Citrus Sinensis ID: 002835
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 875 | 2.2.26 [Sep-21-2011] | |||||||
| Q5ZMM3 | 475 | Rho GTPase-activating pro | yes | no | 0.230 | 0.425 | 0.277 | 3e-15 | |
| Q8IWW6 | 846 | Rho GTPase-activating pro | yes | no | 0.328 | 0.339 | 0.234 | 2e-13 | |
| Q9BE31 | 847 | Rho GTPase-activating pro | N/A | no | 0.328 | 0.338 | 0.234 | 6e-13 | |
| Q8C0D4 | 838 | Rho GTPase-activating pro | yes | no | 0.196 | 0.205 | 0.275 | 1e-12 | |
| Q7Z5H3 | 698 | Rho GTPase-activating pro | no | no | 0.418 | 0.524 | 0.232 | 1e-12 | |
| Q53QZ3 | 475 | Rho GTPase-activating pro | no | no | 0.230 | 0.425 | 0.259 | 2e-12 | |
| Q8BL80 | 702 | Rho GTPase-activating pro | no | no | 0.323 | 0.403 | 0.246 | 3e-12 | |
| Q8C4V1 | 747 | Rho GTPase-activating pro | no | no | 0.283 | 0.331 | 0.239 | 1e-11 | |
| Q5U2Z7 | 748 | Rho GTPase-activating pro | no | no | 0.281 | 0.328 | 0.244 | 2e-11 | |
| Q91YM2 | 1499 | Rho GTPase-activating pro | no | no | 0.180 | 0.105 | 0.271 | 3e-11 |
| >sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 84.7 bits (208), Expect = 3e-15, Method: Compositional matrix adjust.
Identities = 63/227 (27%), Positives = 112/227 (49%), Gaps = 25/227 (11%)
Query: 216 SVEQLKEK-PVKFPVIGRPILLALEDVDGT-PSFLEKAIRFIEEHGVQVEGILRQA---A 270
S++ L+EK +K + G + L E + T P F+ + I+ +E G++V+GI R + A
Sbjct: 264 SLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVERRGLEVDGIYRVSGNLA 323
Query: 271 YVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRT-D 329
+ + + + E+ + S ED H++ +K RELP P +EA + D
Sbjct: 324 TIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYCFFEQFVEAIKIQD 383
Query: 330 RGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPL 389
+R+ A++T +++ P PN ++ + ++ +A+ ++ N MST ++ P LLRP
Sbjct: 384 NATRIKAVKT-LVKKLPRPNYDTMKVLFEHLKKIAAKESVNLMSTQSLGIVFGPTLLRP- 441
Query: 390 LAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFG 436
E ET G+ + +L + IV +L EY KIFG
Sbjct: 442 -----EKET-----GNMAVHML-------YQNQIVELMLSEYSKIFG 471
|
GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Gallus gallus (taxid: 9031) |
| >sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 875 | ||||||
| 224063307 | 904 | predicted protein [Populus trichocarpa] | 0.848 | 0.820 | 0.612 | 0.0 | |
| 224084580 | 857 | predicted protein [Populus trichocarpa] | 0.818 | 0.835 | 0.606 | 0.0 | |
| 255545924 | 980 | conserved hypothetical protein [Ricinus | 0.787 | 0.703 | 0.644 | 0.0 | |
| 334186887 | 933 | Rho GTPase activation protein (RhoGAP) w | 0.872 | 0.817 | 0.571 | 0.0 | |
| 297799548 | 925 | predicted protein [Arabidopsis lyrata su | 0.868 | 0.821 | 0.566 | 0.0 | |
| 356510094 | 927 | PREDICTED: uncharacterized protein LOC10 | 0.793 | 0.748 | 0.540 | 0.0 | |
| 357493921 | 920 | Rho GTPase-activating protein [Medicago | 0.825 | 0.784 | 0.534 | 0.0 | |
| 302142043 | 900 | unnamed protein product [Vitis vinifera] | 0.785 | 0.763 | 0.556 | 0.0 | |
| 224105983 | 872 | predicted protein [Populus trichocarpa] | 0.784 | 0.786 | 0.558 | 0.0 | |
| 357465311 | 900 | Rho GTPase-activating protein [Medicago | 0.817 | 0.794 | 0.554 | 0.0 |
| >gi|224063307|ref|XP_002301088.1| predicted protein [Populus trichocarpa] gi|222842814|gb|EEE80361.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 839 bits (2167), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 486/793 (61%), Positives = 583/793 (73%), Gaps = 51/793 (6%)
Query: 79 RAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGI 138
GN +FKSGPLFISSKGIGWTSWKKRWFILT TSLVFFRS+PSAIPQKGSEVNLTLGGI
Sbjct: 25 HGGNVIFKSGPLFISSKGIGWTSWKKRWFILTRTSLVFFRSNPSAIPQKGSEVNLTLGGI 84
Query: 139 DLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSA 198
DLNNSGSVVV+ADKKLLTVLFPDGRDGRAFTLKAE+ EDLY WKTALENALAQAPST
Sbjct: 85 DLNNSGSVVVRADKKLLTVLFPDGRDGRAFTLKAETSEDLYGWKTALENALAQAPSTSLV 144
Query: 199 TGQNGILKNDKAEAANGSVEQLKEK-PVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEE 257
GQNGI ++D+A+ A+GS+EQLK+K PVK VIGRPILLA+EDVDG+PSFLEKA+RFIE+
Sbjct: 145 MGQNGIFRDDQADGADGSLEQLKDKHPVKSLVIGRPILLAIEDVDGSPSFLEKALRFIED 204
Query: 258 HGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPAS 317
HG++VEGILRQAA VDDV RI+E+EQG TEFSP+EDAH+IADCVKY +RELPSSPVP S
Sbjct: 205 HGIKVEGILRQAADVDDVEHRIKEYEQGTTEFSPKEDAHVIADCVKYFLRELPSSPVPTS 264
Query: 318 CCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAV 377
CCNALLEA RTDRGSRV+AMR A+ ETFPEPNR+LLQRIL+MMQTVAS K NRMSTSAV
Sbjct: 265 CCNALLEAWRTDRGSRVNAMRVAVCETFPEPNRRLLQRILLMMQTVASHKAVNRMSTSAV 324
Query: 378 AACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGE 437
AACMAPLLLRPLLAG+CEIE++FNVGGDGS QLL+AAAAANHAQAIVITLLEEY+KIF E
Sbjct: 325 AACMAPLLLRPLLAGDCEIESNFNVGGDGSIQLLKAAAAANHAQAIVITLLEEYEKIFSE 384
Query: 438 GSASPEELYSESELSGSGTEEATDDDESYEDDDQDGATPESDAYTDDDLDNASSRSCSES 497
GS SP LYS+S+ GS EE TDDDESY DD AT ESD YTD D DNASS +C++S
Sbjct: 385 GSMSP-GLYSDSDECGSEDEEVTDDDESYVDD----ATEESDVYTDADNDNASSGTCTQS 439
Query: 498 GESGDSVVYKDKKNIAPFLYYVLKMQDVGVGSKSPER--NDNSEINQNPSSTSHEKALPQ 555
G+S + P + + D+ G K PE +++ ++ Q SS + +LP
Sbjct: 440 GDSCED---------DPSDHEMQGSDDLSSGFKYPEAEVDNDLKVEQKLSSHPVQASLPD 490
Query: 556 NEDVKDSKNIQNQSENNSSRQVNESAELLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNE 615
D QS + + ++S +L VDVS+ TS E K+ + +K++ +SN
Sbjct: 491 TPD---------QSNYSLAMLPDKSDDLSVDVSTETSLENKIADYNASPNAKKTTTISNG 541
Query: 616 SVYGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILE 675
V G KRPTVWGRTAA+KNLSMESID P + +VEIQ+LE TK ++Q I++EVKGN IL+
Sbjct: 542 LVRG-KRPTVWGRTAAKKNLSMESIDYPIEEDVEIQKLEATKIEMQNIISEEVKGNAILQ 600
Query: 676 ASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTK 735
A+LE + KA HE RLAL+ DVARL++QLQKER+KR +EAGL G +P TIDEK K
Sbjct: 601 ANLEKQTKAFHEYRLALQQDVARLQEQLQKEREKRKFLEAGLNTSKGPLQVPVTIDEKMK 660
Query: 736 VELGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSNQ-----LHQTSTKLKDK 790
EL EI QAE D+ NLKQK DL QL++Q ++ G + NQ LH+ K +
Sbjct: 661 AELEEITQAEADVANLKQKVDDLHAQLNQQCDERSGSMHGLGNQPMNASLHK--AKGNGE 718
Query: 791 QRDNEAAAERLRIKQEVNKDGAAESDNEKKQESLSFPNKLPPQNQQVDSMHTVTSRSTAP 850
++D EA A + + +KD + + QQ+DS H SR +
Sbjct: 719 EKDAEATASS-QFGRSASKDTCMDG----------------AETQQLDSKHCGNSRPISS 761
Query: 851 INSRKSGTRSEFL 863
NS++SG RSE +
Sbjct: 762 TNSKRSGARSEGM 774
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224084580|ref|XP_002307345.1| predicted protein [Populus trichocarpa] gi|222856794|gb|EEE94341.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255545924|ref|XP_002514022.1| conserved hypothetical protein [Ricinus communis] gi|223547108|gb|EEF48605.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|334186887|ref|NP_194189.6| Rho GTPase activation protein (RhoGAP) with PH domain [Arabidopsis thaliana] gi|332659528|gb|AEE84928.1| Rho GTPase activation protein (RhoGAP) with PH domain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297799548|ref|XP_002867658.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313494|gb|EFH43917.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356510094|ref|XP_003523775.1| PREDICTED: uncharacterized protein LOC100796201 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357493921|ref|XP_003617249.1| Rho GTPase-activating protein [Medicago truncatula] gi|355518584|gb|AET00208.1| Rho GTPase-activating protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|302142043|emb|CBI19246.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224105983|ref|XP_002314002.1| predicted protein [Populus trichocarpa] gi|222850410|gb|EEE87957.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357465311|ref|XP_003602937.1| Rho GTPase-activating protein [Medicago truncatula] gi|355491985|gb|AES73188.1| Rho GTPase-activating protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 875 | ||||||
| TAIR|locus:2150265 | 870 | AT5G19390 [Arabidopsis thalian | 0.860 | 0.865 | 0.476 | 1.4e-167 | |
| TAIR|locus:2176992 | 827 | AT5G12150 [Arabidopsis thalian | 0.408 | 0.431 | 0.638 | 1.4e-163 | |
| ZFIN|ZDB-GENE-090313-87 | 698 | arhgap22 "Rho GTPase activatin | 0.158 | 0.199 | 0.296 | 1e-16 | |
| UNIPROTKB|Q5ZMM3 | 475 | ARHGAP15 "Rho GTPase-activatin | 0.196 | 0.362 | 0.268 | 5.1e-14 | |
| RGD|1310017 | 813 | Arhgap12 "Rho GTPase activatin | 0.196 | 0.211 | 0.275 | 1.5e-13 | |
| MGI|MGI:1922665 | 838 | Arhgap12 "Rho GTPase activatin | 0.196 | 0.205 | 0.275 | 6.7e-13 | |
| ZFIN|ZDB-GENE-070912-314 | 465 | arhgap15 "Rho GTPase activatin | 0.228 | 0.430 | 0.258 | 9.4e-13 | |
| UNIPROTKB|Q504X1 | 841 | ARHGAP12 "Rho GTPase-activatin | 0.196 | 0.204 | 0.269 | 1.1e-12 | |
| UNIPROTKB|Q8IWW6 | 846 | ARHGAP12 "Rho GTPase-activatin | 0.196 | 0.203 | 0.269 | 1.1e-12 | |
| ZFIN|ZDB-GENE-030131-3922 | 970 | arhgap27 "Rho GTPase activatin | 0.232 | 0.209 | 0.282 | 1.2e-12 |
| TAIR|locus:2150265 AT5G19390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1630 (578.8 bits), Expect = 1.4e-167, P = 1.4e-167
Identities = 370/777 (47%), Positives = 479/777 (61%)
Query: 80 AGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGID 139
A N VFKSGPLFISSKG+GWTSWKKRWFILT TSLVFF++DP +PQKG EVNLTLGGID
Sbjct: 15 ASNTVFKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPGTLPQKGGEVNLTLGGID 74
Query: 140 LNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSAT 199
LNNSGSVVV+ DKKLLTVLFPDGRDGRAFTLKAE+ EDLY+WKTALE ALAQAP+
Sbjct: 75 LNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETFEDLYEWKTALEQALAQAPNAALIM 134
Query: 200 GQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHG 259
GQNGI + AE N ++E +++P+K V+GRPILLALED+DG+PSFLEKA++FIE++G
Sbjct: 135 GQNGIFR---AET-NEAIEGREKRPLKSLVVGRPILLALEDIDGSPSFLEKALQFIEKYG 190
Query: 260 VQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCC 319
++EGILRQ+A V++V RR++E+EQGKTEF+ +ED H++ DC+K+V+RELPSSPV ASCC
Sbjct: 191 TKIEGILRQSADVEEVERRVQEYEQGKTEFTFDEDPHVVGDCIKHVLRELPSSPVSASCC 250
Query: 320 NALLEARRTD-RGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVA 378
ALLEA R + + +R+S++R+AI ETFPEPNR+LLQRIL MM T++S ++NRM+ +AVA
Sbjct: 251 TALLEAYRIESKEARISSLRSAIAETFPEPNRRLLQRILKMMHTISSHSHENRMNPNAVA 310
Query: 379 ACMAPLLLRPLLAGECEIETDFNVGGDGSXXXXXXXXXXXXXXXIVITLLEEYDKIFGEG 438
ACMAPLLLRPLLAGEC++E DF+ G D S I+ LLE+Y IF E
Sbjct: 311 ACMAPLLLRPLLAGECDLEDDFDGGEDNSAQLLAAANAANNAQAIITVLLEDYGSIFDE- 369
Query: 439 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGATPESDAYTDDDLDNAXXXXXXXXX 498
A E + TDDD D A
Sbjct: 370 ENIQRCSISTESHIGNSGPDDSSDDDNNMKNGYHNADNEVEPVTDDDNDRALSGKMSESS 429
Query: 499 XXXXXVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEINQNPSSTSHEKALPQNED 558
+Y+ K +A G S R D+ N +ST + +D
Sbjct: 430 GCTGSDLYEYKGFVADDSDIESPRDTNGPRCNSNIRTDHLMRNPFVNSTDQQAGEQIGDD 489
Query: 559 VKDSKNIQNQSENNSSRQVNESAE-LLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNESV 617
+K N + S +S L V T + L S KS + K +P SV
Sbjct: 490 --PTKYGVNSCLAHVSESYQQSGTGLNVPTHGNTLAAPGLESPSAKS-VNKGTP---SSV 543
Query: 618 YGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILEAS 677
+ +KR T WGR +ARK + S D ++E+ IQRLE TK++L+++IA E +GN IL+AS
Sbjct: 544 H-AKRATFWGRGSARKISTDGSFDSSGEDELAIQRLETTKNELRQRIAKEARGNAILQAS 602
Query: 678 LESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTKVE 737
LE RK+ALHERRL+LE DV+RL++QLQ ERD R A+E GL +G F +D KT+ E
Sbjct: 603 LERRKQALHERRLSLEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFS-SHGVDSKTRAE 661
Query: 738 LGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSN-----QLHQTSTKLKDKQR 792
L EIA AE D+ LKQK +L QL++Q + + G D+ + Q H + +
Sbjct: 662 LEEIALAEADVARLKQKVAELHHQLNQQRQTHFGSFSDARDTHQYLQNHNPQKRFLQQDF 721
Query: 793 DNEAAAERLRIKQ--EVNKDGAAESDNEKKQESLSFPNKLPPQNQQV-DSMHTVTSR 846
D+ A KQ E N GA E N K S N P +Q+ +S +T S+
Sbjct: 722 DSTLAYVNHERKQRHEENVLGA-EWRNSKGAGSFGVGNSRQPSRKQIPESTNTTDSK 777
|
|
| TAIR|locus:2176992 AT5G12150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-87 arhgap22 "Rho GTPase activating protein 22" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMM3 ARHGAP15 "Rho GTPase-activating protein 15" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1310017 Arhgap12 "Rho GTPase activating protein 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1922665 Arhgap12 "Rho GTPase activating protein 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-314 arhgap15 "Rho GTPase activating protein 15" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q504X1 ARHGAP12 "Rho GTPase-activating protein 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IWW6 ARHGAP12 "Rho GTPase-activating protein 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3922 arhgap27 "Rho GTPase activating protein 27" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.00020958 | hypothetical protein (904 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 875 | |||
| pfam00620 | 152 | pfam00620, RhoGAP, RhoGAP domain | 5e-32 | |
| cd00159 | 169 | cd00159, RhoGAP, RhoGAP: GTPase-activator protein | 2e-29 | |
| smart00324 | 174 | smart00324, RhoGAP, GTPase-activator protein for R | 3e-25 | |
| pfam14389 | 88 | pfam14389, Lzipper-MIP1, Leucine-zipper of ternary | 6e-23 | |
| cd04403 | 187 | cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_ | 2e-16 | |
| cd04377 | 186 | cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGA | 8e-16 | |
| cd04373 | 185 | cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase- | 9e-14 | |
| cd04404 | 195 | cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGA | 2e-13 | |
| cd04393 | 189 | cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP | 5e-12 | |
| cd04376 | 206 | cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (G | 8e-12 | |
| cd04390 | 199 | cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24 | 1e-11 | |
| cd04385 | 184 | cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase- | 2e-11 | |
| cd04407 | 186 | cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: Rho | 2e-11 | |
| cd04389 | 187 | cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase- | 3e-11 | |
| cd04391 | 216 | cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP | 3e-11 | |
| cd04379 | 207 | cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase- | 3e-11 | |
| cd04384 | 195 | cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPas | 6e-11 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 3e-10 | |
