Citrus Sinensis ID: 002835


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-----
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGLRRKNLSGDAGTPPMATNPPGGPPSGQPPGPPPGPNDHRITRAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEGSASPEELYSESELSGSGTEEATDDDESYEDDDQDGATPESDAYTDDDLDNASSRSCSESGESGDSVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEINQNPSSTSHEKALPQNEDVKDSKNIQNQSENNSSRQVNESAELLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNESVYGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILEASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTKVELGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSNQLHQTSTKLKDKQRDNEAAAERLRIKQEVNKDGAAESDNEKKQESLSFPNKLPPQNQQVDSMHTVTSRSTAPINSRKSGTRSEFLQRVLAGSGALNQ
ccccccccccccEEcccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEEEccEEEEEccccccccccccccccccccEEcccccccEEccccEEEEEEccccccccEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccc
cccEEcccccccccccccccccccEEEEEEccccccEccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEccccccccccEEEEEEccEEEEEEccccccccccccccccccEEEccccEEEEEcccccccEEEEcccccccEEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHcccccHHHHHHcccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccEEHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccc
mpifqifppthsifaescnhdagdlVIGIWsvkapnglrrknlsgdagtppmatnppggppsgqppgpppgpndhritragnavfksgplfisskgigwtswkKRWFILTHTSlvffrsdpsaipqkgsevnltlggidlnnsgsvvvKADKKLLTVlfpdgrdgraftlkaESLEDLYDWKTALENALAqapstgsatgqngilkndkaeaangsveqlkekpvkfpvigrpillaledvdgtpSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFeqgktefspeedaHIIADCVKYVIrelpsspvpasCCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASsknqnrmsTSAVAACMAPlllrpllageceietdfnvggdgSAQLLQAAAAANHAQAIVITLLEEYDKifgegsaspeelyseselsgsgteeatdddesyedddqdgatpesdaytdddldnassrscsesgesgdsvvykdkkniAPFLYYVLKMQDvgvgsksperndnseinqnpsstshekalpqnedvkdskniqnqsennssrqvnESAELLVDvssgtssefklncqspkscleksspvsnesvygskrptvwgrtaarknlsmesidgpsdneVEIQRLEDTKSDLQRKIADEVKGNEILEASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEaglgefngsfpipdtidekTKVELGEIAQAETDIINLKQKAKDLRVQLSEQlekndgfvgdssnqlhqTSTKLKDKQRDNEAAAERLRIKQEvnkdgaaesdnekkqeslsfpnklppqnqqvdsmhtvtsrstapinsrksgtrsEFLQRVLAGSGALNQ
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGLRRKNLSGDAGTPPMATNPPGGPPSGQPPGPPPGPNDHRITRAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTvlfpdgrdgraftLKAESLEDLYDWKTALENALAqapstgsatgqngILKNDKAEAANGsveqlkekpvkfpvIGRPILLALEDVDGTPSFLEKAIRFIEehgvqvegilRQAAYVDDVHRRIREFeqgktefspeedaHIIADCVKYVIRELPSSPVPASCCNALLearrtdrgsrVSAMRtailetfpepnRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGegsaspeelyseselsgsgteeatdddesyedddqdgatpesdaytdddldnassrscsesgesgdsvvykDKKNIAPFLYYVLKMQDVGVGSKSPERNDNseinqnpsstshekalpqnedVKDSKNIQNQsennssrqvneSAELLVDVSSGTSSEFKlncqspkscleksspvsnesvygskrptvwgrtaarknlsmesidgpsdnevEIQRLEdtksdlqrkiadevkgneileaSLESRKKALHERRlalendvarlkdqlqKERDKRTameaglgefngsfpipdTIDEKTKVELGEIAQAETDIINLKQKAKDLRVQLSEQLekndgfvgdssnqlhqtstklkdkqrdNEAAAERLrikqevnkdgaaesdnekkqeslsfpnklppqnqqvdsMHTVTSrstapinsrksgtrseFLQRvlagsgalnq
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGLRRKNLSGDagtppmatnppggppsgqppgpppgpNDHRITRAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSaqllqaaaaanhaqaIVITLLEEYDKIFGEGsaspeelyseselsgsgteeatdddesyedddqdGATPESDAYTDDDLDNAssrscsesgesgdsVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEINQNPSSTSHEKALPQNEDVKDSKNIQNQSENNSSRQVNESAELLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNESVYGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILEASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTKVELGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSNQLHQTSTKLKDKQRDNEAAAERLRIKQEVNKDGAAESDNEKKQESLSFPNKLPPQNQQVDSMHTVTSRSTAPINSRKSGTRSEFLQRVLAGSGALNQ
**IFQIFPPTHSIFAESCNHDAGDLVIGIWSVKA**********************************************GNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAI***GSEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENA************************************VKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQG*******EDAHIIADCVKYVIRELPSSPVPASCCNALLEA************RTAILETFP**NRKLLQRILMMM***************AVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFG*******************************************************************VVYKDKKNIAPFLYYVLKMQDV******************************************************************************************************************************************************************************************************************VELGEIAQAETDIINL****************************************************************************************************************************
*PIFQIFPPTHSIFAESCNHDAGDLVIGI***********************************************************************SWKKRWFILTHTSLVFF*******************GIDLNN***************LFPDGRDGRAFTLKAESLEDLYDWKTALENA******************************************GRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDR**RVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLA***************SAQLLQAAAAANHAQAIVITLLEEYD*********************************************************************************************************************************************************************************************************************************************************************************************************************AQA***********************************************************************************************************************************
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGLRRKNLSGDAGTPPMATNP**************GPNDHRITRAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALA*********GQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEAR********SAMRTAILETFPEPNRKLLQRILMMMQTV***********SAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEGS***************************************DAYTD*******************SVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEI***************************************SAELLVD********************************GSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILEASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTKVELGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVG***********************AERLRIKQEV******************FPNKLP***************************RSEFLQRVLAGSGALNQ
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGL*******************************************NAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQK*SEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKA******VEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGE***************************************************************************************************************************************************************************************************************DNEVEIQRLEDTKSDLQRKIADEVKGNEILEASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAG*****************TKVELGEIAQAETDIINLKQKAKDLRVQLSEQLEKND*********************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIFQIFPPTHSIFAESCNHDAGDLVIGIWSVKAPNGLRRKNLSGDAGTPPMATNPPGGPPSGQPPGPPPGPNDHRITRAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEGSASPEELYSESELSGSGTEEATDDDESYEDDDQDGATPESDAYTDDDLDNASSRSCSESGESGDSVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEINQNPSSTSHEKALPQNEDVKDSKNIQNQSENNSSRQVNESAELLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNESVYGSKRPTVWGRTAARKNLSMESIDGPSDNEVExxxxxxxxxxxxxxxxxxxxxNEILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGEFNGSFPIPDTIDEKTKVELGExxxxxxxxxxxxxxxxxxxxxxxxxxxxNDGFVGDSSNQxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKDGAAESDNEKKQESLSFPNKLPPQNQQVDSMHTVTSRSTAPINSRKSGTRSEFLQRVLAGSGALNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query875 2.2.26 [Sep-21-2011]
Q5ZMM3475 Rho GTPase-activating pro yes no 0.230 0.425 0.277 3e-15
Q8IWW6846 Rho GTPase-activating pro yes no 0.328 0.339 0.234 2e-13
Q9BE31847 Rho GTPase-activating pro N/A no 0.328 0.338 0.234 6e-13
Q8C0D4838 Rho GTPase-activating pro yes no 0.196 0.205 0.275 1e-12
Q7Z5H3698 Rho GTPase-activating pro no no 0.418 0.524 0.232 1e-12
Q53QZ3475 Rho GTPase-activating pro no no 0.230 0.425 0.259 2e-12
Q8BL80702 Rho GTPase-activating pro no no 0.323 0.403 0.246 3e-12
Q8C4V1747 Rho GTPase-activating pro no no 0.283 0.331 0.239 1e-11
Q5U2Z7748 Rho GTPase-activating pro no no 0.281 0.328 0.244 2e-11
Q91YM21499 Rho GTPase-activating pro no no 0.180 0.105 0.271 3e-11
>sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 112/227 (49%), Gaps = 25/227 (11%)

