094892 EMB2083 "embryo defective 2083" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2341 (829.1 bits), Expect = 1.8e-302, Sum P(2) = 1.8e-302
 Identities = 464/597 (77%), Positives = 514/597 (86%)

Query:   283 QKYEESLQDARDNYRYMANVWENLAKDSTVATGLGIVFFVIFYRTVVLNYRRQKKDYEDX 342
             +KYEESL++AR NYR MA++W  LA+D  VAT LG+VFF IFYR VVLNYR+QKKDYED 
Sbjct:   275 KKYEESLREARKNYRDMADMWARLAQDPNVATALGLVFFYIFYRVVVLNYRKQKKDYEDR 334

Query:   343 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGEAEQNPHLKMAMQFMKSGARVRRAYG 402
                                             +G  E+NP+L+MAMQFMKSGARVRRA  
Sbjct:   335 LKIEKAEADERKKMRELEREMEGIEEEDEEVEEGTGEKNPYLQMAMQFMKSGARVRRASN 394

Query:   403 KGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRXXXXXXXXXXXXX 462
             K LP+YLERGVDVKF+DVAGLGKIRLELEEIVKFFTHGEMYRRRGV+             
Sbjct:   395 KRLPEYLERGVDVKFTDVAGLGKIRLELEEIVKFFTHGEMYRRRGVKIPGGILLCGPPGV 454

Query:   463 XKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAV 522
              KTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVR+LYQEA++NAPSVVFIDELDAV
Sbjct:   455 GKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRALYQEARENAPSVVFIDELDAV 514

Query:   523 GRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRK 582
             GRERGLIKGSGGQERDATLNQLLV LDGFEGRG VITIASTNRPDILDPALVRPGRFDRK
Sbjct:   515 GRERGLIKGSGGQERDATLNQLLVSLDGFEGRGEVITIASTNRPDILDPALVRPGRFDRK 574

Query:   583 IFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDG 642
             IFIPKPGLIGRMEIL+VHARKKPMA+D+DY+AVASMTDGMVGAELANIVE+AAINMMRDG
Sbjct:   575 IFIPKPGLIGRMEILQVHARKKPMAEDLDYMAVASMTDGMVGAELANIVEIAAINMMRDG 634

Query:   643 RTEITTDDLLQAAQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIA 702
             RTE+TTDDLLQAAQIEERGMLDRK+RS ETWRQVAINEAAMAVVAVNFPD+KNIEF+TI 
Sbjct:   635 RTELTTDDLLQAAQIEERGMLDRKDRSLETWRQVAINEAAMAVVAVNFPDMKNIEFLTIN 694

Query:   703 PRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETA 762
             PRAGRELGYVR+KMDH+KFKEGMLSRQS+LDHITVQLAPRAADELW GE QLSTIWAET+
Sbjct:   695 PRAGRELGYVRVKMDHIKFKEGMLSRQSILDHITVQLAPRAADELWYGEDQLSTIWAETS 754

Query:   763 DNARSAARTFVLGGLSDKHFGLSNFWVADRINEIDTEALRILNLCYERAKEILQRNRNLL 822
             DNARSAAR+ VLGGLSDKH GL+NFWVADRIN+ID EALRILN+CYERAKEIL RNR L+
Sbjct:   755 DNARSAARSLVLGGLSDKHHGLNNFWVADRINDIDVEALRILNMCYERAKEILGRNRTLM 814

Query:   823 DAVVNELVEKKSLTKQEFFHLVELHGSLEPMPPSIVDIRAAKHSEIQEIMTNQNVTS 879
             D VV +LV+KKSLTKQEFF LVEL+GS +PMPPSI+++R  K  E++E++   ++T+
Sbjct:   815 DEVVEKLVQKKSLTKQEFFTLVELYGSSKPMPPSILELRKIKRLELEEMVLKLDMTT 871
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004176 "ATP-dependent peptidase activity" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
UNIPROTKB|Q3AFJ8 ftsH "ATP-dependent zinc metalloprotease FtsH" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0214 CHY_0214 "cell division protein FtsH" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:2157637 VAR1 "VARIEGATED 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0064 BA_0064 "cell division protein FtsH" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1809 GSU_1809 "cell division protein FtsH" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P37476 ftsH "ATP-dependent zinc metalloprotease FtsH" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LNU8 ftsH "ATP-dependent zinc metalloprotease FtsH" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3105 SPO_3105 "ATP-dependent metalloprotease FtsH" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P0C5C0 ftsH "ATP-dependent zinc metalloprotease FtsH" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24LOW CONFIDENCE prediction!
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-136
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-121
CHL00176638 CHL00176, ftsH, cell division protein; Validated 1e-115
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 6e-87
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-85
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-80
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-75
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-65
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-57
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-56
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-54
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-50
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-50
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 3e-41
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 5e-36
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-30
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-25
pfam01434212 pfam01434, Peptidase_M41, Peptidase family M41 3e-17
smart00382148 smart00382, AAA, ATPases associated with a variety 5e-17
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-16
PRK13342413 PRK13342, PRK13342, recombination factor protein R 3e-07
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 8e-06
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 9e-06
TIGR00763775 TIGR00763, lon, ATP-dependent protease La 1e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-05
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 1e-04
PLN03086567 PLN03086, PLN03086, PRLI-interacting factor K; Pro 2e-04
COG0466782 COG0466, Lon, ATP-dependent Lon protease, bacteria 4e-04
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 4e-04
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 4e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
COG1224450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 0.001
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.001
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 0.001
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.002
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.002
pfam03938157 pfam03938, OmpH, Outer membrane protein (OmpH-like 0.002
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.002
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 0.003
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 0.004
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information 
 Score =  414 bits (1067), Expect = e-136
 Identities = 210/482 (43%), Positives = 285/482 (59%), Gaps = 43/482 (8%)

Query: 387 AMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRR 446
           A  F KS A++            E    V F DVAG+ + + EL EIV F  +   + + 
Sbjct: 34  AFSFGKSKAKL----------LNEEKPKVTFKDVAGIDEAKEELMEIVDFLKNPSKFTKL 83

Query: 447 GVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEA 506
           G +IP G+LL GPPG GKTLLAKAVAGEAGV FFSIS S FVE++VGVGASRVR L+++A
Sbjct: 84  GAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQA 143

Query: 507 KDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRP 566
           K NAP ++FIDE+DAVGR+RG   G G  ER+ TLNQLLV +DGF     VI IA+TNRP
Sbjct: 144 KKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFGTNTGVIVIAATNRP 203

Query: 567 DILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAE 626
           D+LDPAL+RPGRFDR++ +  P + GR EILKVHA+ K +A DVD  AVA  T G  GA+
Sbjct: 204 DVLDPALLRPGRFDRQVVVDLPDIKGREEILKVHAKNKKLAPDVDLKAVARRTPGFSGAD 263

Query: 627 LANIVEVAAINMMRDGRTEITTDDLLQA-----AQIEERGMLDRKERSSETWRQVAINEA 681
           LAN++  AA+   R  +TEIT +D+ +A     A  E++  +  ++      + VA +EA
Sbjct: 264 LANLLNEAALLAARKNKTEITMNDIEEAIDRVIAGPEKKSRVISEKEK----KLVAYHEA 319

Query: 682 AMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLSRQSLLDHITVQLAP 741
             A+V +   D   +  VTI PR G+ LGY +   +  K    + ++  LL  I V L  
Sbjct: 320 GHALVGLLLKDADPVHKVTIIPR-GQALGYTQFLPEEDK---YLYTKSQLLAQIAVLLGG 375

Query: 742 RAADELWCGEGQLSTIWAETADNARSAARTFVLG-GLSDK------------HFGLSNFW 788
           RAA+E+  GE  ++T  +     A + AR  V   G+SDK             F    F 
Sbjct: 376 RAAEEIIFGE--VTTGASNDIKQATNIARAMVTEWGMSDKLGPVAYGSDGGDVFLGRGFA 433

Query: 789 VADRINE-----IDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHL 843
            A   +E     ID E  RI+   Y+RAK+IL  NR+ L+ +   L+EK+++T++E   L
Sbjct: 434 KAKEYSEETAREIDEEVKRIIEEAYKRAKQILTENRDELELLAKALLEKETITREEIKEL 493

Query: 844 VE 845
           + 
Sbjct: 494 LA 495

HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 495
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|216502 pfam01434, Peptidase_M41, Peptidase family M41 Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 884
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
CHL00176638 ftsH cell division protein; Validated 100.0
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
PF01434213 Peptidase_M41: Peptidase family M41 This is family 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.98
CHL00195489 ycf46 Ycf46; Provisional 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.97
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.97
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.97
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.97
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.96
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.96
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.96
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.94
PRK10865857 protein disaggregation chaperone; Provisional 99.94
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.94
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.93
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.93
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.93
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.93
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.92
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.9
CHL00095821 clpC Clp protease ATP binding subunit 99.86
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.86
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.83
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 99.77
PF00004132 AAA: ATPase family associated with various cellula 99.74
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.74
CHL00181287 cbbX CbbX; Provisional 99.73
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.73
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.72
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.7
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.69
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.69
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.67
COG0488530 Uup ATPase components of ABC transporters with dup 99.67
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.64
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.55
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.54
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.54
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.52
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.52
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.51
PRK00149450 dnaA chromosomal replication initiation protein; R 99.5
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.48
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.48
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.43
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.42
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.41
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.4
KOG2028554 consensus ATPase related to the helicase subunit o 99.39
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.39
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK14087450 dnaA chromosomal replication initiation protein; P 99.38
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.37
PRK13342413 recombination factor protein RarA; Reviewed 99.36
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.36
PRK14088440 dnaA chromosomal replication initiation protein; P 99.35
PRK12422445 chromosomal replication initiation protein; Provis 99.34
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK14086617 dnaA chromosomal replication initiation protein; P 99.33
PRK04195482 replication factor C large subunit; Provisional 99.33
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.31
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.31
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.31
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.31
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.3
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.3
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.3
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK06893229 DNA replication initiation factor; Validated 99.29
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.29
PTZ001121164 origin recognition complex 1 protein; Provisional 99.28
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.27
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.27
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.27
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.27
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.27
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.27
PLN03025319 replication factor C subunit; Provisional 99.26
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.25
PRK07940394 DNA polymerase III subunit delta'; Validated 99.25
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK12402337 replication factor C small subunit 2; Reviewed 99.23
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.22
PRK13341 725 recombination factor protein RarA/unknown domain f 99.22
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.22
CHL00095 821 clpC Clp protease ATP binding subunit 99.21
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.2
PHA02544316 44 clamp loader, small subunit; Provisional 99.2
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.2
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.2
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.2
PRK10865 857 protein disaggregation chaperone; Provisional 99.19
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.19
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.18
PRK08084235 DNA replication initiation factor; Provisional 99.17
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.17
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.17
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.16
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.16
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.15
PRK08727233 hypothetical protein; Validated 99.15
PRK05642234 DNA replication initiation factor; Validated 99.15
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.14
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.14
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.13
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.13
COG0593408 DnaA ATPase involved in DNA replication initiation 99.12
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.11
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.1
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.09
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.08
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.08
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.07
PRK00440319 rfc replication factor C small subunit; Reviewed 99.07
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.06
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.04
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.03
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.02
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.01
PRK06620214 hypothetical protein; Validated 99.01
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.0
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.98
PRK11147635 ABC transporter ATPase component; Reviewed 98.97
COG0714329 MoxR-like ATPases [General function prediction onl 98.97
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.95
smart00350509 MCM minichromosome maintenance proteins. 98.95
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.94
PHA02244383 ATPase-like protein 98.93
PRK09087226 hypothetical protein; Validated 98.92
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.92
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.92
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.9
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.9
PRK13531498 regulatory ATPase RavA; Provisional 98.87
smart00382148 AAA ATPases associated with a variety of cellular 98.83
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.83
PRK05707328 DNA polymerase III subunit delta'; Validated 98.79
PRK07471365 DNA polymerase III subunit delta'; Validated 98.78
PRK09862506 putative ATP-dependent protease; Provisional 98.75
KOG0062582 consensus ATPase component of ABC transporters wit 98.75
PRK09112351 DNA polymerase III subunit delta'; Validated 98.75
PRK04132846 replication factor C small subunit; Provisional 98.75
PRK05564313 DNA polymerase III subunit delta'; Validated 98.75
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.71
PLN03073718 ABC transporter F family; Provisional 98.7
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.68
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.68
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.67
PF07726131 AAA_3: ATPase family associated with various cellu 98.64
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.64
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.63
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.6
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.6
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.6
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.6
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.56
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.56
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.55
PRK06871325 DNA polymerase III subunit delta'; Validated 98.55
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.54
PRK07399314 DNA polymerase III subunit delta'; Validated 98.53
PRK07993334 DNA polymerase III subunit delta'; Validated 98.53
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.53
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.53
PRK06964342 DNA polymerase III subunit delta'; Validated 98.53
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.53
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.51
PRK11608326 pspF phage shock protein operon transcriptional ac 98.49
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.49
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.48
COG2204464 AtoC Response regulator containing CheY-like recei 98.47
PRK08058329 DNA polymerase III subunit delta'; Validated 98.47
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.47
PRK15424538 propionate catabolism operon regulatory protein Pr 98.45
PRK08769319 DNA polymerase III subunit delta'; Validated 98.45
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.44
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.44
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.41
COG1221403 PspF Transcriptional regulators containing an AAA- 98.4
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.4
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.4
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.4
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.4
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.39
PRK06090319 DNA polymerase III subunit delta'; Validated 98.38
PRK08699325 DNA polymerase III subunit delta'; Validated 98.34
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.32
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.32
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.32
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.3
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.3
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.26
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.25
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.2
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.2
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.2
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.19
PRK08116268 hypothetical protein; Validated 98.19
PRK06526254 transposase; Provisional 98.18
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.16
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.16
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.15
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.14
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.14
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.12
PRK08181269 transposase; Validated 98.11
PRK09183259 transposase/IS protein; Provisional 98.09
COG4559259 ABC-type hemin transport system, ATPase component 98.07
COG0488530 Uup ATPase components of ABC transporters with dup 98.07
PF13173128 AAA_14: AAA domain 98.06
PRK12377248 putative replication protein; Provisional 98.06
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.05
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 98.05
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.04
PRK07952244 DNA replication protein DnaC; Validated 98.03
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.03
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.02
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.02
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.02
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.02
COG4133209 CcmA ABC-type transport system involved in cytochr 98.01
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 97.97
KOG0480764 consensus DNA replication licensing factor, MCM6 c 97.97
COG4619223 ABC-type uncharacterized transport system, ATPase 97.96
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.94
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.94
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.93
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.93
COG1119257 ModF ABC-type molybdenum transport system, ATPase 97.93
PRK13765637 ATP-dependent protease Lon; Provisional 97.92
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.92
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.92
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.92
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 97.91
PRK05917290 DNA polymerase III subunit delta'; Validated 97.91
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 97.9
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 97.89
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.86
COG4586325 ABC-type uncharacterized transport system, ATPase 97.86
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.85
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.85
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 97.84
PRK15115444 response regulator GlrR; Provisional 97.84
cd03246173 ABCC_Protease_Secretion This family represents the 97.83
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.83
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.82
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.82
COG1127263 Ttg2A ABC-type transport system involved in resist 97.82
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.81
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.8
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.8
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.79
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.78
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.78
COG0410237 LivF ABC-type branched-chain amino acid transport 97.76
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.76
PRK06835329 DNA replication protein DnaC; Validated 97.76
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.75
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.74
PRK08939306 primosomal protein DnaI; Reviewed 97.74
PRK13537306 nodulation ABC transporter NodI; Provisional 97.73
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.73
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.72
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.72
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.71
PF05729166 NACHT: NACHT domain 97.71
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.7
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.7
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.7
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.7
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.69
PRK11147 635 ABC transporter ATPase component; Reviewed 97.68
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.68
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 97.67
PRK06921266 hypothetical protein; Provisional 97.67
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.67
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.66
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.66
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.65
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 97.65
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 97.64
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.63
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.62
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 97.61
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.61
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.61
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.6
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.6
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.58
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.58
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.58
PRK13536340 nodulation factor exporter subunit NodI; Provision 97.58
PRK11607377 potG putrescine transporter ATP-binding subunit; P 97.56
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.55
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.55
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.54
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 97.54
PRK07276290 DNA polymerase III subunit delta'; Validated 97.54
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 97.53
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.53
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.53
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.52
PRK05818261 DNA polymerase III subunit delta'; Validated 97.51
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.51
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.51
PRK11153343 metN DL-methionine transporter ATP-binding subunit 97.5
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 97.5
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.49
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.49
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.48
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.46
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.46
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.45
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.45
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.43
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.43
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.43
COG4987573 CydC ABC-type transport system involved in cytochr 97.43
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.43
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.41
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.4
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.4
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.39
COG4178604 ABC-type uncharacterized transport system, permeas 97.39
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 97.39
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.38
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.38
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.38
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.37
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.37
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.37
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.37
KOG0482721 consensus DNA replication licensing factor, MCM7 c 97.36
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 97.35
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.35
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.35
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.35
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.34
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.34
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.34
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.34
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.33
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.33
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.33
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.32
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.31
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.31
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.31
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.3
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.3
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.3
PRK13409590 putative ATPase RIL; Provisional 97.3
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.3
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.29
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.29
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.28
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.28
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.27
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.27
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.27
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.27
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.26
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 97.26
KOG0062582 consensus ATPase component of ABC transporters wit 97.26
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.25
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.25
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.24
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.24
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.24
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.24
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.24
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.24
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.23
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.23
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.23
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.22
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.22
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.21
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.21
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.21
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.2
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.2
PRK07132299 DNA polymerase III subunit delta'; Validated 97.19
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.18
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.18
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.18
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.17
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.17
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.17
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.17
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.16
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.16
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.16
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.16
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 97.16
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 97.15
COG1101263 PhnK ABC-type uncharacterized transport system, AT 97.14
COG4988559 CydD ABC-type transport system involved in cytochr 97.14
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.14
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.14
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.14
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.14
PRK10908222 cell division protein FtsE; Provisional 97.13
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.13
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.12
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.12
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.12
PRK13545549 tagH teichoic acids export protein ATP-binding sub 97.12
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.1
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.1
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.09
PRK08118167 topology modulation protein; Reviewed 97.09
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.09
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.08
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.08
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 97.08
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.07
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.07
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.07
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.07
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.07
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 97.06
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.06
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.06
COG4525259 TauB ABC-type taurine transport system, ATPase com 97.06
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 97.05
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.04
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.04
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.04
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.03
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.03
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.03
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.03
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.02
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.02
PRK07261171 topology modulation protein; Provisional 97.02
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 97.02
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 97.02
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.02
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 96.98
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.98
PRK14242253 phosphate transporter ATP-binding protein; Provisi 96.98
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 96.97
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 96.97
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 96.97
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.96
PRK10253265 iron-enterobactin transporter ATP-binding protein; 96.96
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 96.96
PRK10070400 glycine betaine transporter ATP-binding subunit; P 96.96
PRK11823446 DNA repair protein RadA; Provisional 96.95
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 96.95
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.95
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 96.94
PRK10261623 glutathione transporter ATP-binding protein; Provi 96.94
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 96.93
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 96.93
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.93
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 96.93
COG4152300 ABC-type uncharacterized transport system, ATPase 96.93
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.93
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 96.93
COG4181228 Predicted ABC-type transport system involved in ly 96.93
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 96.92
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 96.92
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 96.92
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 96.92
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-85  Score=720.84  Aligned_cols=429  Identities=40%  Similarity=0.589  Sum_probs=408.1

Q ss_pred             ccCcccccccccCchhHHHHHHHHHHhhcccccccccccccCCcEEEECCCCCCchhHHHHhhhhhccceeeeecchhhh
Q 002754          410 ERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVE  489 (884)
Q Consensus       410 ~~~~~~~f~~~~gl~~~~~~l~~lv~~~~~~~~~~~~g~~i~~giLL~GPpGtGKTtLakaLA~el~~~~~~is~s~~~~  489 (884)
                      +...++.|+++.|+++.+.++++++.++++|..|.++|.++|+||||+||||||||.|||++||+.++||++.++++|-+
T Consensus       296 ~~~~nv~F~dVkG~DEAK~ELeEiVefLkdP~kftrLGGKLPKGVLLvGPPGTGKTlLARAvAGEA~VPFF~~sGSEFdE  375 (752)
T KOG0734|consen  296 EQMKNVTFEDVKGVDEAKQELEEIVEFLKDPTKFTRLGGKLPKGVLLVGPPGTGKTLLARAVAGEAGVPFFYASGSEFDE  375 (752)
T ss_pred             hhhcccccccccChHHHHHHHHHHHHHhcCcHHhhhccCcCCCceEEeCCCCCchhHHHHHhhcccCCCeEeccccchhh
Confidence            34457889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccccchhhhhHHHHHHhcCCcEEEhhhHHHhhhhcCCCCCCCchhHHHHHHHHHHhhccccCCCceEEEeccCCCCCC
Q 002754          490 IYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDIL  569 (884)
Q Consensus       490 ~~~g~~~~~l~~lf~~a~~~~p~Il~iDEId~l~~~r~~~~~Sgge~~~~~l~~LL~~ld~~~~~~~VlVIatTN~~~~L  569 (884)
                      +|+|++..+++.+|..++..+||||||||||+++..|..   +...+.++++|+||.+||+|..+.+||||++||.|+.|
T Consensus       376 m~VGvGArRVRdLF~aAk~~APcIIFIDEiDavG~kR~~---~~~~y~kqTlNQLLvEmDGF~qNeGiIvigATNfpe~L  452 (752)
T KOG0734|consen  376 MFVGVGARRVRDLFAAAKARAPCIIFIDEIDAVGGKRNP---SDQHYAKQTLNQLLVEMDGFKQNEGIIVIGATNFPEAL  452 (752)
T ss_pred             hhhcccHHHHHHHHHHHHhcCCeEEEEechhhhcccCCc---cHHHHHHHHHHHHHHHhcCcCcCCceEEEeccCChhhh
Confidence            999999999999999999999999999999999988753   34458999999999999999999999999999999999


Q ss_pred             CccCCCCCcccccccCCCCChhhHHHHHHHHHccCCCCCcccHHHHHhhCCCCCHHHHHHHHHHHHHHHHHhCCCccCHH
Q 002754          570 DPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTD  649 (884)
Q Consensus       570 dpaLlr~gRfd~~I~~~~P~~eeR~~Il~~~l~~~~~~~didl~~lA~~t~G~s~adL~~Lv~~A~~~A~~~~~~~It~e  649 (884)
                      |++|+||||||++|.+|.||...|.+||+.|+.++.+..++|+..||+-|.||+|+||++++|.|+..|+.++...+|+.
T Consensus       453 D~AL~RPGRFD~~v~Vp~PDv~GR~eIL~~yl~ki~~~~~VD~~iiARGT~GFsGAdLaNlVNqAAlkAa~dga~~VtM~  532 (752)
T KOG0734|consen  453 DKALTRPGRFDRHVTVPLPDVRGRTEILKLYLSKIPLDEDVDPKIIARGTPGFSGADLANLVNQAALKAAVDGAEMVTMK  532 (752)
T ss_pred             hHHhcCCCccceeEecCCCCcccHHHHHHHHHhcCCcccCCCHhHhccCCCCCchHHHHHHHHHHHHHHHhcCcccccHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCcccccc--chhhhHHHHHHHHHHHHHHHhCCCCCCcceeeecCCCCCcccceeeccccccccccccC
Q 002754          650 DLLQAAQIEERGMLDRKER--SSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKEGMLS  727 (884)
Q Consensus       650 di~~Al~~~~~g~~~~~~~--~~~~~~~vA~hEaGhAvva~ll~~~~~v~~vsI~pr~g~~lG~~~~~~~e~~~~~~~~T  727 (884)
                      |++.|-+++.+| ++++..  +++.++..||||.|||||+.++.+..|++++||.|| |.++|.+.+.|+.   |.+.+|
T Consensus       533 ~LE~akDrIlMG-~ERks~~i~~eak~~TAyHE~GHAivA~yTk~A~PlhKaTImPR-G~sLG~t~~LPe~---D~~~~T  607 (752)
T KOG0734|consen  533 HLEFAKDRILMG-PERKSMVIDEEAKKITAYHEGGHAIVALYTKGAMPLHKATIMPR-GPSLGHTSQLPEK---DRYSIT  607 (752)
T ss_pred             HHhhhhhheeec-ccccccccChhhhhhhhhhccCceEEEeecCCCccccceeeccC-CccccceeecCcc---chhhHH
Confidence            999999999999 777665  888899999999999999999999999999999999 9999999999987   889999


Q ss_pred             HHHHHHHHHHhhhhhhHHHHHcCCCcccccccchHHHHHHHHHHHHh-cCCCCCCCCCCc--------hhhHhhHHHHHH
Q 002754          728 RQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAARTFVL-GGLSDKHFGLSN--------FWVADRINEIDT  798 (884)
Q Consensus       728 r~~l~~~I~v~LaGRAAEel~fG~~~~stga~~Dl~~At~iA~~mV~-~Gms~~~~g~~~--------~~~~~~~~~id~  798 (884)
                      |.++++++.||||||+|||++||.|.+|+||++||++||.+|+.||+ ||||+.. |...        ....++...||.
T Consensus       608 k~q~LA~lDV~MGGRvAEELIfG~D~iTsGAssDl~qAT~lA~~MVt~fGMSd~v-G~v~~~~~~~~~s~~~~t~~lida  686 (752)
T KOG0734|consen  608 KAQLLARLDVCMGGRVAEELIFGTDKITSGASSDLDQATKLARRMVTKFGMSDKV-GPVTLSAEDNSSSLSPRTQELIDA  686 (752)
T ss_pred             HHHHHHHHHHhhcchHHHHHhccCCcccccccchHHHHHHHHHHHHHHcCccccc-cceeeeccCCCCCCCchhHHHHHH
Confidence            99999999999999999999999999999999999999999999999 9999996 3322        344667778999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhcccCHHHHHHHHhhc
Q 002754          799 EALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHLVELH  847 (884)
Q Consensus       799 ev~~lL~~ay~rA~~iL~~nr~~l~~la~~LleketL~~~ei~~il~~~  847 (884)
                      ||.++|+++|+||+.||+.|...|++||++||++|||+++||.+++.+.
T Consensus       687 Ei~~lL~~sYeRak~iL~~h~kEl~~LA~ALleYETL~A~eik~vl~g~  735 (752)
T KOG0734|consen  687 EIKRLLRDSYERAKSILKTHKKELHALAEALLEYETLDAKEIKRVLKGK  735 (752)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999765

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01434 Peptidase_M41: Peptidase family M41 This is family M41 in the peptidase classification Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
2ce7_A476 Edta Treated Length = 476 3e-80
3kds_E465 Apo-ftsh Crystal Structure Length = 465 2e-79
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-71
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-71
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 1e-58
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 4e-57
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-56
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 2e-56
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-51
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 5e-46
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 2e-42
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 1e-40
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 3e-40
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 9e-40
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 3e-39
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 9e-39
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 9e-39
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 6e-38
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 7e-38
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 9e-38
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 9e-38
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 3e-33
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 2e-32
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 6e-32
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 7e-22
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-21
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-21
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 3e-21
3vfd_A389 Human Spastin Aaa Domain Length = 389 4e-20
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 6e-20
1xwi_A322 Crystal Structure Of Vps4b Length = 322 3e-19
3b9p_A297 Spastin Length = 297 1e-17
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 1e-17
2di4_A238 Crystal Structure Of The Ftsh Protease Domain Lengt 6e-11
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 6e-04
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure 
Iteration: 1

 Score =  296 bits (758), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 182/449 (40%), Positives = 259/449 (57%), Gaps = 32/449 (7%)
Query: 415 VKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRXXXXXXXXXXXXXXKTLLAKAVAGE 474
           V F DV G  +   EL+E+V+F      + R G R              KTLLA+AVAGE
Sbjct: 13  VTFKDVGGAEEAIEELKEVVEFLKDPSKFNRIGARMPKGILLVGPPGTGKTLLARAVAGE 72
Query: 475 AGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGG 534
           A V FF IS S FVE++VGVGA+RVR L+ +AK +AP +VFIDE+DAVGR RG   G G 
Sbjct: 73  ANVPFFHISGSDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHRGAGLGGGH 132
Query: 535 QERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRM 594
            ER+ TLNQLLV +DGF+ +  +I +A+TNRPDILDPAL+RPGRFD+KI +  P ++GR 
Sbjct: 133 DEREQTLNQLLVEMDGFDSKEGIIVMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRK 192
Query: 595 EILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQA 654
           +IL++H R KP+A+DV+   +A  T G VGA+L N+V  AA+   R+GR +IT  D  +A
Sbjct: 193 KILEIHTRNKPLAEDVNLEIIAKRTPGFVGADLENLVNEAALLAAREGRDKITMKDFEEA 252
Query: 655 -----AQIEERGMLDRKERSSETWRQVAINEAAMAVVAVNFPDLKNIEFVTIAPRAGREL 709
                A    + +L     S    R +A +EA  AVV+   P+ + +  ++I PR  + L
Sbjct: 253 IDRVIAGPARKSLL----ISPAEKRIIAYHEAGHAVVSTVVPNGEPVHRISIIPRGYKAL 308
Query: 710 GYVRMKMDHMKFKEGMLSRQSLLDHITVQLAPRAADELWCGEGQLSTIWAETADNARSAA 769
           GY     +  K+   ++SR  LLD +T  L  RAA+E+  G+  +++  A   + A   A
Sbjct: 309 GYTLHLPEEDKY---LVSRNELLDKLTALLGGRAAEEVVFGD--VTSGAANDIERATEIA 363
Query: 770 RTFV--------LGGLS----------DKHFGLSNFWVADRINEIDTEALRILNLCYERA 811
           R  V        LG L+           K       +  +  ++ID E  +I+  CYERA
Sbjct: 364 RNMVCQLGMSEELGPLAWGKEEQEVFLGKEITRLRNYSEEVASKIDEEVKKIVTNCYERA 423
Query: 812 KEILQRNRNLLDAVVNELVEKKSLTKQEF 840
           KEI+++ R  LD +V  L+EK+++   E 
Sbjct: 424 KEIIRKYRKQLDNIVEILLEKETIEGDEL 452
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2DI4|A Chain A, Crystal Structure Of The Ftsh Protease Domain Length = 238 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-142
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 1e-141
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-114
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 1e-113
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-112
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-112
2r62_A268 Cell division protease FTSH homolog; ATPase domain 1e-111
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-93
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-86
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 6e-81
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-81
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-66
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 9e-81
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 4e-63
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 9e-61
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 9e-61
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 9e-60
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 5e-59
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-58
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 2e-58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-54
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-52
2krk_A86 26S protease regulatory subunit 8; structural geno 7e-22
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-20
3kw6_A78 26S protease regulatory subunit 8; structural geno 4e-20
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 4e-19
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-18
2di4_A238 Zinc protease, cell division protein FTSH homolog; 8e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 5e-15
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 8e-15
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 2e-08
3pvs_A447 Replication-associated recombination protein A; ma 6e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-05
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 3e-05
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-04
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 1e-04
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 4e-04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 6e-04
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 9e-04
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
 Score =  431 bits (1110), Expect = e-142
 Identities = 199/482 (41%), Positives = 273/482 (56%), Gaps = 48/482 (9%)

Query: 387 AMQFMKSGARVRRAYGKGLPQYLERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRR 446
           A  F KS ARV           L     V F DVAG  + + EL+EIV+F  +   +   
Sbjct: 11  AFSFTKSRARV-----------LTEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEM 59

Query: 447 GVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEA 506
           G RIP G+LL GPPGVGKT LA+AVAGEA V F + S S FVE++VGVGA+RVR L++ A
Sbjct: 60  GARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETA 119

Query: 507 KDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRP 566
           K +AP +VFIDE+DAVGR+RG   G G  ER+ TLNQLLV +DGFE    ++ +A+TNRP
Sbjct: 120 KRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTAIVVMAATNRP 179

Query: 567 DILDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAE 626
           DILDPAL+RPGRFDR+I I  P + GR +IL++HAR KP+A+DVD   +A  T G VGA+
Sbjct: 180 DILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGAD 239

Query: 627 LANIVEVAAINMMRDGRTEITTDDLLQA-----AQIEERGM-LDRKERSSETWRQVAINE 680
           L N++  AA+   R+GR +IT  DL +A         ++ + L  ++R     R  A +E
Sbjct: 240 LENLLNEAALLAAREGRRKITMKDLEEAADRVMMLPAKKSLVLSPRDR-----RITAYHE 294

Query: 681 AAMAVVAVNFPDLKNIEFVTIAPRAGRELGYVRMKMDHMKFKE--GMLSRQSLLDHITVQ 738
           A  A+ A        +  VTI PR GR LG++      M  +E     SR+ LLD I V 
Sbjct: 295 AGHALAAHFLEHADGVHKVTIVPR-GRALGFM------MPRREDMLHWSRKRLLDQIAVA 347

Query: 739 LAPRAADELWCGEGQLSTIWAETADNARSAARTFVLG-GLSDK-------------HFGL 784
           LA RAA+E+   +  ++T        A   AR  +   G+  +               G 
Sbjct: 348 LAGRAAEEIVFDD--VTTGAENDFRQATELARRMITEWGMHPEFGPVAYAVREDTYLGGY 405

Query: 785 SNFWVADRI-NEIDTEALRILNLCYERAKEILQRNRNLLDAVVNELVEKKSLTKQEFFHL 843
                ++     ID    R++   Y+R K +L   R +L+ V   L+E+++LT +EF  +
Sbjct: 406 DVRQYSEETAKRIDEAVRRLIEEQYQRVKALLLEKREVLERVAETLLERETLTAEEFQRV 465

Query: 844 VE 845
           VE
Sbjct: 466 VE 467
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Length = 238 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 884
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-94
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-94
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 9e-64
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 9e-54
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 7e-50
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 9e-39
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-32
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-28
d2ce7a1193 a.269.1.1 (A:411-603) Cell division protein FtsH, 5e-26
d2di4a1202 a.269.1.1 (A:406-607) Cell division protein FtsH, 2e-25
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-25
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 7e-20
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-15
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-13
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-11
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-10
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 3e-09
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 3e-09
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 1e-05
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 3e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 8e-04
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.001
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.003
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  294 bits (755), Expect = 3e-94
 Identities = 124/245 (50%), Positives = 174/245 (71%)

Query: 410 ERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAK 469
           E  +   F+DVAG  + + E+ E+V++      +++ G +IP G+L+ GPPG GKTLLAK
Sbjct: 4   EDQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAK 63

Query: 470 AVAGEAGVNFFSISASQFVEIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLI 529
           A+AGEA V FF+IS S FVE++VGVGASRVR ++++AK  AP ++FIDE+DAVGR+RG  
Sbjct: 64  AIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAG 123

Query: 530 KGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIFIPKPG 589
            G G  ER+ TLNQ+LV +DGFEG   +I IA+TNRPD+LDPAL+RPGRFDR++ +  P 
Sbjct: 124 LGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPD 183

Query: 590 LIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITTD 649
           + GR +ILKVH R+ P+A D+D   +A  T G  GA+LAN+V  AA+   R  +  ++  
Sbjct: 184 VRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMV 243

Query: 650 DLLQA 654
           +  +A
Sbjct: 244 EFEKA 248
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 193 Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 202 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query884
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d2di4a1202 Cell division protein FtsH, C-terminal domain {Aqu 100.0
d2ce7a1193 Cell division protein FtsH, C-terminal domain {The 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.9
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.86
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.83
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.82
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.79
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.67
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.65
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.64
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.63
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.62
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.62
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.61
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.6
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.58
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.58
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.56
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.51
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.49
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.48
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.47
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.43
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.33
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.28
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.26
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.12
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.07
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.82
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.77
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.72
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.55
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.49
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.42
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.35
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.34
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.33
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.31
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.28
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.27
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.26
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.23
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.22
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.22
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.21
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.17
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.16
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.12
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.1
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.08
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.05
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.98
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.81
d1zboa1197 Hypothetical protein BPP1347 {Bordetella parapertu 97.72
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.27
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.19
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.17
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.08
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.99
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.97
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.96
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.94
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.93
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.91
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.77
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.76
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.73
d2qy9a2211 GTPase domain of the signal recognition particle r 96.73
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.7
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.69
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.67
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.64
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.61
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.6
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.59
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.56
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.52
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.49
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.47
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.46
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.45
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.43
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.41
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.4
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.37
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.34
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.34
d1vmaa2213 GTPase domain of the signal recognition particle r 96.3
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.28
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.27
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.27
d1okkd2207 GTPase domain of the signal recognition particle r 96.15
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.14
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.05
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.89
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.76
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.58
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.38
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.38
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.3
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.23
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.23
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.22
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.21
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.2
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.15
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.12
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.99
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.93
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.86
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.84
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.83
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.81
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.78
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.73
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.55
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.35
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.31
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.06
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.72
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.67
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.65
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.62
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.55
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.42
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.32
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.24
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.17
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.02
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.82
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.63
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.61
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.44
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.22
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.2
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.13
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.0
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.98
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.93
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.9
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.89
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.83
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 91.77
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.74
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.71
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.7
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.69
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.68
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.49
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 91.48
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.4
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.21
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.2
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.1
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.67
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.64
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.63
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.59
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.58
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.37
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.34
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.34
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.2
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.16
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.13
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.12
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.12
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.08
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.08
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.04
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.89
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.86
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.75
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 89.73
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.67
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.65
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.59
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.54
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.34
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 89.29
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.26
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.04
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.03
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.02
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.96
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.92
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.82
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 88.74
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.66
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.62
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.55
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.39
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.33
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.3
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 88.23
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.23
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.05
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.03
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.02
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.96
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.95
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.92
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.73
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.67
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.6
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.44
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.39
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.33
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 87.33
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.32
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.75
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.7
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.67
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 86.47
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.44
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 86.16
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.98
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.59
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.59
d1xpua3289 Transcription termination factor Rho, ATPase domai 85.39
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 85.07
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.71
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.66
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.12
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 82.88
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.68
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 81.34
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.7e-43  Score=308.62  Aligned_cols=253  Identities=49%  Similarity=0.835  Sum_probs=237.3

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCHHH
Q ss_conf             34676422346558636999999999860143001034663477179978999982257888663305634663122012
Q 002754          409 LERGVDVKFSDVAGLGKIRLELEEIVKFFTHGEMYRRRGVRIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFV  488 (884)
Q Consensus       409 ~~~~~~~~l~~~~gl~~~v~~l~~iv~~l~~~~l~~~~g~~i~~gilL~GppGtGKTtLakaLA~el~~~~~~is~s~~~  488 (884)
                      .++...+.|+|+.|+++.+..+.+++.++..+..+.++|...|+|+||+||||||||++++++|.+++.+++.++++++.
T Consensus         3 ~~~~~~~t~~Di~Gl~~~k~~l~e~v~~~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~   82 (256)
T d1lv7a_           3 TEDQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV   82 (256)
T ss_dssp             EECSSCCCGGGSCSCHHHHHHTHHHHHHHHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSST
T ss_pred             CCCCCCCCHHHHHCHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEHHHHH
T ss_conf             88899989999816399999999999998799999986999888678668998882289999999829987998869942


Q ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             32203541123327899883699578826478864202777899811489999999873116457896489822599887
Q 002754          489 EIYVGVGASRVRSLYQEAKDNAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVCLDGFEGRGNVITIASTNRPDI  568 (884)
Q Consensus       489 ~~~~g~~~~~l~~lf~~a~~~~p~Ii~lDEid~l~~~r~~~~~sgge~~~~~l~~LL~~ld~~~~~~~viVI~tTN~~~~  568 (884)
                      +.|+|.+...++.+|+.++...|||+|+||+|.++..++....++......+++.|+..+|++....+++||+|||+++.
T Consensus        83 ~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatTn~~~~  162 (256)
T d1lv7a_          83 EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDV  162 (256)
T ss_dssp             TSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEESCTTT
T ss_pred             HCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCC
T ss_conf             60010789999999999997599899997756657567898888748999999999999538777799899980799310


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             89667789953333457999966699999999812999870018999841899979999999999999999909985599
Q 002754          569 LDPALVRPGRFDRKIFIPKPGLIGRMEILKVHARKKPMADDVDYLAVASMTDGMVGAELANIVEVAAINMMRDGRTEITT  648 (884)
Q Consensus       569 ldpaLlrpgRfd~~I~i~~P~~eer~~Il~~~l~~~~~~~~~~l~~lA~~t~G~s~adL~~lv~~A~~~A~~~~~~~It~  648 (884)
                      +||+++|||||+..|+|++|+.++|.+|++.++.+.....++++..++..|.||+++||.++|++|...+.++++..|+.
T Consensus       163 ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~~~~~i~~  242 (256)
T d1lv7a_         163 LDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSM  242 (256)
T ss_dssp             SCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHTTCSSBCH
T ss_pred             CCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             79857689878779877995999999999984259986865699999986899899999999999999999828983489


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             8999999999829
Q 002754          649 DDLLQAAQIEERG  661 (884)
Q Consensus       649 edi~~Ai~~~~~g  661 (884)
                      +|+..|++++..|
T Consensus       243 ~d~~~Al~rv~~g  255 (256)
T d1lv7a_         243 VEFEKAKDKIMMG  255 (256)
T ss_dssp             HHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999999669
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure