Citrus Sinensis ID: 002849
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 874 | 2.2.26 [Sep-21-2011] | |||||||
| Q8GYD9 | 1002 | Probable RNA helicase SDE | yes | no | 0.982 | 0.857 | 0.642 | 0.0 | |
| Q5ZKD7 | 967 | Putative helicase MOV-10 | yes | no | 0.779 | 0.704 | 0.378 | 1e-121 | |
| Q1LXK4 | 1013 | Putative helicase mov-10- | yes | no | 0.794 | 0.685 | 0.366 | 1e-120 | |
| Q0V8H6 | 1003 | Putative helicase MOV-10 | yes | no | 0.792 | 0.690 | 0.361 | 1e-116 | |
| Q1LXK5 | 1015 | Putative helicase mov-10- | no | no | 0.704 | 0.606 | 0.387 | 1e-115 | |
| P23249 | 1004 | Putative helicase MOV-10 | yes | no | 0.847 | 0.738 | 0.347 | 1e-112 | |
| Q9HCE1 | 1003 | Putative helicase MOV-10 | yes | no | 0.752 | 0.656 | 0.374 | 1e-110 | |
| Q9BXT6 | 1211 | Putative helicase Mov10l1 | no | no | 0.475 | 0.343 | 0.467 | 1e-101 | |
| Q6J5K9 | 1274 | Probable RNA helicase arm | yes | no | 0.782 | 0.536 | 0.327 | 1e-100 | |
| Q99MV5 | 1187 | Putative helicase Mov10l1 | no | no | 0.477 | 0.351 | 0.461 | 4e-99 |
| >sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1180 bits (3053), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 571/889 (64%), Positives = 707/889 (79%), Gaps = 30/889 (3%)
Query: 7 DDNWGNEWEKRDIGFIDFEDYKSECSYNPSEEDPVQISFPFPFIDGKPQSVSVGETAVDS 66
DD + +K +IGFID+++ S YNP +E PV +S PFPF KPQSV+VGET+ DS
Sbjct: 9 DDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFPFKKEKPQSVTVGETSFDS 68
Query: 67 ITIKNTTREPVELWSKIYASTPENTFTLSVMKPPSPGSDSGTNRGFVEFFTLEERMIQPG 126
T+KNT EPV+LW+KIYAS PE++FTLS++KPPS SD + F E FTLE+RM++PG
Sbjct: 69 FTVKNTMDEPVDLWTKIYASNPEDSFTLSILKPPSKDSDLKERQCFYETFTLEDRMLEPG 128
Query: 127 QTLTIWLSCKPKGIGLHTTVLQFDV-EDRIERVVFLLAEDKISQSLASKRPYSRGGR--K 183
TLTIW+SCKPK IGLHTTV+ D DR+ERVVFLLAEDKIS SL S RPYSR R K
Sbjct: 129 DTLTIWVSCKPKDIGLHTTVVTVDWGSDRVERVVFLLAEDKISSSLTSNRPYSRSRRAPK 188
Query: 184 KQFSVDKYVVGSRPARYRGQIYQNRLPRYDIPNHIRELIERKQIPDAITDGLTLKNYTSF 243
K F+VD YV GSRP++ + ++NRLP Y+IP IRE+IE K+ PD + +GLT +NY ++
Sbjct: 189 KDFAVDDYVKGSRPSKVVERSFRNRLPLYEIPKEIREMIENKEFPDDLNEGLTARNYANY 248
Query: 244 FKTLLIMEEIQLKEDMRAYDMENVTLMRKGLYLSLVVPGLAERRPSLVNGDFIFAKHAYE 303
+KTLLIMEE+QL+EDMRAYDMENV++ R+G+YLSL VPGLAERRPSLV+GDFIF +HAY+
Sbjct: 249 YKTLLIMEELQLEEDMRAYDMENVSMKRRGIYLSLEVPGLAERRPSLVHGDFIFVRHAYD 308
Query: 304 D-TSSAYQGFIHRVEADEVHLKFASDFQLNHRDENLYNVQFTYNRVNMRRLYQATDAAQE 362
D T AYQGF+HRVEADEVH+KFAS+F H ++YNV+FTYNR+N RRLYQA DAA+
Sbjct: 309 DGTDHAYQGFVHRVEADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAVDAAEM 368
Query: 363 LDTEFLFPSESSGIRLIESNTLVPISCNLNEEQMCSIEKILGLKGAPPYLIYGPPGTGKT 422
LD FLFPS SG R+I++ VPIS LN EQ+CSIE +LG KGAPPY+I+GPPGTGKT
Sbjct: 369 LDPNFLFPSLHSGKRMIKTKPFVPISPALNAEQICSIEMVLGCKGAPPYVIHGPPGTGKT 428
Query: 423 MTLVEAILQLYATREDARLLVCAPSNSAADHLLEKILGEKAVEVRENEIFRLNAPSRPYE 482
MTLVEAI+QLY T+ +AR+LVCAPSNSAADH+LEK+L + V +++NEIFRLNA +R YE
Sbjct: 429 MTLVEAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAATRSYE 488
Query: 483 DVNADHIRFCFFDEQIFKCPPLAALVCYRIIISTYMSASLIYAEGVDRGHFSHIFLDEAG 542
++ + IRFCFFDE IFKCPPL AL Y++++STYMSASL+ AEGV+RGHF+HI LDEAG
Sbjct: 489 EIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILLDEAG 548
Query: 543 QASEPESMVPISSYCKKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERLFECEPYCH 602
QASEPE+M+ +S+ C +TVVVLAGDP QLGPVIYSR+AE+ G+GKSYLERLFEC+ YC
Sbjct: 549 QASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECDYYCE 608
Query: 603 GNENYVTKLVRNYRSHPQILHLPSKLFYEEELIACKDESISCTAYLNFLPNKEFPVLFFG 662
G+ENYVTKLV+NYR HP+IL LPSKLFY+ EL+A K+++ S A LNFLPNKEFP++F+G
Sbjct: 609 GDENYVTKLVKNYRCHPEILDLPSKLFYDGELVASKEDTDSVLASLNFLPNKEFPMVFYG 668
Query: 663 IQGCDEREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGVITPYRQQVLKLNKALES 722
IQGCDEREG+NPSWFNRIE+SKV+E I++LT+ + EEDIGVITPYRQQV+K+ + L+
Sbjct: 669 IQGCDEREGNNPSWFNRIEISKVIETIKRLTANDCVQEEDIGVITPYRQQVMKIKEVLDR 728
Query: 723 LYMPDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHCLGFLSNPRRFNVAVTRAIS 782
L M ++KVGSVEQFQGQE+QVII+STVRSTIKHN+FDR +CLGFLSNPRRFNVA+TRAIS
Sbjct: 729 LDMTEVKVGSVEQFQGQEKQVIIISTVRSTIKHNEFDRAYCLGFLSNPRRFNVAITRAIS 788
Query: 783 LLIIIGNPHIVSKDPYWHQLLWYCSDNNSYQGCALPEREEFADED------------PTA 830
LL+IIGNPHI+ KD W++LLW C DNN+YQGC LPE+EEF +E P
Sbjct: 789 LLVIIGNPHIICKDMNWNKLLWRCVDNNAYQGCGLPEQEEFVEEPFKQEGSSNGPQYPPE 848
Query: 831 AECWNHEEEIPQSFQEDN------WNQEPFQAENLKPVKDEDEWSDGWH 873
AE WN+ E+ +N WN N K+++EWSDGW+
Sbjct: 849 AE-WNNSGELNNGGANENGEWSDGWN-------NNGGTKEKNEWSDGWN 889
|
Probable RNA helicase required for post-transcriptional gene silencing (PTGS), a process that provides protection in plants against virus infection and can suppress expression of transgenes Plays a central role in RNA interference (RNAi) process, a process that mediates mRNA destruction of translational repression. Required for the assembly of the RISC complex, a complex required for target RNA destruction or repression. May be required in the RISC assembly to unwind miRNAs, in the production of single-stranded miRNA from the double-stranded miRNA, a key step in RISC formation. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3 |
| >sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 874 | ||||||
| 224112955 | 894 | hypothetical protein POPTRDRAFT_789212 [ | 0.995 | 0.973 | 0.694 | 0.0 | |
| 255552113 | 882 | ATP-dependent helicase NAM7, putative [R | 0.989 | 0.980 | 0.698 | 0.0 | |
| 225432728 | 877 | PREDICTED: probable RNA helicase SDE3 [V | 0.994 | 0.990 | 0.683 | 0.0 | |
| 147866733 | 877 | hypothetical protein VITISV_014567 [Viti | 0.994 | 0.990 | 0.682 | 0.0 | |
| 13811296 | 1002 | RNA helicase SDE3 [Arabidopsis thaliana] | 0.982 | 0.857 | 0.644 | 0.0 | |
| 15220521 | 1002 | putative RNA helicase SDE3 [Arabidopsis | 0.982 | 0.857 | 0.642 | 0.0 | |
| 449444102 | 886 | PREDICTED: probable RNA helicase SDE3-li | 0.990 | 0.977 | 0.650 | 0.0 | |
| 8778728 | 1048 | T25N20.11 [Arabidopsis thaliana] | 0.982 | 0.819 | 0.623 | 0.0 | |
| 356497432 | 886 | PREDICTED: probable RNA helicase SDE3-li | 0.987 | 0.974 | 0.625 | 0.0 | |
| 357480981 | 940 | hypothetical protein MTR_5g006890 [Medic | 0.993 | 0.923 | 0.634 | 0.0 |
| >gi|224112955|ref|XP_002332671.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] gi|222836465|gb|EEE74872.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1256 bits (3249), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 622/896 (69%), Positives = 730/896 (81%), Gaps = 26/896 (2%)
Query: 2 MDTVGDDNWGNEW----EKRDIGFIDFEDYKSECSYNPSEEDPVQISFPFPFIDGKPQSV 57
M T+ DD WG+E +K +I +ID+++ KS CSY+PSEE P+ IS PFPF +GKP+SV
Sbjct: 1 MGTI-DDKWGDECSVIGDKGEIEYIDYQNDKSVCSYDPSEEGPIVISAPFPFEEGKPRSV 59
Query: 58 SVGETAVDSITIKNTTREPVELWSKIYASTPENTFTLSVMKPPSPGSDSGTNRGFVEFFT 117
VGETA+DSITIKNTT E V+LW+KIYASTPE++F LS+MKPPS +D GF++F
Sbjct: 60 FVGETAIDSITIKNTTAEAVDLWTKIYASTPEDSFKLSLMKPPS-ANDVKCQEGFMDFSV 118
Query: 118 LEERMIQPGQTLTIWLSCKPKGIGLHTTVLQFDV-EDRIERVVFLLAEDKISQSLASKRP 176
+E+RM+QPG++LTIWLSCKPK +GL+TTV+ FDV DRIERV FLLA+D ISQSLASK+P
Sbjct: 119 MEDRMLQPGESLTIWLSCKPKELGLYTTVVHFDVGNDRIERVAFLLADDNISQSLASKKP 178
Query: 177 YSRGGRKKQFSVDKYV-VGSRPARYRGQIYQNRLPRYDIPNHIRELIERKQIPDAITDGL 235
+SRG RKK+FS D +V GSRPAR G+ Y+NRLPRYDIP IR LIERKQIPD I GL
Sbjct: 179 FSRGQRKKKFSTDTFVSAGSRPARAPGRAYKNRLPRYDIPKDIRALIERKQIPDVIMGGL 238
Query: 236 TLKNYTSFFKTLLIMEEIQLKEDMRAYDMENVTLMRKGLYLSLVVPGLAERRPSLVNGDF 295
T+ NY S+FKTLLIMEEIQL+EDMR++DME VT+ RKG YLSLVVPGLAERRPSLV GD
Sbjct: 239 TIDNYASYFKTLLIMEEIQLEEDMRSHDMECVTMRRKGNYLSLVVPGLAERRPSLVQGDD 298
Query: 296 IFAKHA-YEDTSSAYQGFIHRVEADEVHLKFASDFQLNHRDENLYNVQFTYNRVNMRRLY 354
IF K A +DT++ YQG+I+RVEADEV+LKF +F H D +LYNV F YNRV+MRRLY
Sbjct: 299 IFVKLADADDTTTPYQGYIYRVEADEVYLKFYQEFHSCHNDGHLYNVHFKYNRVSMRRLY 358
Query: 355 QATDAAQELDTEFLFPSESSGIRLIESNTLVPISCNLNEEQMCSIEKILGLKGAPPYLIY 414
QA DAA++L+TE LFPSE+SG RLIE++TLVPISC+LNEEQ+CS+E ILG KG PPY+IY
Sbjct: 359 QAIDAAKDLETEMLFPSETSGSRLIETSTLVPISCSLNEEQICSVEMILGCKGGPPYVIY 418
Query: 415 GPPGTGKTMTLVEAILQLYATREDARLLVCAPSNSAADHLLEKILGEKAVEVRENEIFRL 474
GPPGTGKTMT++EAILQLY R+ AR+LVCAPSNSAADHLLEK+L E+AV ++E EIFRL
Sbjct: 419 GPPGTGKTMTIIEAILQLYQNRKHARILVCAPSNSAADHLLEKLLSEEAVHIQEKEIFRL 478
Query: 475 NAPSRPYEDVNADHIRFCFFDEQIFKCPPLAALVCYRIIISTYMSASLIYAEGVDRGHFS 534
NA SRP++D+ D IRFC FDE IF CPPL AL YRIIISTYMSASL+ AEGV RG FS
Sbjct: 479 NATSRPFDDIKPDLIRFCLFDEHIFTCPPLGALTRYRIIISTYMSASLLNAEGVKRGQFS 538
Query: 535 HIFLDEAGQASEPESMVPISSYCKKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERL 594
HIFLDEAGQASEPESM+ +S++C +DTVVVLAGDPMQLGPVI+SR+AE+YG+GKSYLERL
Sbjct: 539 HIFLDEAGQASEPESMISVSNFCNRDTVVVLAGDPMQLGPVIFSRDAESYGLGKSYLERL 598
Query: 595 FECEPYCHGNENYVTKLVRNYRSHPQILHLPSKLFYEEELIACK---DESISCTAYLNFL 651
FECE Y G+ENYVTKL+RNYR HP+ILHLPS LFYE ELIACK D+S S N L
Sbjct: 599 FECESYDSGDENYVTKLIRNYRCHPEILHLPSTLFYEGELIACKESNDDSTSLMTLTNLL 658
Query: 652 PNKEFPVLFFGIQGCDEREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGVITPYRQ 711
P K FPVLFFGIQGCDERE +NPSWFNRIE SKVVEI++KL + GNLS+ DIGVITPYRQ
Sbjct: 659 PGKNFPVLFFGIQGCDEREANNPSWFNRIEASKVVEIVKKLATRGNLSDSDIGVITPYRQ 718
Query: 712 QVLKLNKALESLYMPDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHCLGFLSNPR 771
QVLKL KAL+++ MPDIKVGSVEQFQGQER+VIIVSTVRSTIKHNDFDR HCLGFLSNPR
Sbjct: 719 QVLKLKKALDNIDMPDIKVGSVEQFQGQERKVIIVSTVRSTIKHNDFDRVHCLGFLSNPR 778
Query: 772 RFNVAVTRAISLLIIIGNPHIVSKDPYWHQLLWYCSDNNSYQGCALPE-REEFADEDPTA 830
RFNVA+TRAISLLII GNPHI+SKD YW++LLW+C DN+SYQGCALPE R E D PT
Sbjct: 779 RFNVAITRAISLLIITGNPHIISKDQYWNKLLWHCVDNDSYQGCALPEKRLECVDNYPTY 838
Query: 831 AECWNHEEE------------IPQSFQEDNWNQE-PFQAENLKPVKDEDEWSDGWH 873
+ +++ P S E W+ QA+ +PV DE EWSDGW
Sbjct: 839 EDRVDYDGGPVTNEADWCDGWQPSSSGEVGWDHPGSSQAQIPEPVTDEAEWSDGWQ 894
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255552113|ref|XP_002517101.1| ATP-dependent helicase NAM7, putative [Ricinus communis] gi|223543736|gb|EEF45264.1| ATP-dependent helicase NAM7, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225432728|ref|XP_002282919.1| PREDICTED: probable RNA helicase SDE3 [Vitis vinifera] gi|297737082|emb|CBI26283.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147866733|emb|CAN83068.1| hypothetical protein VITISV_014567 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|13811296|gb|AAK40099.1|AF339908_1 RNA helicase SDE3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15220521|ref|NP_172037.1| putative RNA helicase SDE3 [Arabidopsis thaliana] gi|50401594|sp|Q8GYD9.1|SDE3_ARATH RecName: Full=Probable RNA helicase SDE3; AltName: Full=Silencing defective protein 3 gi|26450472|dbj|BAC42350.1| unknown protein [Arabidopsis thaliana] gi|332189722|gb|AEE27843.1| putative RNA helicase SDE3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449444102|ref|XP_004139814.1| PREDICTED: probable RNA helicase SDE3-like [Cucumis sativus] gi|449492596|ref|XP_004159043.1| PREDICTED: probable RNA helicase SDE3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|8778728|gb|AAF79736.1|AC005106_17 T25N20.11 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356497432|ref|XP_003517564.1| PREDICTED: probable RNA helicase SDE3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357480981|ref|XP_003610776.1| hypothetical protein MTR_5g006890 [Medicago truncatula] gi|355512111|gb|AES93734.1| hypothetical protein MTR_5g006890 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 874 | ||||||
| TAIR|locus:2200996 | 1002 | SDE3 "SILENCING DEFECTIVE" [Ar | 0.985 | 0.859 | 0.650 | 0.0 | |
| UNIPROTKB|F1NNW1 | 735 | MOV10 "Putative helicase MOV-1 | 0.513 | 0.610 | 0.407 | 8.2e-123 | |
| UNIPROTKB|Q5ZKD7 | 967 | MOV10 "Putative helicase MOV-1 | 0.513 | 0.464 | 0.407 | 2.8e-122 | |
| UNIPROTKB|Q9BXT6 | 1211 | MOV10L1 "Putative helicase Mov | 0.477 | 0.344 | 0.468 | 3.2e-119 | |
| MGI|MGI:1891384 | 1187 | Mov10l1 "Moloney leukemia viru | 0.477 | 0.351 | 0.470 | 4.1e-119 | |
| UNIPROTKB|E1BZJ8 | 1192 | MOV10L1 "Uncharacterized prote | 0.478 | 0.350 | 0.467 | 6.7e-119 | |
| UNIPROTKB|F1RXR7 | 1211 | MOV10L1 "Uncharacterized prote | 0.477 | 0.344 | 0.451 | 4.7e-118 | |
| UNIPROTKB|G3X7G5 | 1214 | MOV10L1 "Uncharacterized prote | 0.477 | 0.343 | 0.459 | 7.6e-118 | |
| ZFIN|ZDB-GENE-061013-333 | 1106 | zgc:154086 "zgc:154086" [Danio | 0.481 | 0.380 | 0.437 | 3.7e-116 | |
| RGD|1304735 | 550 | Mov10l1 "Mov10l1, Moloney leuk | 0.477 | 0.758 | 0.466 | 2.1e-91 |
| TAIR|locus:2200996 SDE3 "SILENCING DEFECTIVE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3013 (1065.7 bits), Expect = 0., Sum P(2) = 0.
Identities = 567/871 (65%), Positives = 702/871 (80%)
Query: 7 DDNWGNEWEKRDIGFIDFEDYKSECSYNPSEEDPVQISFPFPFIDGKPQSVSVGETAVDS 66
DD + +K +IGFID+++ S YNP +E PV +S PFPF KPQSV+VGET+ DS
Sbjct: 9 DDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFPFKKEKPQSVTVGETSFDS 68
Query: 67 ITIKNTTREPVELWSKIYASTPENTFTLSVMKPPSPGSDSGTNRGFVEFFTLEERMIQPG 126
T+KNT EPV+LW+KIYAS PE++FTLS++KPPS SD + F E FTLE+RM++PG
Sbjct: 69 FTVKNTMDEPVDLWTKIYASNPEDSFTLSILKPPSKDSDLKERQCFYETFTLEDRMLEPG 128
Query: 127 QTLTIWLSCKPKGIGLHTTVLQFDV-EDRIERVVFLLAEDKISQSLASKRPYSRGGR--K 183
TLTIW+SCKPK IGLHTTV+ D DR+ERVVFLLAEDKIS SL S RPYSR R K
Sbjct: 129 DTLTIWVSCKPKDIGLHTTVVTVDWGSDRVERVVFLLAEDKISSSLTSNRPYSRSRRAPK 188
Query: 184 KQFSVDKYVVGSRPARYRGQIYQNRLPRYDIPNHIRELIERKQIPDAITDGLTLKNYTSF 243
K F+VD YV GSRP++ + ++NRLP Y+IP IRE+IE K+ PD + +GLT +NY ++
Sbjct: 189 KDFAVDDYVKGSRPSKVVERSFRNRLPLYEIPKEIREMIENKEFPDDLNEGLTARNYANY 248
Query: 244 FKTLLIMEEIQLKEDMRAYDMENVTLMRKGLYLSLVVPGLAERRPSLVNGDFIFAKHAYE 303
+KTLLIMEE+QL+EDMRAYDMENV++ R+G+YLSL VPGLAERRPSLV+GDFIF +HAY+
Sbjct: 249 YKTLLIMEELQLEEDMRAYDMENVSMKRRGIYLSLEVPGLAERRPSLVHGDFIFVRHAYD 308
Query: 304 D-TSSAYQGFIHRVEADEVHLKFASDFQLNHRDENLYNVQFTYNRVNMRRLYQATDAAQE 362
D T AYQGF+HRVEADEVH+KFAS+F H ++YNV+FTYNR+N RRLYQA DAA+
Sbjct: 309 DGTDHAYQGFVHRVEADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAVDAAEM 368
Query: 363 LDTEFLFPSESSGIRLIESNTLVPISCNLNEEQMCSIEKILGLKGAPPYLIYGPPGTGKT 422
LD FLFPS SG R+I++ VPIS LN EQ+CSIE +LG KGAPPY+I+GPPGTGKT
Sbjct: 369 LDPNFLFPSLHSGKRMIKTKPFVPISPALNAEQICSIEMVLGCKGAPPYVIHGPPGTGKT 428
Query: 423 MTLVEAILQLYATREDARLLVCAPSNSAADHLLEKILGEKAVEVRENEIFRLNAPSRPYE 482
MTLVEAI+QLY T+ +AR+LVCAPSNSAADH+LEK+L + V +++NEIFRLNA +R YE
Sbjct: 429 MTLVEAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAATRSYE 488
Query: 483 DVNADHIRFCFFDEQIFKCPPLAALVCYRIIISTYMSASLIYAEGVDRGHFSHIFLDEAG 542
++ + IRFCFFDE IFKCPPL AL Y++++STYMSASL+ AEGV+RGHF+HI LDEAG
Sbjct: 489 EIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILLDEAG 548
Query: 543 QASEPESMVPISSYCKKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERLFECEPYCH 602
QASEPE+M+ +S+ C +TVVVLAGDP QLGPVIYSR+AE+ G+GKSYLERLFEC+ YC
Sbjct: 549 QASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECDYYCE 608
Query: 603 GNENYVTKLVRNYRSHPQILHLPSKLFYEEELIACKDESISCTAYLNFLPNKEFPVLFFG 662
G+ENYVTKLV+NYR HP+IL LPSKLFY+ EL+A K+++ S A LNFLPNKEFP++F+G
Sbjct: 609 GDENYVTKLVKNYRCHPEILDLPSKLFYDGELVASKEDTDSVLASLNFLPNKEFPMVFYG 668
Query: 663 IQGCDEREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGVITPYRQQVLKLNKALES 722
IQGCDEREG+NPSWFNRIE+SKV+E I++LT+ + EEDIGVITPYRQQV+K+ + L+
Sbjct: 669 IQGCDEREGNNPSWFNRIEISKVIETIKRLTANDCVQEEDIGVITPYRQQVMKIKEVLDR 728
Query: 723 LYMPDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHCLGFLSNPRRFNVAVTRAIS 782
L M ++KVGSVEQFQGQE+QVII+STVRSTIKHN+FDR +CLGFLSNPRRFNVA+TRAIS
Sbjct: 729 LDMTEVKVGSVEQFQGQEKQVIIISTVRSTIKHNEFDRAYCLGFLSNPRRFNVAITRAIS 788
Query: 783 LLIIIGNPHIVSKDPYWHQLLWYCSDNNSYQGCALPEREEFADEDPTAAECWNHEEEIPQ 842
LL+IIGNPHI+ KD W++LLW C DNN+YQGC LPE+EEF +E P E ++ + P
Sbjct: 789 LLVIIGNPHIICKDMNWNKLLWRCVDNNAYQGCGLPEQEEFVEE-PFKQEGSSNGPQYPP 847
Query: 843 SFQEDNWNQEPFQAENLKPVKDEDEWSDGWH 873
E WN + N + EWSDGW+
Sbjct: 848 ---EAEWNNSG-ELNN-GGANENGEWSDGWN 873
|
|
| UNIPROTKB|F1NNW1 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKD7 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BXT6 MOV10L1 "Putative helicase Mov10l1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891384 Mov10l1 "Moloney leukemia virus 10-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZJ8 MOV10L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RXR7 MOV10L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X7G5 MOV10L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061013-333 zgc:154086 "zgc:154086" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1304735 Mov10l1 "Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8GYD9 | SDE3_ARATH | 3, ., 6, ., 4, ., 1, 3 | 0.6422 | 0.9828 | 0.8572 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | RHEL901 | hypothetical protein (894 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 874 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 7e-66 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 4e-47 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 7e-45 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 2e-38 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 5e-17 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 4e-09 | |
| pfam13604 | 195 | pfam13604, AAA_30, AAA domain | 4e-08 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 4e-06 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 2e-05 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 9e-05 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 6e-04 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 0.001 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 0.001 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 0.001 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 0.002 | |
| TIGR01447 | 586 | TIGR01447, recD, exodeoxyribonuclease V, alpha sub | 0.002 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 0.002 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 0.003 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 218 bits (557), Expect = 7e-66
Identities = 82/207 (39%), Positives = 115/207 (55%), Gaps = 15/207 (7%)
Query: 586 MGKSYLERLFECEPYCHGNENYVTKLVRNYRSHPQILHLPSKLFYEEELIACKDESISCT 645
+ +S ERL E P V L YR HP I PS+LFY +L + +
Sbjct: 1 LDRSLFERLQEAGPEA------VVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPL 54
Query: 646 AYLNFLPNKEFPVLFFGIQGCDEREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGV 705
+ LP+ P++F + G +E E + S+ N E VV++++KL +G +DIG+
Sbjct: 55 PWDFHLPDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLKSGPEKNKDIGI 114
Query: 706 ITPYRQQVLKLNKALESLYM--PDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHC 763
ITPYR QV + K L+ + PDI+V +V+ FQG+E+ VII STVRS K
Sbjct: 115 ITPYRAQVRLIKKLLKRKFGGEPDIEVNTVDGFQGREKDVIIFSTVRSN-------EKGG 167
Query: 764 LGFLSNPRRFNVAVTRAISLLIIIGNP 790
+GFLS+PRR NVA+TRA LII+GN
Sbjct: 168 IGFLSDPRRLNVALTRAKRGLIIVGNA 194
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222258 pfam13604, AAA_30, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 874 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 100.0 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.95 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.95 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.95 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.93 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.91 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.91 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.9 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.9 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.9 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.9 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.87 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.87 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.86 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.84 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.83 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.83 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.83 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.82 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.79 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.79 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.75 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.72 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.7 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.68 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.64 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.64 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.63 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 99.61 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.59 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.58 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.42 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.27 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.26 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 99.26 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 99.21 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 99.16 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 98.9 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.89 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.89 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.77 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.63 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 98.62 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.61 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 98.45 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 98.41 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.41 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.35 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 98.3 | |
| PTZ00424 | 401 | helicase 45; Provisional | 98.24 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.2 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.17 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.16 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.14 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.13 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.12 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.12 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.12 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.09 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 98.08 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.08 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.08 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.07 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 98.07 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 98.05 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 98.04 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 98.03 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.03 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 98.02 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.96 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 97.96 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 97.95 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 97.95 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.9 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.89 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.87 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.85 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.84 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 97.84 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 97.83 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 97.81 | |
| PTZ00110 | 545 | helicase; Provisional | 97.8 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.77 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 97.76 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.75 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.75 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.74 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.73 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.7 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 97.7 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 97.69 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.68 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.64 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.63 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 97.6 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.6 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.58 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 97.49 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.44 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.42 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 97.41 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 97.37 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.37 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.36 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 97.35 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.33 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 97.3 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 97.27 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 97.27 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.26 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.25 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.24 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 97.24 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 97.23 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 97.22 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 97.22 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 97.22 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.22 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 97.21 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 97.21 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.21 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.19 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.19 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 97.18 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 97.14 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.13 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 97.13 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.12 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 97.12 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.12 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.07 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.06 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 97.06 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.03 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.03 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 97.02 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.02 | |
| PRK06526 | 254 | transposase; Provisional | 97.0 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 97.0 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.0 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 96.99 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 96.96 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.94 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 96.94 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.92 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.9 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.9 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 96.9 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.89 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 96.88 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 96.86 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.85 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 96.82 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.81 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 96.81 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 96.79 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.78 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.76 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 96.76 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.73 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.72 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 96.71 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.71 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.71 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.7 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.69 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.68 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 96.68 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.67 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 96.67 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.66 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.66 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.65 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.63 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.61 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 96.59 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.59 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.55 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 96.54 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.54 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 96.54 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 96.53 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 96.51 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 96.51 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 96.51 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.5 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.48 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.46 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.45 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.45 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.44 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.41 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.4 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.39 | |
| PF14874 | 102 | PapD-like: Flagellar-associated PapD-like | 96.33 | |
| PHA03311 | 828 | helicase-primase subunit BBLF4; Provisional | 96.32 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 96.32 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.3 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.29 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 96.25 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.22 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 96.21 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.2 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.2 | |
| KOG0987 | 540 | consensus DNA helicase PIF1/RRM3 [Cell cycle contr | 96.19 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 96.18 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.18 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.16 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 96.15 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 96.1 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 96.06 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.04 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.03 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.03 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.01 | |
| PRK08181 | 269 | transposase; Validated | 95.99 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.98 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.96 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.95 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.94 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.94 | |
| PRK06620 | 214 | hypothetical protein; Validated | 95.91 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 95.9 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.84 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 95.81 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 95.81 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 95.8 | |
| PTZ00293 | 211 | thymidine kinase; Provisional | 95.78 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.77 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 95.76 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.76 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.75 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.74 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 95.73 | |
| PF00265 | 176 | TK: Thymidine kinase; InterPro: IPR001267 Thymidin | 95.71 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.71 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 95.7 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 95.66 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 95.62 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 95.59 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.58 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.57 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 95.54 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.51 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 95.47 | |
| PHA03372 | 668 | DNA packaging terminase subunit 1; Provisional | 95.45 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 95.45 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 95.42 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.39 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.38 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 95.37 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 95.29 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.28 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 95.23 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.22 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.2 | |
| TIGR02774 | 1076 | rexB_recomb ATP-dependent nuclease subunit B. DNA | 95.19 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.19 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 95.18 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 95.16 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.16 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 95.14 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 95.14 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.06 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 95.06 | |
| PF03237 | 384 | Terminase_6: Terminase-like family; InterPro: IPR0 | 95.03 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 95.01 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.01 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 94.98 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.97 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 94.97 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.96 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.95 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.93 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.92 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 94.88 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.85 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 94.83 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.83 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 94.83 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 94.79 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.76 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 94.74 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 94.71 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 94.71 | |
| PHA00350 | 399 | putative assembly protein | 94.7 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 94.69 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 94.69 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 94.68 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 94.65 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.64 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 94.62 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 94.59 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.58 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 94.54 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.47 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 94.47 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 94.42 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 94.4 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.39 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.38 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 94.34 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 94.33 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 94.32 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 94.32 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 94.32 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 94.24 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.22 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.16 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 94.14 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.13 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 94.1 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.08 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 94.07 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 94.06 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.05 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 94.02 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 94.0 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 93.98 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.94 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 93.94 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 93.92 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.9 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 93.89 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 93.87 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.81 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.8 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 93.77 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.7 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.69 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 93.68 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.62 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 93.61 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 93.59 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.57 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 93.56 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 93.53 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 93.49 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.47 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 93.47 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 93.41 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 93.41 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.39 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 93.39 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 93.31 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 93.24 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.2 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 93.19 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.15 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 93.12 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 93.1 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.08 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 93.08 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.07 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 93.07 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 93.01 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 93.0 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 92.98 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 92.96 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 92.93 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 92.9 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.84 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.79 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 92.76 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 92.75 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 92.74 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 92.74 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.72 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 92.69 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 92.69 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 92.68 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.67 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 92.67 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.65 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 92.51 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.38 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 92.35 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.34 | |
| PHA02244 | 383 | ATPase-like protein | 92.34 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 92.29 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 92.27 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 92.23 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 92.19 | |
| PF02689 | 818 | Herpes_Helicase: Helicase; InterPro: IPR003840 Thi | 92.19 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 92.12 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 92.11 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 92.07 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 91.89 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 91.83 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 91.8 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 91.78 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 91.78 | |
| PRK03839 | 180 | putative kinase; Provisional | 91.73 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 91.71 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 91.69 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 91.65 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 91.62 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 91.62 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 91.62 | |
| KOG3125 | 234 | consensus Thymidine kinase [Nucleotide transport a | 91.59 | |
| PRK13768 | 253 | GTPase; Provisional | 91.59 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 91.57 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 91.57 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.56 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.54 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 91.53 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 91.48 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 91.46 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 91.45 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 91.43 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 91.38 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 91.29 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 91.29 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 91.27 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 91.24 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 91.23 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 91.22 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 91.22 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 91.2 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 91.17 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 91.16 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 91.13 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 90.98 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 90.95 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 90.92 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 90.89 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 90.87 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 90.87 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 90.85 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 90.82 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 90.81 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 90.81 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 90.79 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 90.76 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 90.61 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 90.6 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 90.59 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 90.54 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 90.54 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 90.51 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 90.47 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 90.47 | |
| PLN02200 | 234 | adenylate kinase family protein | 90.4 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 90.39 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 90.36 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 90.33 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 90.32 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 90.31 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 90.31 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 90.28 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 90.24 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 90.22 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.21 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 90.18 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 90.17 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 90.16 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 90.16 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 90.13 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 90.12 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 90.06 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 90.03 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 90.0 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 89.98 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 89.97 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 89.94 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 89.92 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 89.89 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 89.86 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 89.85 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 89.84 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 89.79 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.77 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 89.57 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 89.56 | |
| PRK06696 | 223 | uridine kinase; Validated | 89.53 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 89.47 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.37 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 89.37 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 89.36 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 89.36 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 89.36 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 89.34 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 89.33 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 89.3 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 89.22 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 89.16 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 89.16 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 89.13 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.08 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-86 Score=733.84 Aligned_cols=640 Identities=29% Similarity=0.407 Sum_probs=493.3
Q ss_pred CCeEEEEEEEecCccceEeEEEEEEcc---CeEEEEEEEEeechhhhh---------cccCCCCccCCCCCccccceEee
Q 002849 126 GQTLTIWLSCKPKGIGLHTTVLQFDVE---DRIERVVFLLAEDKISQS---------LASKRPYSRGGRKKQFSVDKYVV 193 (874)
Q Consensus 126 g~~~~~~~~~~~~~~g~~~~~~~f~~~---~~~~r~~~~~~~~~~~~~---------l~~~~p~~~~~~~~~~~~~~~~~ 193 (874)
|++....-.|-.+ .+|-+| .+-+.|+++.|+.+|+.. +..|.|.+..+ +...|+.
T Consensus 117 get~lecyncg~~--------nvf~lGFi~~ksd~VVvllcr~pcas~s~~kd~Nwd~~qw~~li~dr-----~~l~wiv 183 (935)
T KOG1802|consen 117 GETVLECYNCGSR--------NVFLLGFIPAKSDSVVVLLCRQPCASRSNLKDMNWDLSQWQPLIEDR-----CLLSWIV 183 (935)
T ss_pred CcceEEeeccCcc--------hhhhhcccccccCceEEEEecCcccccccCCCcCCChhhccchhhhh-----cccchhc
Confidence 5555555555444 346667 478889999999998654 34566666666 5666766
Q ss_pred CCC------CCCcccccccccCCCCC--CChHHHHHHHhc----CCCchhcCCCCHHHHHHHHHHHHHHHHHHHHHhhhh
Q 002849 194 GSR------PARYRGQIYQNRLPRYD--IPNHIRELIERK----QIPDAITDGLTLKNYTSFFKTLLIMEEIQLKEDMRA 261 (874)
Q Consensus 194 g~~------~~~~~~~~~~~~l~~y~--~p~~~~~~i~~~----~~~~~l~~~l~~~~Y~~~f~~Ll~lEe~~~~~~~~~ 261 (874)
.+| ..+..+....++|...| .|+...+.+.+. ..|++...+-+...|.+.|..|+.+|.-....-...
T Consensus 184 k~pseqe~~~aR~iT~qqi~~~eelwr~np~at~~dl~kP~~d~~~~hv~~ry~da~~y~~vf~pliklea~ydk~~Kes 263 (935)
T KOG1802|consen 184 KVPSEQEQLRARKITAQQIVKLEELWRKNPSATLEDLDKPGEDEEPPHVQLRYEDAYEYQNVFSPLIKLEADYDKRLKES 263 (935)
T ss_pred cCCcchhhhhhccccHHHHHHHHhhhccCCccchhhcCCcccccCCCcccccccchHHHhhhcchhhhhhhhhhhhhhhh
Confidence 655 24556666778888877 687777777643 256677788889999999999999996532211122
Q ss_pred ccccccEEEEe-C----cEEEEEecCCCCCCCCCCCCCEEEEEecCCCCCccEE--EEEEEEeC---cEEEEEE--CCCc
Q 002849 262 YDMENVTLMRK-G----LYLSLVVPGLAERRPSLVNGDFIFAKHAYEDTSSAYQ--GFIHRVEA---DEVHLKF--ASDF 329 (874)
Q Consensus 262 ~~~~~~~~~~~-~----~~~~l~vpgl~e~rps~~~GD~v~~~~~~~~~~~~~~--g~v~~v~~---~~v~l~~--~~~~ 329 (874)
-..++++.++. | .+..+..|.+ ++.-.+..||.+.+++.. .....|. |+|.++-. +++.|.+ ..+.
T Consensus 264 ~~q~~~tvRW~~gLnkk~~a~f~~~k~-~~e~kl~~GdE~~L~y~~-~~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~ 341 (935)
T KOG1802|consen 264 QTQENGTVRWDIGLNKKRLAYFTLPKL-DSELKLAIGDEIRLTYSG-GLVLPWNGIGSVLKIPDNNGDEVKLELEFSQDP 341 (935)
T ss_pred cccccceEEeeeccccceEEEEecCCC-cchhccccCCeeEEEecC-CcCCcccccceEEecCCCCcceeEEEeecCCCC
Confidence 34466777765 2 4445667777 666678999999999985 3333354 67877764 5776654 3432
Q ss_pred cccCCCCCcEEEEEEechhhHHHHHHHhHHHhh--------cccccccCC-CCC-CccccccCCCCcCCCCCCHHHHHHH
Q 002849 330 QLNHRDENLYNVQFTYNRVNMRRLYQATDAAQE--------LDTEFLFPS-ESS-GIRLIESNTLVPISCNLNEEQMCSI 399 (874)
Q Consensus 330 ~~~~~~~~~~~v~f~~~r~~~~r~~~Al~~~~~--------~~~~~lfP~-~~~-~~~~~~~~~~~~~~~~LN~~Q~~AV 399 (874)
... ....|.|+|.++-+++.||..|+..... +...+|+-. ... .....+..-..+-.+.||.+|..||
T Consensus 342 p~e--~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkLN~SQ~~AV 419 (935)
T KOG1802|consen 342 PIE--VTHGFTVDFVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAV 419 (935)
T ss_pred Ccc--cccceEEEEEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhhchHHHHHH
Confidence 211 2346999999999999999999975321 111122211 110 0011111112233378999999999
Q ss_pred HHHhccCCCCCEEEEcCCCCChhHHHHHHHHHHHHhcCCCeEEEecCCHHHHHHHHHHHhcccccccccccEEEecCCCC
Q 002849 400 EKILGLKGAPPYLIYGPPGTGKTMTLVEAILQLYATREDARLLVCAPSNSAADHLLEKILGEKAVEVRENEIFRLNAPSR 479 (874)
Q Consensus 400 ~~il~~~~~~~~lI~GPPGTGKT~Tlve~I~~ll~~~~~~rILv~ApSNsAaD~l~~rL~~~~~~~~~~~~i~Rl~~~~r 479 (874)
+++|++ +..||+||||||||.|.+++|.++.+. ...+||||||||.|+|+|++++.+. + .+++|+.+.+|
T Consensus 420 ~~VL~r---plsLIQGPPGTGKTvtsa~IVyhl~~~-~~~~VLvcApSNiAVDqLaeKIh~t-g-----LKVvRl~aksR 489 (935)
T KOG1802|consen 420 KHVLQR---PLSLIQGPPGTGKTVTSATIVYHLARQ-HAGPVLVCAPSNIAVDQLAEKIHKT-G-----LKVVRLCAKSR 489 (935)
T ss_pred HHHHcC---CceeeecCCCCCceehhHHHHHHHHHh-cCCceEEEcccchhHHHHHHHHHhc-C-----ceEeeeehhhh
Confidence 999997 789999999999999999999999986 5679999999999999999999873 2 46899998877
Q ss_pred CCcCCc---------------hhhhhhccc----------cchh----ccCCchhhcccceEEEEechhhhhhhhcccCC
Q 002849 480 PYEDVN---------------ADHIRFCFF----------DEQI----FKCPPLAALVCYRIIISTYMSASLIYAEGVDR 530 (874)
Q Consensus 480 ~~~~v~---------------~~~~~~~~~----------~~~~----~~~~~~~~L~~~~VI~~T~~sa~~l~~~~~~~ 530 (874)
....-+ +++.+.... ++.. .+....+.|.+++||+|||.+++... +..
T Consensus 490 E~~~S~vs~L~lh~~~~~~~~pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~r---l~~ 566 (935)
T KOG1802|consen 490 EDIESDVSFLSLHEQLRNMDKPELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRR---LSK 566 (935)
T ss_pred hhccCCccHHHHHHHHhccCcHHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchh---hcc
Confidence 532221 122111111 1110 11123467889999999999998743 344
Q ss_pred CCccEEEEEcCCCCChhhhHHHhhccccCCcEEEEecCCCcccceeecchhhhcCCCccHHHHHHhcCCCCCCCccceee
Q 002849 531 GHFSHIFLDEAGQASEPESMVPISSYCKKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERLFECEPYCHGNENYVTK 610 (874)
Q Consensus 531 ~~fd~ViIDEAsQ~~epe~li~L~~l~~~~~~vVLvGDp~QL~PvI~s~~a~~~gl~~SlfeRL~~~~~~~~~~~~~~~~ 610 (874)
.+|..|+||||.|++||++|+||...++ ++||||||+||+|+|....++..|+..||||||...+. ..++
T Consensus 567 ~kfr~VLiDEaTQatEpe~LiPlvlG~k---q~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~-------~P~~ 636 (935)
T KOG1802|consen 567 FKFRTVLIDEATQATEPECLIPLVLGAK---QLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGI-------KPIR 636 (935)
T ss_pred ccccEEEEecccccCCcchhhhhhhcce---eEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccC-------CceE
Confidence 5899999999999999999999996443 69999999999999999999999999999999987654 2578
Q ss_pred cccccCCchhhhccccccccccccccccccccc-ccccccCCCCCCCCEEEEecCCCccccCCCCCccCHHHHHHHHHHH
Q 002849 611 LVRNYRSHPQILHLPSKLFYEEELIACKDESIS-CTAYLNFLPNKEFPVLFFGIQGCDEREGSNPSWFNRIEVSKVVEII 689 (874)
Q Consensus 611 L~~nYRshp~I~~~~n~~fY~~~L~~~~~~~~~-~~~~~~~~~~~~~pi~f~~v~g~~~~~~~s~S~~N~~Ea~~V~~~v 689 (874)
|..||||||.|.+|||+.||+|.|+.+.....+ ...-+..+|..+.|+.|+...|.++...+++||.|..||..+.++|
T Consensus 637 L~vQYRmhP~lSefpsn~fY~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~~g~eeisasGtSf~Nr~Ea~~~ekii 716 (935)
T KOG1802|consen 637 LQVQYRMHPALSEFPSNMFYEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVCYGQEEISASGTSFLNRTEAANCEKII 716 (935)
T ss_pred EEEeeeeChhhhhcchhhhccchhhcCcchhhhccCCCCCCCCCCCCccceEEeccceeeeccccceecHHHHHHHHHHH
Confidence 999999999999999999999999999877544 3444556788889999999999999999999999999999999999
Q ss_pred HHHHHcCCCCCCeEEEEcccHHHHHHHHHHHHhcCC------CCeEECccccCCCceeeEEEEEeccCCCcCCccccccc
Q 002849 690 QKLTSTGNLSEEDIGVITPYRQQVLKLNKALESLYM------PDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHC 763 (874)
Q Consensus 690 ~~L~~~~~~~~~dIgIItPY~~Qv~~Ir~~L~~~~~------~~v~V~TVd~fQG~E~dvVIiS~VRs~~~~~~~d~~~~ 763 (874)
+.|++.| +.++.|||||||.+|...|-+.|...|. ..|+|.|||+|||+|+|+||+||||++.. .+
T Consensus 717 ~~l~~~g-v~~~qIGVITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~-------qg 788 (935)
T KOG1802|consen 717 TKLLKSG-VKPSQIGVITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEH-------QG 788 (935)
T ss_pred HHHHHcC-CCHHHeeeecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccc-------cc
Confidence 9999997 9999999999999999999998876542 45799999999999999999999999853 68
Q ss_pred cccCCCCCceEeccccccccEEEEEccccccCChHHHHHHHHHHhCCCcc
Q 002849 764 LGFLSNPRRFNVAVTRAISLLIIIGNPHIVSKDPYWHQLLWYCSDNNSYQ 813 (874)
Q Consensus 764 lGFl~d~rrlNVAiTRAK~~LiIvGn~~~L~~~~~w~~ll~~~~~~~~~~ 813 (874)
+||+.|+||||||+||||.+|+||||+..|++++.|..+|.||++.+...
T Consensus 789 IGFl~d~RRlNVaLTRaK~glvivGN~~~L~k~~LW~~li~h~~eke~l~ 838 (935)
T KOG1802|consen 789 IGFLNDPRRLNVALTRAKYGLVIVGNPKVLRKHPLWGHLITHYKEKEVLV 838 (935)
T ss_pred cccccCchhhhhhhhhcccceEEecCHHHhhhchHHHHHHHHhhccccee
Confidence 99999999999999999999999999999999999999999999998654
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF14874 PapD-like: Flagellar-associated PapD-like | Back alignment and domain information |
|---|
| >PHA03311 helicase-primase subunit BBLF4; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PHA03372 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02774 rexB_recomb ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG3125 consensus Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 874 | ||||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 2e-49 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 2e-49 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 6e-49 | ||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 2e-47 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 7e-41 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 4e-40 |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
|
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
Score = 483 bits (1244), Expect = e-161
Identities = 166/637 (26%), Positives = 260/637 (40%), Gaps = 86/637 (13%)
Query: 236 TLKNYTSFFKTLLIMEEIQLKEDMRAYDMENVT----LMRKGLYLSLVVPGLAERRPSLV 291
Y + F L+ +E K+ + +N+T L ++ + L+
Sbjct: 8 DAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLM 67
Query: 292 NGDFIFAKHAYEDTS-SAYQGFIHRV---EADEVHLKFASDFQLNHRDENLYNVQFTYNR 347
GD I ++ + G + +V DE+ ++ S + + V F +
Sbjct: 68 QGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKS 127
Query: 348 VNMRRLYQATDAAQELDTEF-------LFPSESSGIRL---IESNTLVPISCNLNEEQMC 397
+ R+ A +T L E + + + +LN Q+
Sbjct: 128 TSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVY 187
Query: 398 SIEKILGLKGAPPYLIYGPPGTGKTMTLVEAILQLYATREDARLLVCAPSNSAADHLLEK 457
+++ +L P LI GPPGTGKT+T + L A + + +LVCAPSN A D L EK
Sbjct: 188 AVKTVLQ---RPLSLIQGPPGTGKTVTSATIVYHL-ARQGNGPVLVCAPSNIAVDQLTEK 243
Query: 458 ILGEKAVEVRENEIFRLNAPSRPYEDVNADHIRFCFFDEQIFKCPPLAALVC-------- 509
I ++ RL A SR D + + P L L
Sbjct: 244 IHQTGL------KVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGEL 297
Query: 510 ----------------------YRIIISTYMSASLIYAEGVDRGHFSHIFLDEAGQASEP 547
+I T + A + + F I +DE+ QA+EP
Sbjct: 298 SSADEKRYRALKRTAERELLMNADVICCTCVGAG---DPRLAKMQFRSILIDESTQATEP 354
Query: 548 ESMVPISSYCKKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERLFECEPYCHGNENY 607
E MVP+ K+ ++L GD QLGPV+ ++A G+ +S ERL
Sbjct: 355 ECMVPVVLGAKQ---LILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIR------- 404
Query: 608 VTKLVRNYRSHPQILHLPSKLFYEEELIACKDESISCTAYLNF-LPNKEFPVLFFGIQGC 666
+L YR HP + PS +FYE L + +F P + P+ F+ QG
Sbjct: 405 PIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQ 464
Query: 667 DEREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGVITPYRQQVLKLNKALESL--- 723
+E S S+ NR E + V +I KL G + IG+ITPY Q L + ++
Sbjct: 465 EEIASSGTSYLNRTEAANVEKITTKLLKAG-AKPDQIGIITPYEGQRSYLVQYMQFSGSL 523
Query: 724 ---YMPDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHCLGFLSNPRRFNVAVTRA 780
++++ SV+ FQG+E+ II+S VR+ +GFL++PRR NVA+TRA
Sbjct: 524 HTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQG-------IGFLNDPRRLNVALTRA 576
Query: 781 ISLLIIIGNPHIVSKDPYWHQLLWYCSDNNSYQGCAL 817
+II+GNP +SK P W+ LL Y + L
Sbjct: 577 RYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPL 613
|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 874 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.97 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.96 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.95 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.95 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 99.94 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.92 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 99.86 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.86 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 99.55 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.51 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 99.31 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.77 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 98.75 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.72 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.72 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 98.71 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 98.71 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 98.67 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 98.64 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 98.62 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 98.6 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 98.58 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 98.55 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 98.53 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 98.52 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 98.52 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 98.51 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 98.5 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 98.5 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 98.47 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 98.46 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 98.45 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 98.44 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.43 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.43 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 98.42 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 98.39 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 98.38 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.38 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.37 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 98.36 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.34 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 98.34 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 98.34 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 98.32 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 98.31 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 98.31 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.28 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 98.26 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 98.26 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 98.21 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 98.21 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 98.16 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 98.16 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.15 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.14 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 98.13 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 98.13 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 98.1 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.06 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 98.06 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 98.06 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 98.03 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 98.03 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.03 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.02 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.02 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.01 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 98.0 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 97.84 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.8 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 97.78 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.78 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 97.73 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 97.72 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 97.65 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 97.64 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 97.63 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 97.63 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 97.57 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 97.52 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.5 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 97.47 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.46 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 97.44 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.34 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 97.33 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 97.24 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.19 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.17 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 97.15 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.14 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 97.1 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 97.1 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 97.1 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 97.09 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.07 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 97.05 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.02 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.92 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.91 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 96.91 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.88 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.68 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.5 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.41 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 96.4 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.32 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.27 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 96.18 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 96.16 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 96.14 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.1 | |
| 2e6j_A | 112 | Hydin protein; PAPD, structural genomics, NPPSFA, | 96.05 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.02 | |
| 2ys4_A | 122 | Hydrocephalus-inducing protein homolog; hydin, PAP | 95.94 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.94 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.8 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.79 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.61 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.35 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.32 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.32 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 95.28 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.23 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 95.21 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.11 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 95.02 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 94.97 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.95 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.9 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.86 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 94.78 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 94.78 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 94.73 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 94.61 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.55 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.53 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.52 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 94.51 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 94.43 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.33 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 94.29 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.19 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.17 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 94.16 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 94.15 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 94.14 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 94.14 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.11 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 94.08 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 94.01 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 93.96 | |
| 2qsv_A | 220 | Uncharacterized protein; MCSG, structural genomics | 93.95 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.88 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 93.84 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 93.82 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 93.75 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 93.75 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 93.71 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 93.68 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 93.61 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 93.59 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 93.59 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 93.57 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.54 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 93.51 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 93.48 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 93.43 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.38 | |
| 2qsv_A | 220 | Uncharacterized protein; MCSG, structural genomics | 93.06 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 93.02 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.01 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.0 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 92.87 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 92.79 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 92.74 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 92.73 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 92.71 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.68 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.56 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.52 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.35 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.25 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.19 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 92.16 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 92.01 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 92.0 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 91.94 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 91.84 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 91.77 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 91.74 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.67 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 91.63 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 91.56 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 91.54 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 91.49 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.45 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 91.4 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.37 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.36 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 91.25 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.17 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 91.14 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 91.04 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 91.01 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 91.0 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 90.99 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 90.97 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 90.97 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.93 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 90.93 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 90.91 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 90.83 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 90.79 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 90.76 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 90.75 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 90.68 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 90.58 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 90.55 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 90.52 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 90.5 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 90.47 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.44 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 90.43 | |
| 3isy_A | 120 | Bsupi, intracellular proteinase inhibitor; intrace | 90.39 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.35 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 90.34 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 90.32 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.29 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 90.27 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 90.25 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 90.25 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 90.2 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 90.15 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 90.09 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.09 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 89.95 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 89.94 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 89.92 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 89.89 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 89.89 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 89.88 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 89.87 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 89.86 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 89.79 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 89.77 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 89.76 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 89.72 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 89.66 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 89.64 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 89.57 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 89.52 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 89.47 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 89.46 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 89.44 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 89.41 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 89.3 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 89.2 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 89.19 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 89.19 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 89.13 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 89.12 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 89.08 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 89.02 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.01 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 89.0 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 89.0 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 88.99 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 88.96 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 88.94 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.92 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 88.92 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 88.83 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 88.81 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 88.73 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 88.69 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 88.54 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 88.39 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 88.34 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 88.24 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 88.24 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 88.18 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 88.12 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 88.09 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 87.95 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 87.87 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 87.87 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 87.71 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 87.59 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 87.42 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 87.41 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 87.36 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 87.36 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 87.27 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 87.22 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 87.16 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 87.13 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 87.08 | |
| 3qbt_B | 140 | Inositol polyphosphate 5-phosphatase OCRL-1; prote | 86.86 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 86.85 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 86.77 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 86.76 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 86.75 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 86.7 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 86.69 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 86.61 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 86.48 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 86.45 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 86.35 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 86.33 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 86.21 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 86.03 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 86.01 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 85.8 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 85.79 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 85.58 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 85.43 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 85.27 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 85.27 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 85.23 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 85.14 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 84.96 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 84.94 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 84.93 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 84.83 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 84.57 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 84.57 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 84.48 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 84.35 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 84.3 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 84.27 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 84.23 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 84.21 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 84.19 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 84.08 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 84.07 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 83.96 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 83.94 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 83.85 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 83.81 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 83.8 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 83.68 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 83.46 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 83.4 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 83.39 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 83.37 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 83.28 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 82.9 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 82.51 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 82.51 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 82.47 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 82.36 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 82.35 | |
| 1yew_A | 382 | Particulate methane monooxygenase, B subunit; memb | 82.24 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 82.13 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 82.09 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 82.07 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 81.98 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 81.97 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 81.78 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 81.66 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 81.38 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 81.32 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 81.24 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 81.08 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 81.08 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 81.01 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 80.55 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 80.54 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 80.36 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 80.3 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 80.02 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 80.01 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-82 Score=765.78 Aligned_cols=550 Identities=29% Similarity=0.380 Sum_probs=420.3
Q ss_pred CHHHHHHHHHHHHHHHHHHHHHh----hhh----------ccccccEEE--Ee---Cc-EEEEEecCCCCCC--C--CCC
Q 002849 236 TLKNYTSFFKTLLIMEEIQLKED----MRA----------YDMENVTLM--RK---GL-YLSLVVPGLAERR--P--SLV 291 (874)
Q Consensus 236 ~~~~Y~~~f~~Ll~lEe~~~~~~----~~~----------~~~~~~~~~--~~---~~-~~~l~vpgl~e~r--p--s~~ 291 (874)
+.++|.++|..||.+|+.+.... +.. ..+.++.+. .. |. ++.|+.+...... | .+.
T Consensus 3 ~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~ 82 (646)
T 4b3f_X 3 AVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAAALPSNSFT 82 (646)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC---CCCCCCCCC
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHhCCceecceEEEEEEecCCCeEEEEEEecCCCCCCCCccCCCC
Confidence 36899999999999995422111 111 111122221 11 33 3456655433322 2 488
Q ss_pred CCCEEEEEecCCCCCccEEEEEEEEeCcEEEEEECCCccc--cCCCCCcEEEEEEechhhHHHHHHHhHHHhhc------
Q 002849 292 NGDFIFAKHAYEDTSSAYQGFIHRVEADEVHLKFASDFQL--NHRDENLYNVQFTYNRVNMRRLYQATDAAQEL------ 363 (874)
Q Consensus 292 ~GD~v~~~~~~~~~~~~~~g~v~~v~~~~v~l~~~~~~~~--~~~~~~~~~v~f~~~r~~~~r~~~Al~~~~~~------ 363 (874)
.||.|.++...+.....++|+|++|..++|.+.|+..... .......|.+.+..|+.+++||+.|++.+...
T Consensus 83 ~Gd~v~~~~~~~~~~~~~~g~v~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~al~~l~~~~~~~~~ 162 (646)
T 4b3f_X 83 SGDIVGLYDAANEGSQLATGILTRVTQKSVTVAFDESHDFQLSLDRENSYRLLKLANDVTYRRLKKALIALKKYHSGPAS 162 (646)
T ss_dssp TTCEEEEEETTTTSCCCEEEEEEEEETTEEEEECC-------CCCSSCCEEEEEECCHHHHHHHHHHHHHHHTCCSSTTH
T ss_pred CCCEEEEEecCCCCCceEEEEEEEEeCCEEEEEECCccccccccCCCCcEEEEEeccchHHHHHHHHHHHhhhcccCchH
Confidence 9999999877555567899999999999999999765432 23345679999999999999999999876532
Q ss_pred -ccccccCCCCCCccccccCCCCcCCCCCCHHHHHHHHHHhccCCCCCEEEEcCCCCChhHHHHHHHHHHHHhcCCCeEE
Q 002849 364 -DTEFLFPSESSGIRLIESNTLVPISCNLNEEQMCSIEKILGLKGAPPYLIYGPPGTGKTMTLVEAILQLYATREDARLL 442 (874)
Q Consensus 364 -~~~~lfP~~~~~~~~~~~~~~~~~~~~LN~~Q~~AV~~il~~~~~~~~lI~GPPGTGKT~Tlve~I~~ll~~~~~~rIL 442 (874)
..++||+... +........+.+++..||++|++||..++..+ +++||+||||||||+|++++|.++++ .+.+||
T Consensus 163 ~l~~~l~~~~~-p~~~~~~~~~~~~~~~LN~~Q~~AV~~al~~~--~~~lI~GPPGTGKT~ti~~~I~~l~~--~~~~IL 237 (646)
T 4b3f_X 163 SLIEVLFGRSA-PSPASEIHPLTFFNTCLDTSQKEAVLFALSQK--ELAIIHGPPGTGKTTTVVEIILQAVK--QGLKVL 237 (646)
T ss_dssp HHHHHHTTSSC-CCCCCCCCCCCCSSTTCCHHHHHHHHHHHHCS--SEEEEECCTTSCHHHHHHHHHHHHHH--TTCCEE
T ss_pred HHHHHHcCCCC-CCCccccCcccccCCCCCHHHHHHHHHHhcCC--CceEEECCCCCCHHHHHHHHHHHHHh--CCCeEE
Confidence 2346776544 22222233456788999999999999999754 46899999999999999999999997 468999
Q ss_pred EecCCHHHHHHHHHHHhcccccccccccEEEecCCCCCCcCCchhhhhhcc---------------ccchh---------
Q 002849 443 VCAPSNSAADHLLEKILGEKAVEVRENEIFRLNAPSRPYEDVNADHIRFCF---------------FDEQI--------- 498 (874)
Q Consensus 443 v~ApSNsAaD~l~~rL~~~~~~~~~~~~i~Rl~~~~r~~~~v~~~~~~~~~---------------~~~~~--------- 498 (874)
+|||||.|||+|++||... ...++|++...+....+......... .+...
T Consensus 238 v~a~TN~AvD~i~erL~~~------~~~ilRlG~~~r~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 311 (646)
T 4b3f_X 238 CCAPSNIAVDNLVERLALC------KQRILRLGHPARLLESIQQHSLDAVLARSDSAQIVADIRKDIDQVFVKNKKTQDK 311 (646)
T ss_dssp EEESSHHHHHHHHHHHHHT------TCCEEECSCCSSCCHHHHTTBHHHHHTTTTCSSTHHHHHHHHTTSSTTTTC----
T ss_pred EEcCchHHHHHHHHHHHhc------CCceEEecchhhhhhhhhhhhHHHHHhhchHHHHHHHHHHHHHHHHHhhhhhhhH
Confidence 9999999999999999752 34689999877643332211110000 00000
Q ss_pred --------------------ccCCchhhcccceEEEEechhhhhhhh-cccCCCCccEEEEEcCCCCChhhhHHHhhccc
Q 002849 499 --------------------FKCPPLAALVCYRIIISTYMSASLIYA-EGVDRGHFSHIFLDEAGQASEPESMVPISSYC 557 (874)
Q Consensus 499 --------------------~~~~~~~~L~~~~VI~~T~~sa~~l~~-~~~~~~~fd~ViIDEAsQ~~epe~li~L~~l~ 557 (874)
......+.+..++||++||.+++.... ..+...+||+||||||+|+++|++++||..
T Consensus 312 ~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ~~e~~~lipL~~-- 389 (646)
T 4b3f_X 312 REKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVIDECAQALEASCWIPLLK-- 389 (646)
T ss_dssp --CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCSEEEETTGGGSCHHHHTTTGGG--
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCCEEEEcCccccchHHHHhhccc--
Confidence 000011346778999999998764322 335567899999999999999999999862
Q ss_pred cCCcEEEEecCCCcccceeecchhhhcCCCccHHHHHHhcCCCCCCCccceeecccccCCchhhhccccccccccccccc
Q 002849 558 KKDTVVVLAGDPMQLGPVIYSREAETYGMGKSYLERLFECEPYCHGNENYVTKLVRNYRSHPQILHLPSKLFYEEELIAC 637 (874)
Q Consensus 558 ~~~~~vVLvGDp~QL~PvI~s~~a~~~gl~~SlfeRL~~~~~~~~~~~~~~~~L~~nYRshp~I~~~~n~~fY~~~L~~~ 637 (874)
..++||||||+||||++.+..+...|++.|+|+||..... +..+++|.+||||||.|++|+|+.||+|+|.+.
T Consensus 390 --~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~-----~~~v~~L~~qYRmhp~I~~f~n~~fY~g~L~~~ 462 (646)
T 4b3f_X 390 --ARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYG-----ARVVRTLTVQYRMHQAIMRWASDTMYLGQLTAH 462 (646)
T ss_dssp --SSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHG-----GGTEEECCEESSSCHHHHHHHHHHHSTTCCEEC
T ss_pred --cceEEEcCCccccCceecchhhhhccccchHHHHHHHhcC-----CceeeecccccCCcHHHHhhhHHhhcCCccccC
Confidence 3579999999999999999999999999999999976432 234678999999999999999999999999987
Q ss_pred cccccccccc---ccCCCCCCCCEEEEecCCCc---cccCCCCCccCHHHHHHHHHHHHHHHHcCCCCCCeEEEEcccHH
Q 002849 638 KDESISCTAY---LNFLPNKEFPVLFFGIQGCD---EREGSNPSWFNRIEVSKVVEIIQKLTSTGNLSEEDIGVITPYRQ 711 (874)
Q Consensus 638 ~~~~~~~~~~---~~~~~~~~~pi~f~~v~g~~---~~~~~s~S~~N~~Ea~~V~~~v~~L~~~~~~~~~dIgIItPY~~ 711 (874)
.+...+.... +...+....|++|+++.|.. ..+..+.|+.|..||..|+.+++.|++.| +++++|||||||++
T Consensus 463 ~~~~~~~~~~lp~~~~~~~~~~p~~f~d~~g~~~~~~~~~~~~s~~N~~EA~~V~~~v~~L~~~g-v~~~dIgVItpYra 541 (646)
T 4b3f_X 463 SSVARHLLRDLPGVAATEETGVPLLLVDTAGCGLFELEEEDEQSKGNPGEVRLVSLHIQALVDAG-VPARDIAVVSPYNL 541 (646)
T ss_dssp TTTTTCCGGGSTTCCCCTTTTCSEEEEECTTSSCCCCC-----CCCCHHHHHHHHHHHHHHHHHT-CCGGGEEEEESCHH
T ss_pred cchhhhhhccccccccccccCCceEEEecCCCccccccccCCccccCHHHHHHHHHHHHHHHhcC-CCcCcEEEECCCHH
Confidence 7654443332 23344566799999998863 34556789999999999999999999986 89999999999999
Q ss_pred HHHHHHHHHHhcCCCCeEECccccCCCceeeEEEEEeccCCCcCCccccccccccCCCCCceEeccccccccEEEEEccc
Q 002849 712 QVLKLNKALESLYMPDIKVGSVEQFQGQERQVIIVSTVRSTIKHNDFDRKHCLGFLSNPRRFNVAVTRAISLLIIIGNPH 791 (874)
Q Consensus 712 Qv~~Ir~~L~~~~~~~v~V~TVd~fQG~E~dvVIiS~VRs~~~~~~~d~~~~lGFl~d~rrlNVAiTRAK~~LiIvGn~~ 791 (874)
|+..|++.|.+. .++++|+|||+|||+|+|+||+|+|||+. .+.+||+.|+||||||+||||++||||||+.
T Consensus 542 Q~~~l~~~l~~~-~~~i~v~TVd~fQG~E~dvII~S~vrsn~-------~~~iGFl~~~rRlNVAlTRAk~~liivGn~~ 613 (646)
T 4b3f_X 542 QVDLLRQSLVHR-HPELEIKSVDGFQGREKEAVILSFVRSNR-------KGEVGFLAEDRRINVAVTRARRHVAVICDSR 613 (646)
T ss_dssp HHHHHHHHHTTT-CTTCEEEEGGGGTTCCEEEEEEECCCCCT-------TCCCCSTTCHHHHHHHHHTEEEEEEEEECHH
T ss_pred HHHHHHHHHHHh-CCCCEECChhhcccccCCEEEEEeccCCC-------CCCccccCCcCcEEeEhhhhhCeEEEEEchH
Confidence 999999999763 57899999999999999999999999985 3679999999999999999999999999999
Q ss_pred cccCChHHHHHHHHHHhCCCccc
Q 002849 792 IVSKDPYWHQLLWYCSDNNSYQG 814 (874)
Q Consensus 792 ~L~~~~~w~~ll~~~~~~~~~~g 814 (874)
+|+++++|++|++||+++|.+..
T Consensus 614 ~l~~~~~~~~li~~~~~~g~~~~ 636 (646)
T 4b3f_X 614 TVNNHAFLKTLVEYFTQHGEVRT 636 (646)
T ss_dssp HHTTSHHHHHHHHHHHHSSEEEE
T ss_pred HhcCCHHHHHHHHHHHHCCCEee
Confidence 99999999999999999998764
|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2e6j_A Hydin protein; PAPD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ys4_A Hydrocephalus-inducing protein homolog; hydin, PAPD-like, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qsv_A Uncharacterized protein; MCSG, structural genomics, porphyromonas gingivalis W83, PSI protein structure initiative; 2.10A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2qsv_A Uncharacterized protein; MCSG, structural genomics, porphyromonas gingivalis W83, PSI protein structure initiative; 2.10A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3isy_A Bsupi, intracellular proteinase inhibitor; intracellular proteinase inhibitor bsupi, beta sandwich, GRE structural genomics; HET: PG4; 2.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3qbt_B Inositol polyphosphate 5-phosphatase OCRL-1; protein transport, vesicular trafficking, GTPase, LOWE syndr immunoglobulin fold, RAB8A, endocytosis; HET: GNP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1yew_A Particulate methane monooxygenase, B subunit; membrane protein, beta barrel, oxidoreductase; 2.80A {Methylococcus capsulatus} PDB: 3rgb_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 874 | ||||
| d1w36d1 | 359 | c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c | 3e-19 | |
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 3e-09 | |
| d1pjra1 | 318 | c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu | 5e-07 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 5e-06 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 0.003 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V alpha chain (RecD) species: Escherichia coli [TaxId: 562]
Score = 88.4 bits (218), Expect = 3e-19
Identities = 53/291 (18%), Positives = 87/291 (29%), Gaps = 49/291 (16%)
Query: 343 FTYNRVNMRRLYQATDAAQELDTEFLFPSESSGIRLIESNTLVPISCNLNEEQMCSIEKI 402
+R+ + R++ E E L ++ + + Q +
Sbjct: 101 LCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVA 160
Query: 403 LGLKGAPPYLIYGPPGTGKTMTLVE--AILQLYATREDARLLVCAPSNSAADHLLEKILG 460
L +I G PGTGKT T+ + A L A E R+ + AP+ AA L E +
Sbjct: 161 LT---RRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLG- 216
Query: 461 EKAVEVRENEIFRLNAPSRPYEDVNADHIRFCFFDEQIFKCPPLAALVCYRIIISTYMSA 520
+ +L + + D A +R++ + S
Sbjct: 217 --------KALRQLPLTDEQKKRIPED------------------ASTLHRLLGAQPGSQ 250
Query: 521 SLIYAEGVDRGHFSHIFLDEAGQASEPESMVPISSYCKKDTVVVLAGDPMQLGPV----- 575
L + G + H + +DEA P M + V+ GD QL V
Sbjct: 251 RLRHHAG-NPLHLDVLVVDEASMIDLPM-MSRLIDALPDHARVIFLGDRDQLASVEAGAV 308
Query: 576 ----IYSREAETYGMGKSYLERLFECEPYCHGNENY------VTKLVRNYR 616
A L RL + L ++YR
Sbjct: 309 LGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR 359
|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 874 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.94 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.88 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.87 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.84 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.59 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.78 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.76 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.58 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 98.53 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.52 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.52 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.48 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.46 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.39 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 98.38 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 98.34 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.32 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.28 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 98.27 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.22 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 98.19 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.19 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.12 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.12 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.11 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 98.01 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 97.91 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.9 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.89 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 97.71 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.61 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.45 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.45 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.07 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 97.05 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.05 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.88 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.88 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.7 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.7 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.65 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.62 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.61 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.44 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.29 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.27 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 96.24 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.21 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.2 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 96.2 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.2 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.17 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.12 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.7 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.56 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.39 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.31 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.26 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.22 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 95.2 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.16 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.13 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.05 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 94.98 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.73 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 94.7 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.69 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.59 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.41 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.4 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.39 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.3 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.23 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.22 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.2 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.17 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.96 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 93.93 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.89 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.84 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.8 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.67 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.66 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.65 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.62 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.56 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.53 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.5 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.37 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 93.34 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.31 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 93.22 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.12 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.04 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.02 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 93.01 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.92 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 92.88 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.87 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.68 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.67 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.61 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 92.57 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.31 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.06 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 91.96 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 91.8 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 91.76 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.72 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 91.62 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.59 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 91.3 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.09 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.08 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 91.03 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 90.98 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 90.67 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 90.64 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 90.58 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 90.49 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 90.38 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 90.24 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 90.22 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 89.6 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 89.34 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 89.14 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 89.01 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 88.79 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 88.25 | |
| d1so9a_ | 131 | Cytochrome C oxidase assembly protein CtaG {Rhizob | 88.24 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.88 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 87.86 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 87.79 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 87.64 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 87.27 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 86.53 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.22 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 85.99 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 85.87 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 85.28 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 85.19 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 83.88 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 83.78 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 83.58 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 83.54 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 83.49 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 83.34 | |
| d1tzaa_ | 132 | ApaG {Shewanella oneidensis [TaxId: 70863]} | 81.78 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 80.7 | |
| d1ex0a3 | 100 | Transglutaminase, two C-terminal domains {Human (H | 80.57 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 80.51 | |
| d1xvsa_ | 124 | ApaG {Vibrio cholerae [TaxId: 666]} | 80.37 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 80.15 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 80.15 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1so9a_ b.146.1.1 (A:) Cytochrome C oxidase assembly protein CtaG {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|