Query: 216 SVEQLKEK-PVKFPVIGRPILLALEDVDGT-PSFLEKAIRFIEEHGVQVEGILRQA---A 270
           S++ L+EK  +K  + G  + L  E  + T P F+ + I+ +E  G++V+GI R +   A
Sbjct: 264 SLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVERRGLEVDGIYRVSGNLA 323

Query: 271 YVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRT-D 329
            +  +   + + E+   + S  ED H++   +K   RELP    P       +EA +  D
Sbjct: 324 TIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYCFFEQFVEAIKIQD 383

Query: 330 RGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPL 389
             +R+ A++T +++  P PN   ++ +   ++ +A+ ++ N MST ++     P LLRP 
Sbjct: 384 NATRIKAVKT-LVKKLPRPNYDTMKVLFEHLKKIAAKESVNLMSTQSLGIVFGPTLLRP- 441

Query: 390 LAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFG 436
                E ET     G+ +  +L       +   IV  +L EY KIFG
Sbjct: 442 -----EKET-----GNMAVHML-------YQNQIVELMLSEYSKIFG 471




GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Gallus gallus (taxid: 9031)
>sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 Back     alignment and function description
>sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 Back     alignment and function description
>sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 Back     alignment and function description
>sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 Back     alignment and function description
>sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 Back     alignment and function description
>sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 Back     alignment and function description
>sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=2 SV=2 Back     alignment and function description
>sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=2 SV=2 Back     alignment and function description
>sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query875
224063307904 predicted protein [Populus trichocarpa] 0.848 0.820 0.612 0.0
224084580857 predicted protein [Populus trichocarpa] 0.818 0.835 0.606 0.0
255545924 980 conserved hypothetical protein [Ricinus 0.787 0.703 0.644 0.0
334186887933 Rho GTPase activation protein (RhoGAP) w 0.872 0.817 0.571 0.0
297799548925 predicted protein [Arabidopsis lyrata su 0.868 0.821 0.566 0.0
356510094927 PREDICTED: uncharacterized protein LOC10 0.793 0.748 0.540 0.0
357493921920 Rho GTPase-activating protein [Medicago 0.825 0.784 0.534 0.0
302142043900 unnamed protein product [Vitis vinifera] 0.785 0.763 0.556 0.0
224105983872 predicted protein [Populus trichocarpa] 0.784 0.786 0.558 0.0
357465311900 Rho GTPase-activating protein [Medicago 0.817 0.794 0.554 0.0
>gi|224063307|ref|XP_002301088.1| predicted protein [Populus trichocarpa] gi|222842814|gb|EEE80361.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/793 (61%), Positives = 583/793 (73%), Gaps = 51/793 (6%)

Query: 79  RAGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGI 138
             GN +FKSGPLFISSKGIGWTSWKKRWFILT TSLVFFRS+PSAIPQKGSEVNLTLGGI
Sbjct: 25  HGGNVIFKSGPLFISSKGIGWTSWKKRWFILTRTSLVFFRSNPSAIPQKGSEVNLTLGGI 84

Query: 139 DLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSA 198
           DLNNSGSVVV+ADKKLLTVLFPDGRDGRAFTLKAE+ EDLY WKTALENALAQAPST   
Sbjct: 85  DLNNSGSVVVRADKKLLTVLFPDGRDGRAFTLKAETSEDLYGWKTALENALAQAPSTSLV 144

Query: 199 TGQNGILKNDKAEAANGSVEQLKEK-PVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEE 257
            GQNGI ++D+A+ A+GS+EQLK+K PVK  VIGRPILLA+EDVDG+PSFLEKA+RFIE+
Sbjct: 145 MGQNGIFRDDQADGADGSLEQLKDKHPVKSLVIGRPILLAIEDVDGSPSFLEKALRFIED 204

Query: 258 HGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPAS 317
           HG++VEGILRQAA VDDV  RI+E+EQG TEFSP+EDAH+IADCVKY +RELPSSPVP S
Sbjct: 205 HGIKVEGILRQAADVDDVEHRIKEYEQGTTEFSPKEDAHVIADCVKYFLRELPSSPVPTS 264

Query: 318 CCNALLEARRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAV 377
           CCNALLEA RTDRGSRV+AMR A+ ETFPEPNR+LLQRIL+MMQTVAS K  NRMSTSAV
Sbjct: 265 CCNALLEAWRTDRGSRVNAMRVAVCETFPEPNRRLLQRILLMMQTVASHKAVNRMSTSAV 324

Query: 378 AACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGE 437
           AACMAPLLLRPLLAG+CEIE++FNVGGDGS QLL+AAAAANHAQAIVITLLEEY+KIF E
Sbjct: 325 AACMAPLLLRPLLAGDCEIESNFNVGGDGSIQLLKAAAAANHAQAIVITLLEEYEKIFSE 384

Query: 438 GSASPEELYSESELSGSGTEEATDDDESYEDDDQDGATPESDAYTDDDLDNASSRSCSES 497
           GS SP  LYS+S+  GS  EE TDDDESY DD    AT ESD YTD D DNASS +C++S
Sbjct: 385 GSMSP-GLYSDSDECGSEDEEVTDDDESYVDD----ATEESDVYTDADNDNASSGTCTQS 439

Query: 498 GESGDSVVYKDKKNIAPFLYYVLKMQDVGVGSKSPER--NDNSEINQNPSSTSHEKALPQ 555
           G+S +           P  + +    D+  G K PE   +++ ++ Q  SS   + +LP 
Sbjct: 440 GDSCED---------DPSDHEMQGSDDLSSGFKYPEAEVDNDLKVEQKLSSHPVQASLPD 490

Query: 556 NEDVKDSKNIQNQSENNSSRQVNESAELLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNE 615
             D         QS  + +   ++S +L VDVS+ TS E K+   +     +K++ +SN 
Sbjct: 491 TPD---------QSNYSLAMLPDKSDDLSVDVSTETSLENKIADYNASPNAKKTTTISNG 541

Query: 616 SVYGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILE 675
            V G KRPTVWGRTAA+KNLSMESID P + +VEIQ+LE TK ++Q  I++EVKGN IL+
Sbjct: 542 LVRG-KRPTVWGRTAAKKNLSMESIDYPIEEDVEIQKLEATKIEMQNIISEEVKGNAILQ 600

Query: 676 ASLESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTK 735
           A+LE + KA HE RLAL+ DVARL++QLQKER+KR  +EAGL    G   +P TIDEK K
Sbjct: 601 ANLEKQTKAFHEYRLALQQDVARLQEQLQKEREKRKFLEAGLNTSKGPLQVPVTIDEKMK 660

Query: 736 VELGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSNQ-----LHQTSTKLKDK 790
            EL EI QAE D+ NLKQK  DL  QL++Q ++  G +    NQ     LH+   K   +
Sbjct: 661 AELEEITQAEADVANLKQKVDDLHAQLNQQCDERSGSMHGLGNQPMNASLHK--AKGNGE 718

Query: 791 QRDNEAAAERLRIKQEVNKDGAAESDNEKKQESLSFPNKLPPQNQQVDSMHTVTSRSTAP 850
           ++D EA A   +  +  +KD   +                  + QQ+DS H   SR  + 
Sbjct: 719 EKDAEATASS-QFGRSASKDTCMDG----------------AETQQLDSKHCGNSRPISS 761

Query: 851 INSRKSGTRSEFL 863
            NS++SG RSE +
Sbjct: 762 TNSKRSGARSEGM 774




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224084580|ref|XP_002307345.1| predicted protein [Populus trichocarpa] gi|222856794|gb|EEE94341.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545924|ref|XP_002514022.1| conserved hypothetical protein [Ricinus communis] gi|223547108|gb|EEF48605.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|334186887|ref|NP_194189.6| Rho GTPase activation protein (RhoGAP) with PH domain [Arabidopsis thaliana] gi|332659528|gb|AEE84928.1| Rho GTPase activation protein (RhoGAP) with PH domain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799548|ref|XP_002867658.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313494|gb|EFH43917.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356510094|ref|XP_003523775.1| PREDICTED: uncharacterized protein LOC100796201 [Glycine max] Back     alignment and taxonomy information
>gi|357493921|ref|XP_003617249.1| Rho GTPase-activating protein [Medicago truncatula] gi|355518584|gb|AET00208.1| Rho GTPase-activating protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|302142043|emb|CBI19246.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105983|ref|XP_002314002.1| predicted protein [Populus trichocarpa] gi|222850410|gb|EEE87957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357465311|ref|XP_003602937.1| Rho GTPase-activating protein [Medicago truncatula] gi|355491985|gb|AES73188.1| Rho GTPase-activating protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query875
TAIR|locus:2150265870 AT5G19390 [Arabidopsis thalian 0.860 0.865 0.476 1.4e-167
TAIR|locus:2176992827 AT5G12150 [Arabidopsis thalian 0.408 0.431 0.638 1.4e-163
ZFIN|ZDB-GENE-090313-87698 arhgap22 "Rho GTPase activatin 0.158 0.199 0.296 1e-16
UNIPROTKB|Q5ZMM3475 ARHGAP15 "Rho GTPase-activatin 0.196 0.362 0.268 5.1e-14
RGD|1310017813 Arhgap12 "Rho GTPase activatin 0.196 0.211 0.275 1.5e-13
MGI|MGI:1922665838 Arhgap12 "Rho GTPase activatin 0.196 0.205 0.275 6.7e-13
ZFIN|ZDB-GENE-070912-314465 arhgap15 "Rho GTPase activatin 0.228 0.430 0.258 9.4e-13
UNIPROTKB|Q504X1841 ARHGAP12 "Rho GTPase-activatin 0.196 0.204 0.269 1.1e-12
UNIPROTKB|Q8IWW6846 ARHGAP12 "Rho GTPase-activatin 0.196 0.203 0.269 1.1e-12
ZFIN|ZDB-GENE-030131-3922970 arhgap27 "Rho GTPase activatin 0.232 0.209 0.282 1.2e-12
TAIR|locus:2150265 AT5G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1630 (578.8 bits), Expect = 1.4e-167, P = 1.4e-167
 Identities = 370/777 (47%), Positives = 479/777 (61%)

Query:    80 AGNAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAIPQKGSEVNLTLGGID 139
             A N VFKSGPLFISSKG+GWTSWKKRWFILT TSLVFF++DP  +PQKG EVNLTLGGID
Sbjct:    15 ASNTVFKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPGTLPQKGGEVNLTLGGID 74

Query:   140 LNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSAT 199
             LNNSGSVVV+ DKKLLTVLFPDGRDGRAFTLKAE+ EDLY+WKTALE ALAQAP+     
Sbjct:    75 LNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETFEDLYEWKTALEQALAQAPNAALIM 134

Query:   200 GQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALEDVDGTPSFLEKAIRFIEEHG 259
             GQNGI +   AE  N ++E  +++P+K  V+GRPILLALED+DG+PSFLEKA++FIE++G
Sbjct:   135 GQNGIFR---AET-NEAIEGREKRPLKSLVVGRPILLALEDIDGSPSFLEKALQFIEKYG 190

Query:   260 VQVEGILRQAAYVDDVHRRIREFEQGKTEFSPEEDAHIIADCVKYVIRELPSSPVPASCC 319
              ++EGILRQ+A V++V RR++E+EQGKTEF+ +ED H++ DC+K+V+RELPSSPV ASCC
Sbjct:   191 TKIEGILRQSADVEEVERRVQEYEQGKTEFTFDEDPHVVGDCIKHVLRELPSSPVSASCC 250

Query:   320 NALLEARRTD-RGSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVA 378
              ALLEA R + + +R+S++R+AI ETFPEPNR+LLQRIL MM T++S  ++NRM+ +AVA
Sbjct:   251 TALLEAYRIESKEARISSLRSAIAETFPEPNRRLLQRILKMMHTISSHSHENRMNPNAVA 310

Query:   379 ACMAPLLLRPLLAGECEIETDFNVGGDGSXXXXXXXXXXXXXXXIVITLLEEYDKIFGEG 438
             ACMAPLLLRPLLAGEC++E DF+ G D S               I+  LLE+Y  IF E 
Sbjct:   311 ACMAPLLLRPLLAGECDLEDDFDGGEDNSAQLLAAANAANNAQAIITVLLEDYGSIFDE- 369

Query:   439 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGATPESDAYTDDDLDNAXXXXXXXXX 498
                                                A  E +  TDDD D A         
Sbjct:   370 ENIQRCSISTESHIGNSGPDDSSDDDNNMKNGYHNADNEVEPVTDDDNDRALSGKMSESS 429

Query:   499 XXXXXVVYKDKKNIAPFLYYVLKMQDVGVGSKSPERNDNSEINQNPSSTSHEKALPQNED 558
                   +Y+ K  +A            G    S  R D+   N   +ST  +      +D
Sbjct:   430 GCTGSDLYEYKGFVADDSDIESPRDTNGPRCNSNIRTDHLMRNPFVNSTDQQAGEQIGDD 489

Query:   559 VKDSKNIQNQSENNSSRQVNESAE-LLVDVSSGTSSEFKLNCQSPKSCLEKSSPVSNESV 617
                +K   N    + S    +S   L V     T +   L   S KS + K +P    SV
Sbjct:   490 --PTKYGVNSCLAHVSESYQQSGTGLNVPTHGNTLAAPGLESPSAKS-VNKGTP---SSV 543

Query:   618 YGSKRPTVWGRTAARKNLSMESIDGPSDNEVEIQRLEDTKSDLQRKIADEVKGNEILEAS 677
             + +KR T WGR +ARK  +  S D   ++E+ IQRLE TK++L+++IA E +GN IL+AS
Sbjct:   544 H-AKRATFWGRGSARKISTDGSFDSSGEDELAIQRLETTKNELRQRIAKEARGNAILQAS 602

Query:   678 LESRKKALHERRLALENDVARLKDQLQKERDKRTAMEAGLGEFNGSFPIPDTIDEKTKVE 737
             LE RK+ALHERRL+LE DV+RL++QLQ ERD R A+E GL   +G F     +D KT+ E
Sbjct:   603 LERRKQALHERRLSLEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFS-SHGVDSKTRAE 661

Query:   738 LGEIAQAETDIINLKQKAKDLRVQLSEQLEKNDGFVGDSSN-----QLHQTSTKLKDKQR 792
             L EIA AE D+  LKQK  +L  QL++Q + + G   D+ +     Q H    +   +  
Sbjct:   662 LEEIALAEADVARLKQKVAELHHQLNQQRQTHFGSFSDARDTHQYLQNHNPQKRFLQQDF 721

Query:   793 DNEAAAERLRIKQ--EVNKDGAAESDNEKKQESLSFPNKLPPQNQQV-DSMHTVTSR 846
             D+  A      KQ  E N  GA E  N K   S    N   P  +Q+ +S +T  S+
Sbjct:   722 DSTLAYVNHERKQRHEENVLGA-EWRNSKGAGSFGVGNSRQPSRKQIPESTNTTDSK 777




GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0035091 "phosphatidylinositol binding" evidence=ISS
GO:0005100 "Rho GTPase activator activity" evidence=ISS
TAIR|locus:2176992 AT5G12150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-87 arhgap22 "Rho GTPase activating protein 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMM3 ARHGAP15 "Rho GTPase-activating protein 15" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310017 Arhgap12 "Rho GTPase activating protein 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1922665 Arhgap12 "Rho GTPase activating protein 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-314 arhgap15 "Rho GTPase activating protein 15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q504X1 ARHGAP12 "Rho GTPase-activating protein 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IWW6 ARHGAP12 "Rho GTPase-activating protein 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3922 arhgap27 "Rho GTPase activating protein 27" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00020958
hypothetical protein (904 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query875
pfam00620152 pfam00620, RhoGAP, RhoGAP domain 5e-32
cd00159169 cd00159, RhoGAP, RhoGAP: GTPase-activator protein 2e-29
smart00324174 smart00324, RhoGAP, GTPase-activator protein for R 3e-25
pfam1438988 pfam14389, Lzipper-MIP1, Leucine-zipper of ternary 6e-23
cd04403187 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_ 2e-16
cd04377186 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGA 8e-16
cd04373185 cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase- 9e-14
cd04404195 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGA 2e-13
cd04393189 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP 5e-12
cd04376206 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (G 8e-12
cd04390199 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24 1e-11
cd04385184 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase- 2e-11
cd04407186 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: Rho 2e-11
cd04389187 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase- 3e-11
cd04391216 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP 3e-11
cd04379207 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase- 3e-11
cd04384195 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPas 6e-11
smart00233102 smart00233, PH, Pleckstrin homology domain 3e-10
cd04406186 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: Rho 1e-09
pfam00169101 pfam00169, PH, PH domain 1e-09
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 2e-09
cd04374203 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activato 4e-09
cd04386203 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTP 9e-09
cd04387196 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-ac 1e-08
cd04398192 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPas 2e-08
cd04409211 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPas 3e-08
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 1e-07
cd04375220 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase- 2e-07
cd04395196 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP 2e-07
cd04402192 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP 3e-07
cd04382193 cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGA 5e-07
cd04378203 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: Rho 1e-06
cd04372194 cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGA 1e-06
cd04394202 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGA 2e-06
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 5e-06
cd04383188 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPas 6e-06
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 7e-06
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 1e-05
cd04381182 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTP 2e-05
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 4e-05
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 8e-05
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 9e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 2e-04
cd13297123 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h 2e-04
cd04408200 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase- 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
cd1332690 cd13326, PH_CNK_insect-like, Connector enhancer of 4e-04
cd1327991 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) d 4e-04
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 7e-04
cd04392208 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP 7e-04
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 8e-04
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 9e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 0.002
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 0.002
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 0.004
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
>gnl|CDD|216027 pfam00620, RhoGAP, RhoGAP domain Back     alignment and domain information
 Score =  121 bits (306), Expect = 5e-32
 Identities = 45/147 (30%), Positives = 70/147 (47%), Gaps = 4/147 (2%)