| cd04406 | 186 | cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: Rho | 1e-09 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 1e-09 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-09 | |
| cd04374 | 203 | cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activato | 4e-09 | |
| cd04386 | 203 | cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTP | 9e-09 | |
| cd04387 | 196 | cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-ac | 1e-08 | |
| cd04398 | 192 | cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPas | 2e-08 | |
| cd04409 | 211 | cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPas | 3e-08 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 1e-07 | |
| cd04375 | 220 | cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase- | 2e-07 | |
| cd04395 | 196 | cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP | 2e-07 | |
| cd04402 | 192 | cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP | 3e-07 | |
| cd04382 | 193 | cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGA | 5e-07 | |
| cd04378 | 203 | cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: Rho | 1e-06 | |
| cd04372 | 194 | cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGA | 1e-06 | |
| cd04394 | 202 | cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGA | 2e-06 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 5e-06 | |
| cd04383 | 188 | cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPas | 6e-06 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 7e-06 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 1e-05 | |
| cd04381 | 182 | cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTP | 2e-05 | |
| cd13265 | 108 | cd13265, PH_evt, Evectin Pleckstrin homology (PH) | 4e-05 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 8e-05 | |
| cd13215 | 130 | cd13215, PH-GRAM1_AGT26, Autophagy-related protein | 9e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| cd13284 | 99 | cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro | 2e-04 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 2e-04 | |
| cd04408 | 200 | cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase- | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 4e-04 | |
| cd13279 | 91 | cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) d | 4e-04 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 7e-04 | |
| cd04392 | 208 | cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP | 7e-04 | |
| cd13247 | 125 | cd13247, BAR-PH_APPL, Adaptor protein containing P | 8e-04 | |
| cd13253 | 93 | cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky | 9e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| cd13271 | 114 | cd13271, PH2_TAPP1_2, Tandem PH-domain-containing | 0.002 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 |
| >gnl|CDD|216027 pfam00620, RhoGAP, RhoGAP domain | Back alignment and domain information |
|---|
Score = 121 bits (306), Expect = 5e-32
Identities = 45/147 (30%), Positives = 70/147 (47%), Gaps = 4/147 (2%)
Query: 245 PSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSP--EEDAHIIADCV 302
P +EK + F+E+ G+ EGI R + + F+ G+ EED H++A +
Sbjct: 1 PLIVEKCVEFLEKRGLDTEGIFRVSGSASRIKELREAFDSGEDVDLDLEEEDVHVVASLL 60
Query: 303 KYVIRELPSSPVPASCCNALLEA-RRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQ 361
K +RELP + +EA + D RV A+R +L P NR L+ +L +
Sbjct: 61 KLFLRELPEPLLTFELYEEFIEAAKSEDEEERVEALR-ELLRKLPPANRDTLRYLLAHLN 119
Query: 362 TVASSKNQNRMSTSAVAACMAPLLLRP 388
VA + N+M+ +A P LLRP
Sbjct: 120 RVAQNSEVNKMNAHNLAIVFGPTLLRP 146
|
GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. Length = 152 |
| >gnl|CDD|238090 cd00159, RhoGAP, RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|214618 smart00324, RhoGAP, GTPase-activator protein for Rho-like GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206557 pfam14389, Lzipper-MIP1, Leucine-zipper of ternary complex factor MIP1 | Back alignment and domain information |
|---|
| >gnl|CDD|239868 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains | Back alignment and domain information |
|---|
| >gnl|CDD|239842 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|239838 cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239869 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) | Back alignment and domain information |
|---|
| >gnl|CDD|239858 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239841 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239855 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239850 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs | Back alignment and domain information |
|---|
| >gnl|CDD|239872 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB | Back alignment and domain information |
|---|
| >gnl|CDD|239854 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239856 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239844 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239849 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|239871 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239839 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239851 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239852 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239863 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239874 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239840 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239860 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239867 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239847 cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239843 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >gnl|CDD|239837 cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins | Back alignment and domain information |
|---|
| >gnl|CDD|239859 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239848 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239846 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin | Back alignment and domain information |
|---|
| >gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|239873 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|239857 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 875 | |||
| KOG1451 | 812 | consensus Oligophrenin-1 and related Rho GTPase-ac | 100.0 | |
| KOG4271 | 1100 | consensus Rho-GTPase activating protein [Signal tr | 100.0 | |
| cd04372 | 194 | RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- | 100.0 | |
| cd04386 | 203 | RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa | 100.0 | |
| cd04402 | 192 | RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac | 100.0 | |
| cd04390 | 199 | RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas | 100.0 | |
| cd04391 | 216 | RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac | 100.0 | |
| cd04375 | 220 | RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator | 100.0 | |
| cd04407 | 186 | RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas | 100.0 | |
| cd04384 | 195 | RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato | 100.0 | |
| cd04383 | 188 | RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato | 100.0 | |
| cd04381 | 182 | RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa | 100.0 | |
| cd04403 | 187 | RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G | 100.0 | |
| cd04397 | 213 | RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato | 100.0 | |
| cd04395 | 196 | RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac | 100.0 | |
| cd04404 | 195 | RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- | 100.0 | |
| cd04408 | 200 | RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator | 100.0 | |
| cd04406 | 186 | RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas | 100.0 | |
| cd04394 | 202 | RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- | 100.0 | |
| cd04398 | 192 | RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato | 100.0 | |
| cd04396 | 225 | RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas | 100.0 | |
| cd04376 | 206 | RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti | 100.0 | |
| cd04378 | 203 | RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas | 100.0 | |
| cd04373 | 185 | RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator | 100.0 | |
| cd04409 | 211 | RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato | 100.0 | |
| cd04400 | 190 | RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato | 100.0 | |
| cd04377 | 186 | RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- | 100.0 | |
| cd04393 | 189 | RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac | 100.0 | |
| cd04387 | 196 | RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr | 100.0 | |
| cd04379 | 207 | RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator | 100.0 | |
| KOG4407 | 1973 | consensus Predicted Rho GTPase-activating protein | 100.0 | |
| cd04392 | 208 | RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac | 100.0 | |
| cd04385 | 184 | RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator | 100.0 | |
| cd04374 | 203 | RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein | 100.0 | |
| cd04382 | 193 | RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- | 100.0 | |
| cd04399 | 212 | RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activato | 100.0 | |
| cd04389 | 187 | RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator | 100.0 | |
| cd04388 | 200 | RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr | 100.0 | |
| KOG1450 | 650 | consensus Predicted Rho GTPase-activating protein | 99.98 | |
| KOG4270 | 577 | consensus GTPase-activator protein [Signal transdu | 99.97 | |
| smart00324 | 174 | RhoGAP GTPase-activator protein for Rho-like GTPas | 99.97 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 99.97 | |
| KOG2200 | 674 | consensus Tumour suppressor protein p122-RhoGAP/DL | 99.97 | |
| cd04380 | 220 | RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato | 99.96 | |
| cd00159 | 169 | RhoGAP RhoGAP: GTPase-activator protein (GAP) for | 99.96 | |
| KOG4269 | 1112 | consensus Rac GTPase-activating protein BCR/ABR [S | 99.96 | |
| PF00620 | 151 | RhoGAP: RhoGAP domain; InterPro: IPR000198 Members | 99.95 | |
| KOG4406 | 467 | consensus CDC42 Rho GTPase-activating protein [Sig | 99.95 | |
| KOG2710 | 412 | consensus Rho GTPase-activating protein [Signal tr | 99.93 | |
| KOG4724 | 741 | consensus Predicted Rho GTPase-activating protein | 99.91 | |
| KOG1453 | 918 | consensus Chimaerin and related Rho GTPase activat | 99.91 | |
| KOG3564 | 604 | consensus GTPase-activating protein [General funct | 99.9 | |
| PF14389 | 88 | Lzipper-MIP1: Leucine-zipper of ternary complex fa | 99.86 | |
| KOG4271 | 1100 | consensus Rho-GTPase activating protein [Signal tr | 99.75 | |
| KOG1452 | 442 | consensus Predicted Rho GTPase-activating protein | 99.72 | |
| cd04405 | 235 | RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPas | 99.6 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.6 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.59 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.55 | |
| cd04401 | 198 | RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activato | 99.53 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.51 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.51 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.47 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.46 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.44 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.43 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.41 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.39 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.39 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.34 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.34 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.33 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.33 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.31 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.3 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 99.28 | |
| KOG4370 | 514 | consensus Ral-GTPase effector RLIP76 [Signal trans | 99.23 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.23 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.2 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.2 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 99.16 | |
| KOG3565 | 640 | consensus Cdc42-interacting protein CIP4 [Cytoskel | 99.13 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.11 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.1 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.03 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 98.97 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 98.93 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 98.91 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.9 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.77 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 98.73 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 98.68 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.64 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.63 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 98.56 | |
| KOG4724 | 741 | consensus Predicted Rho GTPase-activating protein | 98.47 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.32 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.23 | |
| PF08101 | 420 | DUF1708: Domain of unknown function (DUF1708); Int | 98.21 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.13 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.12 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 97.96 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 97.74 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 97.72 | |
| KOG0932 | 774 | consensus Guanine nucleotide exchange factor EFA6 | 97.61 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 97.6 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 97.45 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 97.43 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 97.38 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 97.23 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.15 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 97.15 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 97.11 | |
| KOG3543 | 1218 | consensus Ca2+-dependent activator protein [Signal | 97.01 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 96.31 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 96.25 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 96.21 | |
| KOG1453 | 918 | consensus Chimaerin and related Rho GTPase activat | 96.13 | |
| KOG0517 | 2473 | consensus Beta-spectrin [Cytoskeleton] | 95.67 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 95.57 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 95.54 | |
| PLN02866 | 1068 | phospholipase D | 95.5 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 95.32 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.23 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 95.08 | |
| KOG3723 | 851 | consensus PH domain protein Melted [Signal transdu | 94.98 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 94.79 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 94.36 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 94.17 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 94.14 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 93.79 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 93.78 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 93.29 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 93.11 | |
| KOG1449 | 670 | consensus Predicted Rho GTPase-activating protein | 92.78 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 92.53 | |
| KOG1449 | 670 | consensus Predicted Rho GTPase-activating protein | 92.47 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 92.2 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 91.7 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 91.35 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 90.74 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 89.33 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 88.44 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 88.43 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 87.91 | |
| cd00089 | 72 | HR1 Protein kinase C-related kinase homology regio | 87.77 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 87.56 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 86.9 | |
| KOG1737 | 799 | consensus Oxysterol-binding protein [Lipid transpo | 86.39 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 83.27 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 83.1 | |
| KOG3549 | 505 | consensus Syntrophins (type gamma) [Extracellular | 82.8 |
| >KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-60 Score=526.24 Aligned_cols=355 Identities=23% Similarity=0.326 Sum_probs=298.0
Q ss_pred ceeecCCchhhHhhhccchhhhcccceecccC-CCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCC
Q 002835 3 IFQIFPPTHSIFAESCNHDAGDLVIGIWSVKA-PNGLRRKNLSGDAGTPPMATNPPGGPPSGQPPGPPPGPNDHRITRAG 81 (875)
Q Consensus 3 ~~~~~~~~~~~~~~df~~y~~~L~~~lq~tR~-~~~tR~~~esl~~~~~km~~~p~~~~~~~~~p~~~~~p~~~~~~~~~ 81 (875)
+|.|||.|- |+++||+||+++||+.|||||+ |++||.++++| +++|+++|.. . +.+
T Consensus 206 lf~f~h~g~-el~qDF~pfk~qlq~s~QnTrn~f~~Tr~E~EeL---kKkmke~p~e----------------~---k~p 262 (812)
T KOG1451|consen 206 LFSFFHVGS-ELHQDFKPFKDQLQTSVQNTRNNFNATRAEAEEL---KKKMKESPTE----------------D---KRP 262 (812)
T ss_pred HHHHhhhhH-HHHhhhhhHHHHHHHHHHHhhhcccchHHHHHHH---HHHHhhCccc----------------c---cCC
Confidence 356666665 9999999999999999999999 99999999999 9999988862 1 112
Q ss_pred CcEEEEeeeEeecCCCCccCceeEEEEEeCCeEEEecCCCCCC--CCCCccceeecCCeeecCCCceeeecCCcceEEEE
Q 002835 82 NAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAI--PQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLF 159 (875)
Q Consensus 82 ~~v~KEGyL~k~kKg~~~ksWkKRWfVL~~~sL~yYKd~k~~~--p~~g~e~~i~L~~~~l~~s~sv~~~~~KK~~FvI~ 159 (875)
.+.+++||||.++|.+..++|.|+||+|.+.+..|..-.-+-+ ...|+...+.|+.|..+..++ ++|+|||++.
T Consensus 263 ~p~t~eGYlY~QEK~~~g~sWvKyYC~Y~retk~~TMvp~~qk~g~k~g~~~~~~lKsC~RRktdS----IdKRFCFDve 338 (812)
T KOG1451|consen 263 TPSTKEGYLYMQEKSKIGKSWVKYYCVYSRETKIFTMVPANQKTGTKMGQTATFKLKSCSRRKTDS----IDKRFCFDVE 338 (812)
T ss_pred CCcccceeeeehhhhhccchhhhheeEeecccceEEEeecccCCCCcCCCcceEEehhhccCcccc----cccceeeeee
Confidence 2368999999999999899999999999999877755433221 223555669999999998754 5999999999
Q ss_pred ecCCCCceeEEEecchhhHHHHHHHHHhhhccCCCCCCCCcccCcccccchhhccCchhhhcccCCCCCccccChhHhhh
Q 002835 160 PDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALE 239 (875)
Q Consensus 160 ~~~~dgrty~fQAdSEeE~~eWI~AI~~ai~~aP~~~~~~~~~~if~~~~~~~~~~s~~~~~~K~~k~~vFGvpLe~ll~ 239 (875)
...++| +.++||.+++++..||.||+++. |.+. .+.+ + +..+ +..+
T Consensus 339 ~~erpg-viTmQALSE~drrlWmeAMDG~e---p~Y~--s~~~-~-------~~~~-------------------~~qL- 384 (812)
T KOG1451|consen 339 VEERPG-VITMQALSEKDRRLWMEAMDGAE---PSYT--SGEN-C-------STYK-------------------QTQL- 384 (812)
T ss_pred ecccCC-eeehHhhhhhHHHHHHHHhcCCC---cccc--Cccc-c-------chhh-------------------hhhh-
Confidence 988886 58999999999999999999985 4432 1111 0 0000 0111
Q ss_pred cCCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCC----CC--CCCCCCchhhHhhHHHHHhhCCCCC
Q 002835 240 DVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGK----TE--FSPEEDAHIIADCVKYVIRELPSSP 313 (875)
Q Consensus 240 ~~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~----~~--~~~~~D~h~VAslLK~fLReLPePL 313 (875)
++-...||.+||..|+..|++++|+||..|.+.+|++|...+-..+ .+ ....||+.+|++.||.|||.||+||
T Consensus 385 -d~iGF~fvrkCI~i~Et~GI~eqGlYR~vGvns~VQKlln~~fDPK~ase~d~dn~~eWeiKTITSaLKtYLRnLpEPL 463 (812)
T KOG1451|consen 385 -DDIGFEFVRKCIDILETSGIHEQGLYRNVGVNSKVQKLLNLGFDPKKASEKDGDNLDEWEIKTITSALKTYLRNLPEPL 463 (812)
T ss_pred -hhhhHHHHHHHHHHHHhcCcccccchhhccchHHHHHHHHhcCCCCCccccccchhhhhhhhhHHHHHHHHHHhCCchh
Confidence 2245789999999999999999999999999999999988754422 22 2357899999999999999999999
Q ss_pred CChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhcccCCCccccceeecccccCCCcCC
Q 002835 314 VPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAG 392 (875)
Q Consensus 314 lp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~~NkMta~NLAi~FgPtLLrp~~s~ 392 (875)
++|.++..||.|++.++ +.|+.+||.|++ +||+.||.+|..||+||.+|+.|+..|.||+.||+|||||+||||++
T Consensus 464 MTY~LHk~FI~AAKsdnq~yRv~aIHsLVH-kLPEKNReMLelLirHLvnVa~hSkeNLMTVSNLGViFGPTLlRpQE-- 540 (812)
T KOG1451|consen 464 MTYELHKVFINAAKSDNQTYRVDAIHSLVH-KLPEKNREMLELLIRHLVNVADHSKENLMTVSNLGVIFGPTLLRPQE-- 540 (812)
T ss_pred hHHHHHHHHHHHHhccchhhhHHHHHHHHH-hccHhhHHHHHHHHHHHHHHHhhhhcccccccccceeecccccCchH--
Confidence 99999999999999999 999999999998 99999999999999999999999999999999999999999999984
Q ss_pred ccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhcccccCCC
Q 002835 393 ECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEG 438 (875)
Q Consensus 393 ~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF~e~ 438 (875)
|+ ++|+|.+++++-||++||+||++||...
T Consensus 541 ----ET------------VAAiMdIKFQNIVVEILIEnyeKIF~t~ 570 (812)
T KOG1451|consen 541 ----ET------------VAAIMDIKFQNIVVEILIENYEKIFKTK 570 (812)
T ss_pred ----HH------------HHHHHcchhhhhhHHHHHhhhHHHhcCC
Confidence 33 6788888888888999999999999844
|
|
| >KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins | Back alignment and domain information |
|---|
| >cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins | Back alignment and domain information |
|---|
| >cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins | Back alignment and domain information |
|---|
| >cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins | Back alignment and domain information |
|---|
| >cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins | Back alignment and domain information |
|---|
| >cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB | Back alignment and domain information |
|---|
| >cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA | Back alignment and domain information |
|---|
| >cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs | Back alignment and domain information |
|---|
| >cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin | Back alignment and domain information |
|---|
| >cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains | Back alignment and domain information |
|---|
| >cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins | Back alignment and domain information |
|---|
| >cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins | Back alignment and domain information |
|---|
| >cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) | Back alignment and domain information |
|---|
| >cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) | Back alignment and domain information |
|---|
| >cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA | Back alignment and domain information |
|---|
| >cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins | Back alignment and domain information |
|---|
| >cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins | Back alignment and domain information |
|---|
| >cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins | Back alignment and domain information |
|---|
| >cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins | Back alignment and domain information |
|---|
| >cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins | Back alignment and domain information |
|---|
| >cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins | Back alignment and domain information |
|---|
| >cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins | Back alignment and domain information |
|---|
| >cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins | Back alignment and domain information |
|---|
| >cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins | Back alignment and domain information |
|---|
| >cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins | Back alignment and domain information |
|---|
| >KOG4407 consensus Predicted Rho GTPase-activating protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins | Back alignment and domain information |
|---|
| >cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs | Back alignment and domain information |
|---|
| >cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins | Back alignment and domain information |
|---|
| >cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins | Back alignment and domain information |
|---|
| >cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins | Back alignment and domain information |
|---|
| >cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain | Back alignment and domain information |
|---|
| >cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) | Back alignment and domain information |
|---|
| >KOG1450 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4270 consensus GTPase-activator protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2200 consensus Tumour suppressor protein p122-RhoGAP/DLC1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins | Back alignment and domain information |
|---|
| >cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases | Back alignment and domain information |
|---|
| >KOG4269 consensus Rac GTPase-activating protein BCR/ABR [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation | Back alignment and domain information |
|---|
| >KOG4406 consensus CDC42 Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2710 consensus Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3564 consensus GTPase-activating protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14389 Lzipper-MIP1: Leucine-zipper of ternary complex factor MIP1 | Back alignment and domain information |
|---|
| >KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04405 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of BRCC3-like proteins | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04401 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal MSB1-like proteins | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4370 consensus Ral-GTPase effector RLIP76 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3565 consensus Cdc42-interacting protein CIP4 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF08101 DUF1708: Domain of unknown function (DUF1708); InterPro: IPR012965 This is a fungal domain of unknown function, though the yeast protein MSB1(P21339 from SWISSPROT) which contains this domain is thought to play a role in bud formation [] | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0517 consensus Beta-spectrin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd00089 HR1 Protein kinase C-related kinase homology region 1 domain; also known as the ACC (antiparallel coiled-coil) finger domain or Rho-binding domain | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 875 | ||||
| 3fk2_A | 246 | Crystal Structure Of The Rhogap Domain Of Human Glu | 8e-12 | ||
| 3byi_A | 214 | Crystal Structure Of Human Rho Gtpase Activating Pr | 1e-11 | ||
| 2ee5_A | 219 | Solution Structure Of The N-Teruminus Extended Rhog | 3e-09 | ||
| 2ee4_A | 209 | Solution Structure Of The Rhogap Domain From Human | 6e-09 | ||
| 3kuq_A | 228 | Crystal Structure Of The Dlc1 Rhogap Domain Length | 1e-08 | ||
| 1am4_A | 199 | Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S | 4e-08 | ||
| 1grn_B | 203 | Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX | 4e-08 | ||
| 1ow3_A | 242 | Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With | 5e-08 | ||
| 1tx4_A | 198 | RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 | 8e-08 | ||
| 2ngr_B | 234 | Transition State Complex For Gtp Hydrolysis By Cdc4 | 4e-07 | ||
| 1f7c_A | 231 | Crystal Structure Of The Bh Domain From Graf, The G | 1e-06 | ||
| 3msx_B | 201 | Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With | 5e-06 | ||
| 3eap_A | 271 | Crystal Structure Of The Rhogap Domain Of Arhgap11a | 2e-05 |
| >pdb|3FK2|A Chain A, Crystal Structure Of The Rhogap Domain Of Human Glucocorticoid Receptor Dna-Binding Factor 1 Length = 246 | Back alignment and structure |
|
| >pdb|3BYI|A Chain A, Crystal Structure Of Human Rho Gtpase Activating Protein 15 (arhgap15) Length = 214 | Back alignment and structure |
| >pdb|2EE5|A Chain A, Solution Structure Of The N-Teruminus Extended Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 219 | Back alignment and structure |
| >pdb|2EE4|A Chain A, Solution Structure Of The Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 209 | Back alignment and structure |
| >pdb|3KUQ|A Chain A, Crystal Structure Of The Dlc1 Rhogap Domain Length = 228 | Back alignment and structure |
| >pdb|1AM4|A Chain A, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 199 | Back alignment and structure |
| >pdb|1GRN|B Chain B, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX Length = 203 | Back alignment and structure |
| >pdb|1OW3|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 242 | Back alignment and structure |
| >pdb|1TX4|A Chain A, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 | Back alignment and structure |
| >pdb|2NGR|B Chain B, Transition State Complex For Gtp Hydrolysis By Cdc42: Comparisons Of The High Resolution Structures For Cdc42 Bound To The Active And Catalytically Compromised Forms Of The Cdc42-gap Length = 234 | Back alignment and structure |
| >pdb|1F7C|A Chain A, Crystal Structure Of The Bh Domain From Graf, The Gtpase Regulator Associated With Focal Adhesion Kinase Length = 231 | Back alignment and structure |
| >pdb|3MSX|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 201 | Back alignment and structure |
| >pdb|3EAP|A Chain A, Crystal Structure Of The Rhogap Domain Of Arhgap11a Length = 271 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Length = 198 | Back alignment and structure |
|---|
Score = 123 bits (311), Expect = 2e-32
Identities = 45/218 (20%), Positives = 87/218 (39%), Gaps = 26/218 (11%)
Query: 223 KPVKFPVIGRP---ILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRI 279
P+ G + + + P L + + +++ H + EGI R++A V R +
Sbjct: 2 PPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVV-REV 60
Query: 280 RE-FEQGKT-EFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAM 337
++ + G +F H+ A +K +RELP + ++ D RV A
Sbjct: 61 QQKYNMGLPVDFDQYNALHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPAT 120
Query: 338 RTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIE 397
+L+T PE N ++L+ + + +++ +QN+M+ + +A P LL
Sbjct: 121 L-QVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWA--------- 170
Query: 398 TDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF 435
D + L A N LL+ ++F
Sbjct: 171 ------KDAAITL----KAINPINTFTKFLLDHQGELF 198
|
| >1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Length = 242 | Back alignment and structure |
|---|
| >3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Length = 209 | Back alignment and structure |
|---|
| >3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Length = 231 | Back alignment and structure |
|---|
| >2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 | Back alignment and structure |
|---|
| >1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Length = 216 | Back alignment and structure |
|---|
| >3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Length = 366 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 875 | |||
| 3byi_A | 214 | RHO GTPase activating protein 15; BM046, arhgap15, | 100.0 | |
| 3msx_B | 201 | RHO GTPase-activating protein 20; protein-proten c | 100.0 | |
| 1f7c_A | 231 | Rhogap protein; GTPase activating protein, RHO GTP | 100.0 | |
| 2ee4_A | 209 | RHO GTPase activating protein 5 variant; all alpha | 100.0 | |
| 1tx4_A | 198 | P50-rhogap; complex (GTPase activation/proto-oncog | 100.0 | |
| 3iug_A | 229 | RHO/CDC42/RAC GTPase-activating protein RICS; stru | 100.0 | |
| 2osa_A | 202 | N-chimaerin; RHO-GAP, GTPase activation, structura | 100.0 | |
| 3fk2_A | 246 | Glucocorticoid receptor DNA-binding factor 1; stru | 100.0 | |
| 1ow3_A | 242 | RHO-GTPase-activating protein 1; complex, GTPase, | 100.0 | |
| 3kuq_A | 228 | RHO GTPase-activating protein 7; structural genomi | 100.0 | |
| 1pbw_A | 216 | Rhogap domain, phosphatidylinositol 3-kinase; phos | 100.0 | |
| 2ovj_A | 201 | Mgcracgap, RAC GTPase-activating protein 1; signal | 100.0 | |
| 3eap_A | 271 | RHO GTPase-activating protein 11A; GAP, structural | 100.0 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 100.0 | |
| 2xs6_A | 214 | Phosphatidylinositol 3-kinase regulatory subunit; | 100.0 | |
| 3qis_A | 366 | Inositol polyphosphate 5-phosphatase OCRL-1; DENT | 99.97 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.75 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.73 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.7 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.65 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.64 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.62 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.61 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.61 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.61 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.61 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.6 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.6 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.58 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.58 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.58 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.58 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.57 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.57 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.57 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.57 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.57 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.57 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.57 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.57 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.56 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.56 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.56 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.55 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.55 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.55 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.54 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.54 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.53 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.53 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.53 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.52 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.52 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.52 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.52 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.52 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.52 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.51 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.5 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.5 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.5 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.49 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.49 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.47 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.47 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.46 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.44 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.41 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.39 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.33 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.32 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.3 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.26 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.22 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.18 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.18 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.17 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.1 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.04 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.98 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 98.95 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 98.89 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 98.88 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 98.86 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.63 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.36 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.2 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 97.57 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.2 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 97.18 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 97.14 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 96.8 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 96.78 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 96.76 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.72 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 96.47 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 96.3 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.11 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 96.0 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 95.81 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 95.57 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 95.46 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 95.46 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 95.46 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 95.02 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 94.85 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 94.82 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 94.41 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 94.36 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 94.19 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 94.12 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.98 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 93.2 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 91.64 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.25 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 90.75 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 89.73 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.34 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.25 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 87.32 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.3 | |
| 2ke4_A | 98 | CDC42-interacting protein 4; CIP4, TC10, coiled-co | 84.82 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 83.92 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 80.73 |
| >3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-41 Score=346.77 Aligned_cols=205 Identities=26% Similarity=0.432 Sum_probs=178.5
Q ss_pred Cchhhhccc-CCCCCccccChhHhhhc-CCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCC-CCCCC
Q 002835 215 GSVEQLKEK-PVKFPVIGRPILLALED-VDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGK-TEFSP 291 (875)
Q Consensus 215 ~s~~~~~~K-~~k~~vFGvpLe~ll~~-~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~-~~~~~ 291 (875)
++.+.+++| ..+.++||+||+.++.+ +..||.+|.+|+.||+.+|+.+|||||++|+..+|++|+..++.|. .++..
T Consensus 4 ps~~~l~~~~~~~~~vFG~~L~~~~~~~~~~vP~~v~~~i~~l~~~gl~~eGIfR~~G~~~~i~~L~~~~~~~~~~~~~~ 83 (214)
T 3byi_A 4 PSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDD 83 (214)
T ss_dssp CCHHHHHHHTSCCCCSTTSCHHHHHHHHTCSSCHHHHHHHHHHHHHTTTSTTTTTSCCCHHHHHHHHHHHHTTCCCCTTS
T ss_pred CchhhHHhcCCCcCCccCCcHHHHHHHcCCCCChHHHHHHHHHHHhCCCCCCccccCCCHHHHHHHHHHHhcCCCCCCCc
Confidence 444556666 77889999999998864 6789999999999999999999999999999999999999999985 33332
Q ss_pred --CCCchhhHhhHHHHHhhCCCCCCChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhc
Q 002835 292 --EEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKN 368 (875)
Q Consensus 292 --~~D~h~VAslLK~fLReLPePLlp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~ 368 (875)
..|+|+||++||.|||+||+||||+++|+.|+.+.+..+ .+++..++.+|. +||+.|+.+|+||+.||++|+.|++
T Consensus 84 ~~~~dvh~va~lLK~flreLPePLl~~~l~~~~~~~~~~~~~~~~~~~l~~ll~-~LP~~n~~~L~~L~~~L~~v~~~s~ 162 (214)
T 3byi_A 84 SQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQ-KLPPPNRDTMKVLFGHLTKIVAKAS 162 (214)
T ss_dssp GGGCSHHHHHHHHHHHHHHSSSCSSCHHHHHHHHHHHTSSSHHHHHHHHHHHHH-HSCHHHHHHHHHHHHHHHHHHHTHH
T ss_pred ccccchHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHhcCCHHHHHHHHHHHHH-hCCHHHHHHHHHHHHHHHHHHHccc
Confidence 249999999999999999999999999999999999888 899999999886 9999999999999999999999999
Q ss_pred ccCCCccccceeecccccCCCcCCccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhcccccCCC
Q 002835 369 QNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEG 438 (875)
Q Consensus 369 ~NkMta~NLAi~FgPtLLrp~~s~~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF~e~ 438 (875)
.|+||+.|||+||||+|||++... + . .+......+.+|++||+||+.||+++
T Consensus 163 ~NkM~~~NLa~vf~P~Ll~~~~~~-----------~--~-----~~~~~~~~~~vve~LI~~~~~iF~~d 214 (214)
T 3byi_A 163 KNLMSTQSLGIVFGPTLLRAENET-----------G--N-----MAIHMVYQNQIAELMLSEYSKIFGSE 214 (214)
T ss_dssp HHCCCHHHHHHHHHHHHHCCTTSS-----------S--C-----HHHHHHHHHHHHHHHHHTHHHHHC--
T ss_pred CCCCCHHHhHHHhccccCCCCCcc-----------H--H-----HHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence 999999999999999999987311 0 0 01234567889999999999999863
|
| >3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A | Back alignment and structure |
|---|
| >1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* | Back alignment and structure |
|---|
| >3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* | Back alignment and structure |
|---|
| >3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} | Back alignment and structure |
|---|
| >3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 875 | ||||
| d1tx4a_ | 196 | a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapi | 1e-30 | |
| d1f7ca_ | 191 | a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxI | 3e-28 | |
| d1xa6a1 | 196 | a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal d | 3e-28 | |
| d1pbwa_ | 184 | a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Hu | 2e-26 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 1e-14 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 2e-14 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 6e-13 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 1e-12 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 2e-12 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 2e-12 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 2e-11 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 2e-11 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 3e-11 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 4e-11 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 4e-11 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 9e-11 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 2e-10 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 2e-10 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 2e-10 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 8e-10 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 9e-10 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 1e-09 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 2e-09 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 2e-09 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 2e-09 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 5e-09 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 9e-09 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 2e-08 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 4e-08 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 6e-08 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 7e-08 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 1e-07 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 1e-06 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 1e-06 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 1e-06 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 2e-06 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-06 | |
| d1w1ha_ | 147 | b.55.1.1 (A:) 3-phosphoinositide dependent protein | 6e-05 | |
| d1v61a_ | 132 | b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M | 3e-04 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 8e-04 |
| >d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GTPase activation domain, GAP superfamily: GTPase activation domain, GAP family: BCR-homology GTPase activation domain (BH-domain) domain: p50 RhoGAP domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 117 bits (294), Expect = 1e-30
Identities = 43/216 (19%), Positives = 83/216 (38%), Gaps = 24/216 (11%)
Query: 224 PVKFPVIGRPILLALE---DVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIR 280
P+ G + E + + P L + + +++ H + EGI R++A V +
Sbjct: 1 PLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQ 60
Query: 281 EFEQGK-TEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRT 339
++ G +F H+ A +K +RELP + ++ D RV A
Sbjct: 61 KYNMGLPVDFDQYNALHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATL- 119
Query: 340 AILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETD 399
+L+T PE N ++L+ + + +++ +QN+M+ + +A P LL
Sbjct: 120 QVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWA----------- 168
Query: 400 FNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF 435
A N LL+ ++F
Sbjct: 169 --------KDAAITLKAINPINTFTKFLLDHQGELF 196
|
| >d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Length = 191 | Back information, alignment and structure |
|---|
| >d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 875 | |||
| d1xa6a1 | 196 | Beta-chimaerin, C-terminal domain {Human (Homo sap | 100.0 | |
| d1tx4a_ | 196 | p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 | 100.0 | |
| d1f7ca_ | 191 | Graf {Chicken (Gallus gallus) [TaxId: 9031]} | 100.0 | |
| d1pbwa_ | 184 | p85 alpha subunit RhoGAP domain {Human (Homo sapie | 100.0 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.6 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.6 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.59 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.59 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.59 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.59 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.57 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.57 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.57 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.56 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.56 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.56 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.55 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.54 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.54 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.53 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.52 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.51 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.48 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.48 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.47 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.47 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.47 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.46 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.44 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.44 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.43 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.42 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.39 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.64 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.29 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 97.86 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.73 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.72 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 97.61 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 97.43 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.16 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.13 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.23 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 95.03 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 94.25 |
| >d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GTPase activation domain, GAP superfamily: GTPase activation domain, GAP family: BCR-homology GTPase activation domain (BH-domain) domain: Beta-chimaerin, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.9e-39 Score=324.99 Aligned_cols=190 Identities=19% Similarity=0.354 Sum_probs=167.7
Q ss_pred CccccChhHhhhc-CCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCCC--C--CCCCCCchhhHhhH
Q 002835 228 PVIGRPILLALED-VDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKT--E--FSPEEDAHIIADCV 302 (875)
Q Consensus 228 ~vFGvpLe~ll~~-~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~~--~--~~~~~D~h~VAslL 302 (875)
+|||+||+.++++ +..||.+|.+|+.||+++|+++|||||++|+..++++|++.|+.+.. . ....+|+|+||++|
T Consensus 1 kiFg~~L~~~~~~~~~~iP~iv~~~i~~l~~~gl~~eGiFR~~g~~~~v~~l~~~~~~~~~~~~~~~~~~~d~~~va~~l 80 (196)
T d1xa6a1 1 KVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGAL 80 (196)
T ss_dssp CCTTSCHHHHHHHHTCSSCHHHHHHHHHHHHSCSSSTTTTTSCCCHHHHHHHHHHHSSTTTTSCCCSSSSCCTHHHHHHH
T ss_pred CccCCCHHHHHHhcCCCCChHHHHHHHHHHHhCCCCCCeeeeCCCHHHHHHHHHHHhcCCCccccccccccchhHHHHHH
Confidence 4899999999866 66799999999999999999999999999999999999999998632 2 22346999999999
Q ss_pred HHHHhhCCCCCCChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhcccCCCccccceee
Q 002835 303 KYVIRELPSSPVPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACM 381 (875)
Q Consensus 303 K~fLReLPePLlp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~~NkMta~NLAi~F 381 (875)
|.|||+||+||+|.++|+.|+.+.+..+ +.++..++.++. +||+.|+.+|.||+.||++|+.|++.|+||+.|||+||
T Consensus 81 K~fLr~Lp~pli~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-~LP~~n~~~L~~L~~~l~~i~~~s~~NkM~~~nLA~~f 159 (196)
T d1xa6a1 81 KLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLM-LLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVF 159 (196)
T ss_dssp HHHHHHCSSCTTCSTTHHHHHTTTTCCCHHHHHHHHHHHHT-TSCHHHHHHHHHTTTTTHHHHTTTTTSCCCHHHHHHHH
T ss_pred HHHHHhCCCccCCHHHHHHHHHHHhccchhHHHHHHHHHHH-HCCHHHHHHHHHHHHHHHHHHHhhhhhccchhhhhHHh
Confidence 9999999999999999999999998888 889999999885 99999999999999999999999999999999999999
Q ss_pred cccccCCCcCCccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhccccc
Q 002835 382 APLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF 435 (875)
Q Consensus 382 gPtLLrp~~s~~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF 435 (875)
||+|||++...... +.......+.+|++||+||+.||
T Consensus 160 ~P~l~~~~~~~~~~-----------------~~~~~~~~~~iv~~LI~~~~~iF 196 (196)
T d1xa6a1 160 GPTLMRPPEDSTLT-----------------TLHDMRYQKLIVQILIENEDVLF 196 (196)
T ss_dssp TTTSCCCCCSCTTG-----------------GGGTHHHHHHHHHHHHHTHHHHC
T ss_pred ccccccCCCccHHH-----------------HHHHHHHHHHHHHHHHHhhHhhC
Confidence 99999987422111 11223567789999999999998
|
| >d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|