Query: 245 PSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEFSP--EEDAHIIADCV 302
           P  +EK + F+E+ G+  EGI R +     +      F+ G+       EED H++A  +
Sbjct: 1   PLIVEKCVEFLEKRGLDTEGIFRVSGSASRIKELREAFDSGEDVDLDLEEEDVHVVASLL 60

Query: 303 KYVIRELPSSPVPASCCNALLEA-RRTDRGSRVSAMRTAILETFPEPNRKLLQRILMMMQ 361
           K  +RELP   +        +EA +  D   RV A+R  +L   P  NR  L+ +L  + 
Sbjct: 61  KLFLRELPEPLLTFELYEEFIEAAKSEDEEERVEALR-ELLRKLPPANRDTLRYLLAHLN 119

Query: 362 TVASSKNQNRMSTSAVAACMAPLLLRP 388
            VA +   N+M+   +A    P LLRP
Sbjct: 120 RVAQNSEVNKMNAHNLAIVFGPTLLRP 146


GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. Length = 152

>gnl|CDD|238090 cd00159, RhoGAP, RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases Back     alignment and domain information
>gnl|CDD|214618 smart00324, RhoGAP, GTPase-activator protein for Rho-like GTPases Back     alignment and domain information
>gnl|CDD|206557 pfam14389, Lzipper-MIP1, Leucine-zipper of ternary complex factor MIP1 Back     alignment and domain information
>gnl|CDD|239868 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains Back     alignment and domain information
>gnl|CDD|239842 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins Back     alignment and domain information
>gnl|CDD|239838 cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins Back     alignment and domain information
>gnl|CDD|239869 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) Back     alignment and domain information
>gnl|CDD|239858 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins Back     alignment and domain information
>gnl|CDD|239841 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins Back     alignment and domain information
>gnl|CDD|239855 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239850 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs Back     alignment and domain information
>gnl|CDD|239872 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB Back     alignment and domain information
>gnl|CDD|239854 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain Back     alignment and domain information
>gnl|CDD|239856 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins Back     alignment and domain information
>gnl|CDD|239844 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins Back     alignment and domain information
>gnl|CDD|239849 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|239871 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239839 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins Back     alignment and domain information
>gnl|CDD|239851 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins Back     alignment and domain information
>gnl|CDD|239852 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins Back     alignment and domain information
>gnl|CDD|239863 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins Back     alignment and domain information
>gnl|CDD|239874 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239840 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins Back     alignment and domain information
>gnl|CDD|239860 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins Back     alignment and domain information
>gnl|CDD|239867 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins Back     alignment and domain information
>gnl|CDD|239847 cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins Back     alignment and domain information
>gnl|CDD|239843 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>gnl|CDD|239837 cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins Back     alignment and domain information
>gnl|CDD|239859 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|239848 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|239846 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 Back     alignment and domain information
>gnl|CDD|239873 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|239857 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 875
KOG1451812 consensus Oligophrenin-1 and related Rho GTPase-ac 100.0
KOG42711100 consensus Rho-GTPase activating protein [Signal tr 100.0
cd04372194 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- 100.0
cd04386203 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa 100.0
cd04402192 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac 100.0
cd04390199 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas 100.0
cd04391216 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac 100.0
cd04375220 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator 100.0
cd04407186 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas 100.0
cd04384195 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato 100.0
cd04383188 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato 100.0
cd04381182 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa 100.0
cd04403187 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G 100.0
cd04397213 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato 100.0
cd04395196 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac 100.0
cd04404195 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- 100.0
cd04408200 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator 100.0
cd04406186 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas 100.0
cd04394202 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- 100.0
cd04398192 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato 100.0
cd04396225 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas 100.0
cd04376206 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti 100.0
cd04378203 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas 100.0
cd04373185 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator 100.0
cd04409211 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato 100.0
cd04400190 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato 100.0
cd04377186 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- 100.0
cd04393189 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac 100.0
cd04387196 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr 100.0
cd04379207 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator 100.0
KOG4407 1973 consensus Predicted Rho GTPase-activating protein 100.0
cd04392208 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac 100.0
cd04385184 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator 100.0
cd04374203 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein 100.0
cd04382193 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- 100.0
cd04399212 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activato 100.0
cd04389187 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator 100.0
cd04388200 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr 100.0
KOG1450650 consensus Predicted Rho GTPase-activating protein 99.98
KOG4270577 consensus GTPase-activator protein [Signal transdu 99.97
smart00324174 RhoGAP GTPase-activator protein for Rho-like GTPas 99.97
KOG11171186 consensus Rho- and Arf-GTPase activating protein A 99.97
KOG2200674 consensus Tumour suppressor protein p122-RhoGAP/DL 99.97
cd04380220 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato 99.96
cd00159169 RhoGAP RhoGAP: GTPase-activator protein (GAP) for 99.96
KOG42691112 consensus Rac GTPase-activating protein BCR/ABR [S 99.96
PF00620151 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members 99.95
KOG4406467 consensus CDC42 Rho GTPase-activating protein [Sig 99.95
KOG2710412 consensus Rho GTPase-activating protein [Signal tr 99.93
KOG4724741 consensus Predicted Rho GTPase-activating protein 99.91
KOG1453918 consensus Chimaerin and related Rho GTPase activat 99.91
KOG3564604 consensus GTPase-activating protein [General funct 99.9
PF1438988 Lzipper-MIP1: Leucine-zipper of ternary complex fa 99.86
KOG42711100 consensus Rho-GTPase activating protein [Signal tr 99.75
KOG1452442 consensus Predicted Rho GTPase-activating protein 99.72
cd04405235 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPas 99.6
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.6
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.59
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.55
cd04401198 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activato 99.53
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.51
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.51
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.47
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.46
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.44
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.43
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.41
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.39
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.39
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.34
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.34
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.33
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.33
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.31
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.3
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.28
KOG4370514 consensus Ral-GTPase effector RLIP76 [Signal trans 99.23
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.23
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.2
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.2
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.16
KOG3565640 consensus Cdc42-interacting protein CIP4 [Cytoskel 99.13
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.11
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.1
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.03
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 98.97
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.93
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 98.91
PF1540989 PH_8: Pleckstrin homology domain 98.9
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.77
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.73
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.68
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.64
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.63
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 98.56
KOG4724741 consensus Predicted Rho GTPase-activating protein 98.47
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.32
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.23
PF08101420 DUF1708: Domain of unknown function (DUF1708); Int 98.21
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.13
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.12
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 97.96
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 97.74
KOG3751622 consensus Growth factor receptor-bound proteins (G 97.72
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 97.61
KOG10901732 consensus Predicted dual-specificity phosphatase [ 97.6
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 97.45
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 97.43
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 97.38
PLN00188719 enhanced disease resistance protein (EDR2); Provis 97.23
PTZ00267478 NIMA-related protein kinase; Provisional 97.15
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 97.15
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.11
KOG35431218 consensus Ca2+-dependent activator protein [Signal 97.01
PF15408104 PH_7: Pleckstrin homology domain 96.31
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 96.25
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 96.21
KOG1453918 consensus Chimaerin and related Rho GTPase activat 96.13
KOG05172473 consensus Beta-spectrin [Cytoskeleton] 95.67
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 95.57
KOG35311036 consensus Rho guanine nucleotide exchange factor C 95.54
PLN028661068 phospholipase D 95.5
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 95.32
PTZ00283496 serine/threonine protein kinase; Provisional 95.23
KOG0248936 consensus Cytoplasmic protein Max-1, contains PH, 95.08
KOG3723851 consensus PH domain protein Melted [Signal transdu 94.98
KOG0705749 consensus GTPase-activating protein Centaurin gamm 94.79
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 94.36
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 94.17
PF15404185 PH_4: Pleckstrin homology domain 94.14
KOG11171186 consensus Rho- and Arf-GTPase activating protein A 93.79
KOG1739611 consensus Serine/threonine protein kinase GPBP [Si 93.78
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 93.29
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 93.11
KOG1449 670 consensus Predicted Rho GTPase-activating protein 92.78
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.53
KOG1449670 consensus Predicted Rho GTPase-activating protein 92.47
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 92.2
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 91.7
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 91.35
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 90.74
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 89.33
PF12240205 Angiomotin_C: Angiomotin C terminal; InterPro: IPR 88.44
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 88.43
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 87.91
cd0008972 HR1 Protein kinase C-related kinase homology regio 87.77
PF10186302 Atg14: UV radiation resistance protein and autopha 87.56
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 86.9
KOG1737799 consensus Oxysterol-binding protein [Lipid transpo 86.39
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 83.27
PF15406112 PH_6: Pleckstrin homology domain 83.1
KOG3549505 consensus Syntrophins (type gamma) [Extracellular 82.8
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.1e-60  Score=526.24  Aligned_cols=355  Identities=23%  Similarity=0.326  Sum_probs=298.0

Q ss_pred             ceeecCCchhhHhhhccchhhhcccceecccC-CCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCC
Q 002835            3 IFQIFPPTHSIFAESCNHDAGDLVIGIWSVKA-PNGLRRKNLSGDAGTPPMATNPPGGPPSGQPPGPPPGPNDHRITRAG   81 (875)
Q Consensus         3 ~~~~~~~~~~~~~~df~~y~~~L~~~lq~tR~-~~~tR~~~esl~~~~~km~~~p~~~~~~~~~p~~~~~p~~~~~~~~~   81 (875)
                      +|.|||.|- |+++||+||+++||+.|||||+ |++||.++++|   +++|+++|..                .   +.+
T Consensus       206 lf~f~h~g~-el~qDF~pfk~qlq~s~QnTrn~f~~Tr~E~EeL---kKkmke~p~e----------------~---k~p  262 (812)
T KOG1451|consen  206 LFSFFHVGS-ELHQDFKPFKDQLQTSVQNTRNNFNATRAEAEEL---KKKMKESPTE----------------D---KRP  262 (812)
T ss_pred             HHHHhhhhH-HHHhhhhhHHHHHHHHHHHhhhcccchHHHHHHH---HHHHhhCccc----------------c---cCC
Confidence            356666665 9999999999999999999999 99999999999   9999988862                1   112


Q ss_pred             CcEEEEeeeEeecCCCCccCceeEEEEEeCCeEEEecCCCCCC--CCCCccceeecCCeeecCCCceeeecCCcceEEEE
Q 002835           82 NAVFKSGPLFISSKGIGWTSWKKRWFILTHTSLVFFRSDPSAI--PQKGSEVNLTLGGIDLNNSGSVVVKADKKLLTVLF  159 (875)
Q Consensus        82 ~~v~KEGyL~k~kKg~~~ksWkKRWfVL~~~sL~yYKd~k~~~--p~~g~e~~i~L~~~~l~~s~sv~~~~~KK~~FvI~  159 (875)
                      .+.+++||||.++|.+..++|.|+||+|.+.+..|..-.-+-+  ...|+...+.|+.|..+..++    ++|+|||++.
T Consensus       263 ~p~t~eGYlY~QEK~~~g~sWvKyYC~Y~retk~~TMvp~~qk~g~k~g~~~~~~lKsC~RRktdS----IdKRFCFDve  338 (812)
T KOG1451|consen  263 TPSTKEGYLYMQEKSKIGKSWVKYYCVYSRETKIFTMVPANQKTGTKMGQTATFKLKSCSRRKTDS----IDKRFCFDVE  338 (812)
T ss_pred             CCcccceeeeehhhhhccchhhhheeEeecccceEEEeecccCCCCcCCCcceEEehhhccCcccc----cccceeeeee
Confidence            2368999999999999899999999999999877755433221  223555669999999998754    5999999999


Q ss_pred             ecCCCCceeEEEecchhhHHHHHHHHHhhhccCCCCCCCCcccCcccccchhhccCchhhhcccCCCCCccccChhHhhh
Q 002835          160 PDGRDGRAFTLKAESLEDLYDWKTALENALAQAPSTGSATGQNGILKNDKAEAANGSVEQLKEKPVKFPVIGRPILLALE  239 (875)
Q Consensus       160 ~~~~dgrty~fQAdSEeE~~eWI~AI~~ai~~aP~~~~~~~~~~if~~~~~~~~~~s~~~~~~K~~k~~vFGvpLe~ll~  239 (875)
                      ...++| +.++||.+++++..||.||+++.   |.+.  .+.+ +       +..+                   +..+ 
T Consensus       339 ~~erpg-viTmQALSE~drrlWmeAMDG~e---p~Y~--s~~~-~-------~~~~-------------------~~qL-  384 (812)
T KOG1451|consen  339 VEERPG-VITMQALSEKDRRLWMEAMDGAE---PSYT--SGEN-C-------STYK-------------------QTQL-  384 (812)
T ss_pred             ecccCC-eeehHhhhhhHHHHHHHHhcCCC---cccc--Cccc-c-------chhh-------------------hhhh-
Confidence            988886 58999999999999999999985   4432  1111 0       0000                   0111 


Q ss_pred             cCCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCC----CC--CCCCCCchhhHhhHHHHHhhCCCCC
Q 002835          240 DVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGK----TE--FSPEEDAHIIADCVKYVIRELPSSP  313 (875)
Q Consensus       240 ~~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~----~~--~~~~~D~h~VAslLK~fLReLPePL  313 (875)
                       ++-...||.+||..|+..|++++|+||..|.+.+|++|...+-..+    .+  ....||+.+|++.||.|||.||+||
T Consensus       385 -d~iGF~fvrkCI~i~Et~GI~eqGlYR~vGvns~VQKlln~~fDPK~ase~d~dn~~eWeiKTITSaLKtYLRnLpEPL  463 (812)
T KOG1451|consen  385 -DDIGFEFVRKCIDILETSGIHEQGLYRNVGVNSKVQKLLNLGFDPKKASEKDGDNLDEWEIKTITSALKTYLRNLPEPL  463 (812)
T ss_pred             -hhhhHHHHHHHHHHHHhcCcccccchhhccchHHHHHHHHhcCCCCCccccccchhhhhhhhhHHHHHHHHHHhCCchh
Confidence             2245789999999999999999999999999999999988754422    22  2357899999999999999999999


Q ss_pred             CChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhcccCCCccccceeecccccCCCcCC
Q 002835          314 VPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAG  392 (875)
Q Consensus       314 lp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~~NkMta~NLAi~FgPtLLrp~~s~  392 (875)
                      ++|.++..||.|++.++ +.|+.+||.|++ +||+.||.+|..||+||.+|+.|+..|.||+.||+|||||+||||++  
T Consensus       464 MTY~LHk~FI~AAKsdnq~yRv~aIHsLVH-kLPEKNReMLelLirHLvnVa~hSkeNLMTVSNLGViFGPTLlRpQE--  540 (812)
T KOG1451|consen  464 MTYELHKVFINAAKSDNQTYRVDAIHSLVH-KLPEKNREMLELLIRHLVNVADHSKENLMTVSNLGVIFGPTLLRPQE--  540 (812)
T ss_pred             hHHHHHHHHHHHHhccchhhhHHHHHHHHH-hccHhhHHHHHHHHHHHHHHHhhhhcccccccccceeecccccCchH--
Confidence            99999999999999999 999999999998 99999999999999999999999999999999999999999999984  


Q ss_pred             ccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhcccccCCC
Q 002835          393 ECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEG  438 (875)
Q Consensus       393 ~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF~e~  438 (875)
                          |+            ++|+|.+++++-||++||+||++||...
T Consensus       541 ----ET------------VAAiMdIKFQNIVVEILIEnyeKIF~t~  570 (812)
T KOG1451|consen  541 ----ET------------VAAIMDIKFQNIVVEILIENYEKIFKTK  570 (812)
T ss_pred             ----HH------------HHHHHcchhhhhhHHHHHhhhHHHhcCC
Confidence                33            6788888888888999999999999844



>KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins Back     alignment and domain information
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins Back     alignment and domain information
>cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins Back     alignment and domain information
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain Back     alignment and domain information
>cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins Back     alignment and domain information
>cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins Back     alignment and domain information
>cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB Back     alignment and domain information
>cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA Back     alignment and domain information
>cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs Back     alignment and domain information
>cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin Back     alignment and domain information
>cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains Back     alignment and domain information
>cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins Back     alignment and domain information
>cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins Back     alignment and domain information
>cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) Back     alignment and domain information
>cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) Back     alignment and domain information
>cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA Back     alignment and domain information
>cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins Back     alignment and domain information
>cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins Back     alignment and domain information
>cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins Back     alignment and domain information
>cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins Back     alignment and domain information
>cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins Back     alignment and domain information
>cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins Back     alignment and domain information
>cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins Back     alignment and domain information
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins Back     alignment and domain information
>cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins Back     alignment and domain information
>cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins Back     alignment and domain information
>KOG4407 consensus Predicted Rho GTPase-activating protein [General function prediction only] Back     alignment and domain information
>cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins Back     alignment and domain information
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs Back     alignment and domain information
>cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins Back     alignment and domain information
>cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins Back     alignment and domain information
>cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins Back     alignment and domain information
>cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain Back     alignment and domain information
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) Back     alignment and domain information
>KOG1450 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4270 consensus GTPase-activator protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2200 consensus Tumour suppressor protein p122-RhoGAP/DLC1 [Signal transduction mechanisms] Back     alignment and domain information
>cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins Back     alignment and domain information
>cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases Back     alignment and domain information
>KOG4269 consensus Rac GTPase-activating protein BCR/ABR [Signal transduction mechanisms] Back     alignment and domain information
>PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation Back     alignment and domain information
>KOG4406 consensus CDC42 Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2710 consensus Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3564 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>PF14389 Lzipper-MIP1: Leucine-zipper of ternary complex factor MIP1 Back     alignment and domain information
>KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04405 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of BRCC3-like proteins Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd04401 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal MSB1-like proteins Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4370 consensus Ral-GTPase effector RLIP76 [Signal transduction mechanisms] Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3565 consensus Cdc42-interacting protein CIP4 [Cytoskeleton] Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>PF08101 DUF1708: Domain of unknown function (DUF1708); InterPro: IPR012965 This is a fungal domain of unknown function, though the yeast protein MSB1(P21339 from SWISSPROT) which contains this domain is thought to play a role in bud formation [] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0517 consensus Beta-spectrin [Cytoskeleton] Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd00089 HR1 Protein kinase C-related kinase homology region 1 domain; also known as the ACC (antiparallel coiled-coil) finger domain or Rho-binding domain Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query875
3fk2_A246 Crystal Structure Of The Rhogap Domain Of Human Glu 8e-12
3byi_A214 Crystal Structure Of Human Rho Gtpase Activating Pr 1e-11
2ee5_A219 Solution Structure Of The N-Teruminus Extended Rhog 3e-09
2ee4_A209 Solution Structure Of The Rhogap Domain From Human 6e-09
3kuq_A228 Crystal Structure Of The Dlc1 Rhogap Domain Length 1e-08
1am4_A199 Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S 4e-08
1grn_B203 Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX 4e-08
1ow3_A242 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 5e-08
1tx4_A198 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 8e-08
2ngr_B234 Transition State Complex For Gtp Hydrolysis By Cdc4 4e-07
1f7c_A231 Crystal Structure Of The Bh Domain From Graf, The G 1e-06
3msx_B201 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 5e-06
3eap_A271 Crystal Structure Of The Rhogap Domain Of Arhgap11a 2e-05
>pdb|3FK2|A Chain A, Crystal Structure Of The Rhogap Domain Of Human Glucocorticoid Receptor Dna-Binding Factor 1 Length = 246 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 43/162 (26%), Positives = 81/162 (50%), Gaps = 4/162 (2%) Query: 230 IGRPILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKTEF 289 G P+ + P F+E+ I +IE G+ EGI R + ++ R+F+Q Sbjct: 54 FGVPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLD 113 Query: 290 SPEEDAHI--IADCVKYVIRELPSSPVPASCCNALLEARRT-DRGSRVSAMRTAILETFP 346 E+D + +A +K ELP VP + L+EA + DR ++ A++ +L+ FP Sbjct: 114 LAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALK-EVLKKFP 172 Query: 347 EPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRP 388 + N ++ + ++ + V+ + N M++ ++ C P L+RP Sbjct: 173 KENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRP 214
>pdb|3BYI|A Chain A, Crystal Structure Of Human Rho Gtpase Activating Protein 15 (arhgap15) Length = 214 Back     alignment and structure
>pdb|2EE5|A Chain A, Solution Structure Of The N-Teruminus Extended Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 219 Back     alignment and structure
>pdb|2EE4|A Chain A, Solution Structure Of The Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 209 Back     alignment and structure
>pdb|3KUQ|A Chain A, Crystal Structure Of The Dlc1 Rhogap Domain Length = 228 Back     alignment and structure
>pdb|1AM4|A Chain A, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 199 Back     alignment and structure
>pdb|1GRN|B Chain B, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX Length = 203 Back     alignment and structure
>pdb|1OW3|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 242 Back     alignment and structure
>pdb|1TX4|A Chain A, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 Back     alignment and structure
>pdb|2NGR|B Chain B, Transition State Complex For Gtp Hydrolysis By Cdc42: Comparisons Of The High Resolution Structures For Cdc42 Bound To The Active And Catalytically Compromised Forms Of The Cdc42-gap Length = 234 Back     alignment and structure
>pdb|1F7C|A Chain A, Crystal Structure Of The Bh Domain From Graf, The Gtpase Regulator Associated With Focal Adhesion Kinase Length = 231 Back     alignment and structure
>pdb|3MSX|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 201 Back     alignment and structure
>pdb|3EAP|A Chain A, Crystal Structure Of The Rhogap Domain Of Arhgap11a Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query875
1tx4_A198 P50-rhogap; complex (GTPase activation/proto-oncog 2e-32
1ow3_A242 RHO-GTPase-activating protein 1; complex, GTPase, 1e-31
3msx_B201 RHO GTPase-activating protein 20; protein-proten c 3e-30
3kuq_A228 RHO GTPase-activating protein 7; structural genomi 4e-29
3fk2_A246 Glucocorticoid receptor DNA-binding factor 1; stru 9e-29
2ee4_A209 RHO GTPase activating protein 5 variant; all alpha 1e-28
3byi_A214 RHO GTPase activating protein 15; BM046, arhgap15, 2e-27
3eap_A271 RHO GTPase-activating protein 11A; GAP, structural 3e-27
2ovj_A201 Mgcracgap, RAC GTPase-activating protein 1; signal 1e-26
1f7c_A231 Rhogap protein; GTPase activating protein, RHO GTP 2e-26
2osa_A202 N-chimaerin; RHO-GAP, GTPase activation, structura 4e-26
3iug_A229 RHO/CDC42/RAC GTPase-activating protein RICS; stru 1e-24
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 2e-24
1pbw_A216 Rhogap domain, phosphatidylinositol 3-kinase; phos 3e-23
3qis_A366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 5e-22
3aj4_A112 Pleckstrin homology domain-containing family B ME; 5e-18
2xs6_A214 Phosphatidylinositol 3-kinase regulatory subunit; 9e-18
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 2e-17
2d9v_A130 Pleckstrin homology domain-containing protein fami 9e-17
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 1e-13
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-13
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 9e-13
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-12
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 3e-12
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 5e-12
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 5e-12
3cxb_B112 Pleckstrin homology domain-containing family M mem 7e-12
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 1e-11
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-11
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 2e-11
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 2e-11
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-11
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 4e-11
2yry_A122 Pleckstrin homology domain-containing family A mem 4e-11
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 4e-11
2d9y_A117 Pleckstrin homology domain-containing protein fami 4e-11
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 4e-11
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 6e-11
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 1e-10
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-10
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-10
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 3e-10
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 3e-10
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 3e-10
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 4e-10
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 8e-10
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 9e-10
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 1e-09
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 1e-09
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 2e-09
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 6e-09
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 7e-09
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 7e-09
1v88_A130 Oxysterol binding protein-related protein 8; vesic 8e-09
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 1e-08
1u5e_A211 SRC-associated adaptor protein; novel dimerization 1e-08
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 2e-08
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 6e-08
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 6e-08
1wi1_A126 Calcium-dependent activator protein for secretion, 6e-08
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 4e-07
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 6e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-07
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 2e-06
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 2e-06
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 3e-06
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 3e-06
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 3e-06
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 4e-06
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 1e-05
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 3e-04
2d9w_A127 Docking protein 2; PH domain, structural genomics, 3e-04
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 4e-04
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 6e-04
>1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Length = 198 Back     alignment and structure
 Score =  123 bits (311), Expect = 2e-32
 Identities = 45/218 (20%), Positives = 87/218 (39%), Gaps = 26/218 (11%)

Query: 223 KPVKFPVIGRP---ILLALEDVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRI 279
            P+     G     +     + +  P  L + + +++ H +  EGI R++A    V R +
Sbjct: 2   PPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVV-REV 60

Query: 280 RE-FEQGKT-EFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAM 337
           ++ +  G   +F      H+ A  +K  +RELP   +       ++     D   RV A 
Sbjct: 61  QQKYNMGLPVDFDQYNALHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPAT 120

Query: 338 RTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIE 397
              +L+T PE N ++L+ +   +  +++  +QN+M+ + +A    P LL           
Sbjct: 121 L-QVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWA--------- 170

Query: 398 TDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF 435
                  D +  L     A N        LL+   ++F
Sbjct: 171 ------KDAAITL----KAINPINTFTKFLLDHQGELF 198


>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Length = 242 Back     alignment and structure
>3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Length = 201 Back     alignment and structure
>3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Length = 228 Back     alignment and structure
>3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Length = 246 Back     alignment and structure
>2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Length = 209 Back     alignment and structure
>3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Length = 214 Back     alignment and structure
>3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Length = 271 Back     alignment and structure
>2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Length = 201 Back     alignment and structure
>1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Length = 231 Back     alignment and structure
>2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Length = 202 Back     alignment and structure
>3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Length = 229 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Length = 216 Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Length = 366 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Length = 214 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query875
3byi_A214 RHO GTPase activating protein 15; BM046, arhgap15, 100.0
3msx_B201 RHO GTPase-activating protein 20; protein-proten c 100.0
1f7c_A231 Rhogap protein; GTPase activating protein, RHO GTP 100.0
2ee4_A209 RHO GTPase activating protein 5 variant; all alpha 100.0
1tx4_A198 P50-rhogap; complex (GTPase activation/proto-oncog 100.0
3iug_A229 RHO/CDC42/RAC GTPase-activating protein RICS; stru 100.0
2osa_A202 N-chimaerin; RHO-GAP, GTPase activation, structura 100.0
3fk2_A246 Glucocorticoid receptor DNA-binding factor 1; stru 100.0
1ow3_A242 RHO-GTPase-activating protein 1; complex, GTPase, 100.0
3kuq_A228 RHO GTPase-activating protein 7; structural genomi 100.0
1pbw_A216 Rhogap domain, phosphatidylinositol 3-kinase; phos 100.0
2ovj_A201 Mgcracgap, RAC GTPase-activating protein 1; signal 100.0
3eap_A271 RHO GTPase-activating protein 11A; GAP, structural 100.0
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 100.0
2xs6_A214 Phosphatidylinositol 3-kinase regulatory subunit; 100.0
3qis_A366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 99.97
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.75
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.73
1wi1_A126 Calcium-dependent activator protein for secretion, 99.7
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.65
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.64
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.62
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.61
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.61
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.61
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.61
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.6
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.6
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.58
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.58
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.58
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.58
2yry_A122 Pleckstrin homology domain-containing family A mem 99.57
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.57
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.57
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.57
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.57
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.57
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.57
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.57
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.56
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.56
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.56
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.55
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.55
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.55
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.54
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.54
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.53
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.53
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.53
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.52
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.52
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.52
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.52
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.52
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.52
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.51
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.5
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.5
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.5
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.49
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.49
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.47
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.47
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.46
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.44
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.41
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.39
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.33
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.32
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.3
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.26
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.22
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.18
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.18
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.17
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.1
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.04
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.98
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 98.95
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 98.89
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 98.88
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 98.86
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.63
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.36
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.2
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.57
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.2
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.18
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.14
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 96.8
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 96.78
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 96.76
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.72
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 96.47
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 96.3
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.11
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 96.0
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 95.81
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 95.57
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 95.46
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 95.46
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 95.46
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.02
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 94.85
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 94.82
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 94.41
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 94.36
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 94.19
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 94.12
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 93.98
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 93.2
3ksy_A1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 91.64
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.25
1foe_A377 T-lymphoma invasion and metastasis inducing protei 90.75
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 89.73
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 88.34
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 88.25
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 87.32
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 87.3
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 84.82
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 83.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 80.73
>3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7e-41  Score=346.77  Aligned_cols=205  Identities=26%  Similarity=0.432  Sum_probs=178.5

Q ss_pred             Cchhhhccc-CCCCCccccChhHhhhc-CCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCC-CCCCC
Q 002835          215 GSVEQLKEK-PVKFPVIGRPILLALED-VDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGK-TEFSP  291 (875)
Q Consensus       215 ~s~~~~~~K-~~k~~vFGvpLe~ll~~-~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~-~~~~~  291 (875)
                      ++.+.+++| ..+.++||+||+.++.+ +..||.+|.+|+.||+.+|+.+|||||++|+..+|++|+..++.|. .++..
T Consensus         4 ps~~~l~~~~~~~~~vFG~~L~~~~~~~~~~vP~~v~~~i~~l~~~gl~~eGIfR~~G~~~~i~~L~~~~~~~~~~~~~~   83 (214)
T 3byi_A            4 PSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDD   83 (214)
T ss_dssp             CCHHHHHHHTSCCCCSTTSCHHHHHHHHTCSSCHHHHHHHHHHHHHTTTSTTTTTSCCCHHHHHHHHHHHHTTCCCCTTS
T ss_pred             CchhhHHhcCCCcCCccCCcHHHHHHHcCCCCChHHHHHHHHHHHhCCCCCCccccCCCHHHHHHHHHHHhcCCCCCCCc
Confidence            444556666 77889999999998864 6789999999999999999999999999999999999999999985 33332


Q ss_pred             --CCCchhhHhhHHHHHhhCCCCCCChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhc
Q 002835          292 --EEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKN  368 (875)
Q Consensus       292 --~~D~h~VAslLK~fLReLPePLlp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~  368 (875)
                        ..|+|+||++||.|||+||+||||+++|+.|+.+.+..+ .+++..++.+|. +||+.|+.+|+||+.||++|+.|++
T Consensus        84 ~~~~dvh~va~lLK~flreLPePLl~~~l~~~~~~~~~~~~~~~~~~~l~~ll~-~LP~~n~~~L~~L~~~L~~v~~~s~  162 (214)
T 3byi_A           84 SQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQ-KLPPPNRDTMKVLFGHLTKIVAKAS  162 (214)
T ss_dssp             GGGCSHHHHHHHHHHHHHHSSSCSSCHHHHHHHHHHHTSSSHHHHHHHHHHHHH-HSCHHHHHHHHHHHHHHHHHHHTHH
T ss_pred             ccccchHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHhcCCHHHHHHHHHHHHH-hCCHHHHHHHHHHHHHHHHHHHccc
Confidence              249999999999999999999999999999999999888 899999999886 9999999999999999999999999


Q ss_pred             ccCCCccccceeecccccCCCcCCccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhcccccCCC
Q 002835          369 QNRMSTSAVAACMAPLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIFGEG  438 (875)
Q Consensus       369 ~NkMta~NLAi~FgPtLLrp~~s~~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF~e~  438 (875)
                      .|+||+.|||+||||+|||++...           +  .     .+......+.+|++||+||+.||+++
T Consensus       163 ~NkM~~~NLa~vf~P~Ll~~~~~~-----------~--~-----~~~~~~~~~~vve~LI~~~~~iF~~d  214 (214)
T 3byi_A          163 KNLMSTQSLGIVFGPTLLRAENET-----------G--N-----MAIHMVYQNQIAELMLSEYSKIFGSE  214 (214)
T ss_dssp             HHCCCHHHHHHHHHHHHHCCTTSS-----------S--C-----HHHHHHHHHHHHHHHHHTHHHHHC--
T ss_pred             CCCCCHHHhHHHhccccCCCCCcc-----------H--H-----HHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            999999999999999999987311           0  0     01234567889999999999999863



>3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Back     alignment and structure
>1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Back     alignment and structure
>2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Back     alignment and structure
>1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Back     alignment and structure
>3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Back     alignment and structure
>2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Back     alignment and structure
>3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Back     alignment and structure
>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Back     alignment and structure
>3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
>1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Back     alignment and structure
>2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Back     alignment and structure
>3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 875
d1tx4a_196 a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapi 1e-30
d1f7ca_191 a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxI 3e-28
d1xa6a1196 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal d 3e-28
d1pbwa_184 a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Hu 2e-26
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 1e-14
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 2e-14
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 6e-13
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 1e-12
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 2e-12
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 2e-12
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 2e-11
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 2e-11
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 3e-11
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 4e-11
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 4e-11
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 9e-11
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 2e-10
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 2e-10
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 2e-10
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 8e-10
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 9e-10
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 1e-09
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-09
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 2e-09
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 2e-09
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 5e-09
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 9e-09
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 2e-08
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 4e-08
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 6e-08
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 7e-08
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 1e-07
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 1e-06
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 1e-06
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 1e-06
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 2e-06
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-06
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 6e-05
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 3e-04
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 8e-04
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure

class: All alpha proteins
fold: GTPase activation domain, GAP
superfamily: GTPase activation domain, GAP
family: BCR-homology GTPase activation domain (BH-domain)
domain: p50 RhoGAP domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  117 bits (294), Expect = 1e-30
 Identities = 43/216 (19%), Positives = 83/216 (38%), Gaps = 24/216 (11%)

Query: 224 PVKFPVIGRPILLALE---DVDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIR 280
           P+     G  +    E   + +  P  L + + +++ H +  EGI R++A    V    +
Sbjct: 1   PLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQ 60

Query: 281 EFEQGK-TEFSPEEDAHIIADCVKYVIRELPSSPVPASCCNALLEARRTDRGSRVSAMRT 339
           ++  G   +F      H+ A  +K  +RELP   +       ++     D   RV A   
Sbjct: 61  KYNMGLPVDFDQYNALHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATL- 119

Query: 340 AILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACMAPLLLRPLLAGECEIETD 399
            +L+T PE N ++L+ +   +  +++  +QN+M+ + +A    P LL             
Sbjct: 120 QVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWA----------- 168

Query: 400 FNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF 435
                           A N        LL+   ++F
Sbjct: 169 --------KDAAITLKAINPINTFTKFLLDHQGELF 196


>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Length = 191 Back     information, alignment and structure
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query875
d1xa6a1196 Beta-chimaerin, C-terminal domain {Human (Homo sap 100.0
d1tx4a_196 p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 100.0
d1f7ca_191 Graf {Chicken (Gallus gallus) [TaxId: 9031]} 100.0
d1pbwa_184 p85 alpha subunit RhoGAP domain {Human (Homo sapie 100.0
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.6
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.6
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.59
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.59
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.59
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.59
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.57
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.57
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.56
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.56
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.56
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.55
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.54
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.54
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.53
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.52
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.51
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.48
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.48
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.47
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.47
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.47
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.46
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.44
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.44
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.43
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.42
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.39
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.64
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.29
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 97.86
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.73
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.72
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 97.61
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.43
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.16
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.13
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.23
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 95.03
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 94.25
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: GTPase activation domain, GAP
superfamily: GTPase activation domain, GAP
family: BCR-homology GTPase activation domain (BH-domain)
domain: Beta-chimaerin, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.9e-39  Score=324.99  Aligned_cols=190  Identities=19%  Similarity=0.354  Sum_probs=167.7

Q ss_pred             CccccChhHhhhc-CCCCcHHHHHHHHHHHHhCCccCCeeecCCCHHHHHHHHHHHhcCCC--C--CCCCCCchhhHhhH
Q 002835          228 PVIGRPILLALED-VDGTPSFLEKAIRFIEEHGVQVEGILRQAAYVDDVHRRIREFEQGKT--E--FSPEEDAHIIADCV  302 (875)
Q Consensus       228 ~vFGvpLe~ll~~-~~~VP~~L~kcI~~Le~~Gl~~EGIFR~sG~~~~V~~Lk~~ld~g~~--~--~~~~~D~h~VAslL  302 (875)
                      +|||+||+.++++ +..||.+|.+|+.||+++|+++|||||++|+..++++|++.|+.+..  .  ....+|+|+||++|
T Consensus         1 kiFg~~L~~~~~~~~~~iP~iv~~~i~~l~~~gl~~eGiFR~~g~~~~v~~l~~~~~~~~~~~~~~~~~~~d~~~va~~l   80 (196)
T d1xa6a1           1 KVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGAL   80 (196)
T ss_dssp             CCTTSCHHHHHHHHTCSSCHHHHHHHHHHHHSCSSSTTTTTSCCCHHHHHHHHHHHSSTTTTSCCCSSSSCCTHHHHHHH
T ss_pred             CccCCCHHHHHHhcCCCCChHHHHHHHHHHHhCCCCCCeeeeCCCHHHHHHHHHHHhcCCCccccccccccchhHHHHHH
Confidence            4899999999866 66799999999999999999999999999999999999999998632  2  22346999999999


Q ss_pred             HHHHhhCCCCCCChhhHHHHHHHHhcCc-hHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHHhhcccCCCccccceee
Q 002835          303 KYVIRELPSSPVPASCCNALLEARRTDR-GSRVSAMRTAILETFPEPNRKLLQRILMMMQTVASSKNQNRMSTSAVAACM  381 (875)
Q Consensus       303 K~fLReLPePLlp~~ly~~~i~a~~~~~-~eri~~i~~LI~~~LP~~Nr~lL~~Ll~~L~~Va~~S~~NkMta~NLAi~F  381 (875)
                      |.|||+||+||+|.++|+.|+.+.+..+ +.++..++.++. +||+.|+.+|.||+.||++|+.|++.|+||+.|||+||
T Consensus        81 K~fLr~Lp~pli~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-~LP~~n~~~L~~L~~~l~~i~~~s~~NkM~~~nLA~~f  159 (196)
T d1xa6a1          81 KLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLM-LLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVF  159 (196)
T ss_dssp             HHHHHHCSSCTTCSTTHHHHHTTTTCCCHHHHHHHHHHHHT-TSCHHHHHHHHHTTTTTHHHHTTTTTSCCCHHHHHHHH
T ss_pred             HHHHHhCCCccCCHHHHHHHHHHHhccchhHHHHHHHHHHH-HCCHHHHHHHHHHHHHHHHHHHhhhhhccchhhhhHHh
Confidence            9999999999999999999999998888 889999999885 99999999999999999999999999999999999999


Q ss_pred             cccccCCCcCCccccccccccCCCChHHHHHHHHHHHHHHHHHHHHHhhccccc
Q 002835          382 APLLLRPLLAGECEIETDFNVGGDGSAQLLQAAAAANHAQAIVITLLEEYDKIF  435 (875)
Q Consensus       382 gPtLLrp~~s~~~e~e~d~~~~g~~~~qL~~a~~~~~~~~~IVe~LIeny~~IF  435 (875)
                      ||+|||++......                 +.......+.+|++||+||+.||
T Consensus       160 ~P~l~~~~~~~~~~-----------------~~~~~~~~~~iv~~LI~~~~~iF  196 (196)
T d1xa6a1         160 GPTLMRPPEDSTLT-----------------TLHDMRYQKLIVQILIENEDVLF  196 (196)
T ss_dssp             TTTSCCCCCSCTTG-----------------GGGTHHHHHHHHHHHHHTHHHHC
T ss_pred             ccccccCCCccHHH-----------------HHHHHHHHHHHHHHHHHhhHhhC
Confidence            99999987422111                 11223567789999999999998



>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure