Citrus Sinensis ID: 002937

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----
MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDVSKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNAEEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
ccccHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHEEHcccccccccEEEcHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHccccccEEEcEEEEccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccHHHHHHHHcccccccccEEEEEcccccccccccHHHHHHccccccEEEEccccccccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHcccHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHccccccccEEEEcccccccccccccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHcHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHc
cccHHHHHEcccccccEEccccccccccccccccccccccccccccccccHHHHHHEccccEEEEEccccccEEEEEccccccccccccccccccccccccHHEEEEccccccccccccccccccccccHEEHEEEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEccccccHcccccccHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccEcccccccccccccEEEEEccccccEEEEEEEEEEEEEEccHHHHccccEEEEEEcHHHHHccccHHHHHHHHHccccEEEEEccccHHccHHHHHHHHHHccHHHcccHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccccEEEEEEEEccccccEEEccccEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcHHHHHcccccccccccEEEEcHHHHHHHHHccccccEEEccccccccHHHHHEEEEccEEEEcccccccHHHHHHHEcccccHHHHc
MSSLVERLRvrsdrkpiyqldesdddadfeqgkpgttveKFERIVRidakddscqacgesenlmscdtctyayhakclvpplkappsgswrcpecvsplndidkildcemrptvagdsdvsklgskQIFVKQYLVKWKGLSYLHCTWVPEKEFLKafksnprlrtkVNNFHrqmssnnnaeedfvairpewTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQsrshrsscnkqksspqdvtestkkpkefqqyehspeflsggslhpyqleglnflrfswskQTHVILADEMGLGKTIQSIAFLASLFgerisphlvvaplstlRNWEREFATWAPQMNVVMYVGTSQARNIIREYefyfpknpkkvkkkksgqvvseskqdriKFDVLLTSYEMinldsaslkpikwqcmivdeghrlknkdsKLFSSLKQYSTRHRVlltgtplqnNLDELFMLMHFldagkfgslEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDvmkelppkkeLILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCchpymlegvepdiedTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYeridgkvggaeRQIRIDrfnaknssrFCFLLSTragglginlatadtviiydsdwnphADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGskelfadendeggksrqihyddaaidrlldrdqvgdeeaslddedeDGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
msslverlrvrsdrkpiyqldesdddadfeqgkpgttvekferiVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTvagdsdvsklgskQIFVKQYLVKWKGLSYLHCTWVPEKEFLKafksnprlRTKVNNFhrqmssnnnaeedfvairpEWTTVDRILacrgeddekeYLVKYKELSYDECYWEYESDISAFQPEIERFIKIqsrshrsscnkqksspqdvtestkkpKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYefyfpknpkkvkkkksgqvvseskqdrikfdVLLTSYEMInldsaslkpiKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKdvmkelppkkelilRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIdgkvggaerqiridrfnaknssrFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAhrlgqtnkvMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRlkaqninqeelDDIIRYGSKELFadendeggksrqihyddAAIDRLLDRDQVGDEeaslddededgFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDVSKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNAEEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPknpkkvkkkksgqvvseskQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELFADENDEGGKSRQIHYddaaidrlldrdQVGdeeaslddededGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
***************************************KFERIVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDVSKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKS***********************DFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKI*****************************************GSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFP*********************RIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDIN****ISRLHRMLAPHLLRRVKKDVM******KELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDI**************GKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELF*******************I**********************GFLKAFKVLSSIINICMLICDSFLLIDVRYDFS*******
******************************************************QACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCE*******************FVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNF***********EDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKI*******************************YEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKKK***Q*VSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQI*T******ISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHL****************DIIRYGSK*****************YDDAAIDRLLD*********************AFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDVSKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNAEEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQ********************************HSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNP****************QDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQV**********DEDGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
**********RSDRKPIYQ***************************IDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPT***********SKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMS***NAEEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQSR***********************KEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELFADEND*GGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGESENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDVSKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNAEEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLKAFKVLSSIINICMLICDSFLLIDVRYDFSSSIEKVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query864 2.2.26 [Sep-21-2011]
Q9S775 1384 CHD3-type chromatin-remod yes no 0.947 0.591 0.810 0.0
Q12873 2000 Chromodomain-helicase-DNA yes no 0.893 0.386 0.463 0.0
Q6PDQ2 1915 Chromodomain-helicase-DNA no no 0.887 0.400 0.469 0.0
Q14839 1912 Chromodomain-helicase-DNA no no 0.887 0.401 0.469 0.0
Q8TDI0 1954 Chromodomain-helicase-DNA no no 0.890 0.393 0.432 0.0
O97159 1982 Chromodomain-helicase-DNA yes no 0.881 0.384 0.436 0.0
O16102892 Chromodomain-helicase-DNA no no 0.864 0.837 0.449 0.0
Q22516 1787 Chromodomain-helicase-DNA yes no 0.900 0.435 0.439 0.0
G5EBZ4 1829 Protein let-418 OS=Caenor no no 0.895 0.423 0.436 0.0
B0R0I6 2511 Chromodomain-helicase-DNA no no 0.744 0.256 0.428 1e-153
>sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 Back     alignment and function desciption
 Score = 1358 bits (3514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/832 (81%), Positives = 740/832 (88%), Gaps = 13/832 (1%)

Query: 1   MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGES 60
           MSSLVERLR+RSDRKP+Y LD+SDDD      K   T E+ E IVR DAK+++CQACGES
Sbjct: 1   MSSLVERLRIRSDRKPVYNLDDSDDDDFVP--KKDRTFEQVEAIVRTDAKENACQACGES 58

Query: 61  ENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDV 120
            NL+SC+TCTYA+HAKCLVPPLK     +WRCPECVSPLN+IDKILDCEMRPT + +   
Sbjct: 59  TNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVSPLNEIDKILDCEMRPTKSSEQGS 118

Query: 121 SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNA 180
           S    K IFVKQYLVKWKGLSYLHC+WVPEKEF KA+KSN RL+T+VNNFHRQM S NN+
Sbjct: 119 SDAEPKPIFVKQYLVKWKGLSYLHCSWVPEKEFQKAYKSNHRLKTRVNNFHRQMESFNNS 178

Query: 181 EEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFI 240
           E+DFVAIRPEWTTVDRILACR ED E EYLVKYKELSYDECYWE ESDIS FQ EI+RF 
Sbjct: 179 EDDFVAIRPEWTTVDRILACREEDGELEYLVKYKELSYDECYWESESDISTFQNEIQRFK 238

Query: 241 KIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFS 300
            + SR+ RS         +DV +  + P++FQQ++H+PEFL G  LHPYQLEGLNFLRFS
Sbjct: 239 DVNSRTRRS---------KDV-DHKRNPRDFQQFDHTPEFLKG-LLHPYQLEGLNFLRFS 287

Query: 301 WSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMN 360
           WSKQTHVILADEMGLGKTIQSIA LASLF E + PHLV+APLSTLRNWEREFATWAPQMN
Sbjct: 288 WSKQTHVILADEMGLGKTIQSIALLASLFEENLIPHLVIAPLSTLRNWEREFATWAPQMN 347

Query: 361 VVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLD 420
           VVMY GT+QAR +IRE+EFY  K+ KK+KKKKSGQ+ SESKQ RIKFDVLLTSYEMINLD
Sbjct: 348 VVMYFGTAQARAVIREHEFYLSKDQKKIKKKKSGQISSESKQKRIKFDVLLTSYEMINLD 407

Query: 421 SASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHF 480
           SA LKPIKW+CMIVDEGHRLKNKDSKLFSSL QYS+ HR+LLTGTPLQNNLDELFMLMHF
Sbjct: 408 SAVLKPIKWECMIVDEGHRLKNKDSKLFSSLTQYSSNHRILLTGTPLQNNLDELFMLMHF 467

Query: 481 LDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVEL 540
           LDAGKFGSLEEFQEEFKDINQEEQISRLH+MLAPHLLRRVKKDVMK++PPKKELILRV+L
Sbjct: 468 LDAGKFGSLEEFQEEFKDINQEEQISRLHKMLAPHLLRRVKKDVMKDMPPKKELILRVDL 527

Query: 541 SSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESF 600
           SS QKEYYKAI TRNYQ+LT++GGAQISL N++MELRK+CCHPYMLEGVEP I D NE+F
Sbjct: 528 SSLQKEYYKAIFTRNYQVLTKKGGAQISLNNIMMELRKVCCHPYMLEGVEPVIHDANEAF 587

Query: 601 KQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGG 660
           KQLLES GKLQLLDKMMVKLKEQGHRVLIY+QFQHMLDLLEDY T KKWQYERIDGKVGG
Sbjct: 588 KQLLESCGKLQLLDKMMVKLKEQGHRVLIYTQFQHMLDLLEDYCTHKKWQYERIDGKVGG 647

Query: 661 AERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 720
           AERQIRIDRFNAKNS++FCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR
Sbjct: 648 AERQIRIDRFNAKNSNKFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 707

Query: 721 LGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKE 780
           LGQTNKVMI+RLI RG+IEERMMQ+TKKKMVLEHLVVG+LK QNINQEELDDIIRYGSKE
Sbjct: 708 LGQTNKVMIYRLINRGTIEERMMQLTKKKMVLEHLVVGKLKTQNINQEELDDIIRYGSKE 767

Query: 781 LFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLKAFKV 832
           LFA E+DE GKS +IHYDDAAID+LLDRD V  EE S+DDE+E+GFLKAFKV
Sbjct: 768 LFASEDDEAGKSGKIHYDDAAIDKLLDRDLVEAEEVSVDDEEENGFLKAFKV 819
Chromatin remodeling factor that represses the expression of embryonic trait genes (such as NFYB9/LEC1) upon and after seed germination and thus enables the developmental switch to post-germinative growth. Silences some MADS-box proteins such as PHE1 and PHE2. Plays a role during carpel differentiation.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 Back     alignment and function description
>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 Back     alignment and function description
>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 Back     alignment and function description
>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 Back     alignment and function description
>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 Back     alignment and function description
>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 Back     alignment and function description
>sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 Back     alignment and function description
>sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
255548778 1470 chromodomain helicase DNA binding protei 0.959 0.563 0.888 0.0
224092566 1340 chromatin remodeling complex subunit [Po 0.959 0.618 0.882 0.0
359475843 1472 PREDICTED: CHD3-type chromatin-remodelin 0.962 0.565 0.891 0.0
296082077 1356 unnamed protein product [Vitis vinifera] 0.962 0.613 0.891 0.0
449455537 1474 PREDICTED: CHD3-type chromatin-remodelin 0.962 0.564 0.859 0.0
224143281 1334 chromatin remodeling complex subunit [Po 0.947 0.613 0.865 0.0
449485189 1474 PREDICTED: LOW QUALITY PROTEIN: CHD3-typ 0.962 0.564 0.856 0.0
356507366 1441 PREDICTED: CHD3-type chromatin-remodelin 0.962 0.577 0.877 0.0
356515042 1440 PREDICTED: CHD3-type chromatin-remodelin 0.962 0.577 0.875 0.0
357466053 1483 Chromatin remodeling complex subunit [Me 0.959 0.559 0.822 0.0
>gi|255548778|ref|XP_002515445.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] gi|223545389|gb|EEF46894.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1545 bits (3999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/832 (88%), Positives = 789/832 (94%), Gaps = 3/832 (0%)

Query: 1   MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGES 60
           MSSLVERLRVRS+R+P+Y LDESDD+ DF  GKPG + EK ERIVR DAK D CQ+CGE+
Sbjct: 1   MSSLVERLRVRSERRPVYNLDESDDE-DFVSGKPGKSQEKIERIVRDDAKADCCQSCGEN 59

Query: 61  ENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDV 120
            +L+SC+TCTY+YH KCL+PP+KA    +WRCPECVSPLNDIDKILDCEMRPTVAGD+DV
Sbjct: 60  GDLLSCETCTYSYHPKCLLPPIKATLPSNWRCPECVSPLNDIDKILDCEMRPTVAGDNDV 119

Query: 121 SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNA 180
           SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQM SNNNA
Sbjct: 120 SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMDSNNNA 179

Query: 181 EEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFI 240
           E+DFVAIRPEWTTVDRILACRG+DDEKEY VKYKEL YDECYWE+ESDISAFQPEIE+F 
Sbjct: 180 EDDFVAIRPEWTTVDRILACRGDDDEKEYFVKYKELPYDECYWEFESDISAFQPEIEKFN 239

Query: 241 KIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFS 300
           +IQS+S +   NK KSS +D T+S KK KEFQQYE SPEFL+GGSLHPYQLEGLNFLRFS
Sbjct: 240 RIQSKSRK--LNKHKSSLKDATDSKKKSKEFQQYEQSPEFLTGGSLHPYQLEGLNFLRFS 297

Query: 301 WSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMN 360
           WSKQTHVILADEMGLGKTIQSIAFLASLF E +SPHLVVAPLSTLRNWEREFATWAPQ+N
Sbjct: 298 WSKQTHVILADEMGLGKTIQSIAFLASLFEESLSPHLVVAPLSTLRNWEREFATWAPQLN 357

Query: 361 VVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLD 420
           VVMYVG++QAR +IREYEFY+PK+ KK+KKKKSGQVV ESKQDRIKFDVLLTSYEMINLD
Sbjct: 358 VVMYVGSAQARTVIREYEFYYPKSHKKIKKKKSGQVVGESKQDRIKFDVLLTSYEMINLD 417

Query: 421 SASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHF 480
           + SLKPIKW+CMIVDEGHRLKNKDSKLF SLKQYS+ HRVLLTGTPLQNNLDELFMLMHF
Sbjct: 418 TTSLKPIKWECMIVDEGHRLKNKDSKLFLSLKQYSSNHRVLLTGTPLQNNLDELFMLMHF 477

Query: 481 LDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVEL 540
           LDAGKF SLEEFQEEFKDINQEEQISRLH+MLAPHLLRRVKKDVM ELPPKKELILRVEL
Sbjct: 478 LDAGKFASLEEFQEEFKDINQEEQISRLHKMLAPHLLRRVKKDVMTELPPKKELILRVEL 537

Query: 541 SSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESF 600
           SSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDI+D+NESF
Sbjct: 538 SSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIQDSNESF 597

Query: 601 KQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGG 660
           +QL+ESSGKLQLLDKMMV+LKEQGHRVLIYSQFQHMLDLLEDY T+KKWQYERIDGKVGG
Sbjct: 598 RQLVESSGKLQLLDKMMVRLKEQGHRVLIYSQFQHMLDLLEDYCTYKKWQYERIDGKVGG 657

Query: 661 AERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 720
           AERQ+RIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR
Sbjct: 658 AERQVRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 717

Query: 721 LGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKE 780
           LGQTNKVMI+RLITRG+IEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKE
Sbjct: 718 LGQTNKVMIYRLITRGTIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKE 777

Query: 781 LFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLKAFKV 832
           LFADENDE GKSRQIHYDD AIDRLLDR+QVG+EEAS+DDE+EDGFLKAFKV
Sbjct: 778 LFADENDEAGKSRQIHYDDTAIDRLLDREQVGEEEASVDDEEEDGFLKAFKV 829

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224092566|ref|XP_002309665.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222855641|gb|EEE93188.1| chromatin remodeling complex subunit [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475843|ref|XP_002282918.2| PREDICTED: CHD3-type chromatin-remodeling factor PICKLE-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082077|emb|CBI21082.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455537|ref|XP_004145509.1| PREDICTED: CHD3-type chromatin-remodeling factor PICKLE-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224143281|ref|XP_002324903.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222866337|gb|EEF03468.1| chromatin remodeling complex subunit [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449485189|ref|XP_004157094.1| PREDICTED: LOW QUALITY PROTEIN: CHD3-type chromatin-remodeling factor PICKLE-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507366|ref|XP_003522438.1| PREDICTED: CHD3-type chromatin-remodeling factor PICKLE-like [Glycine max] Back     alignment and taxonomy information
>gi|356515042|ref|XP_003526210.1| PREDICTED: CHD3-type chromatin-remodeling factor PICKLE-like [Glycine max] Back     alignment and taxonomy information
>gi|357466053|ref|XP_003603311.1| Chromatin remodeling complex subunit [Medicago truncatula] gi|355492359|gb|AES73562.1| Chromatin remodeling complex subunit [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
TAIR|locus:2040184 1384 PKL "PICKLE" [Arabidopsis thal 0.947 0.591 0.774 0.0
TAIR|locus:2116747 1202 PKR2 "PICKLE RELATED 2" [Arabi 0.486 0.349 0.690 1.2e-253
UNIPROTKB|F1N3F6 1934 CHD4 "Uncharacterized protein" 0.702 0.313 0.520 4.3e-180
UNIPROTKB|F1LPP7 2020 Chd3 "Protein Chd3" [Rattus no 0.702 0.300 0.520 5.6e-180
UNIPROTKB|F1M7Q0 2054 Chd3 "Protein Chd3" [Rattus no 0.702 0.295 0.520 5.6e-180
RGD|1311923 1925 Chd3 "chromodomain helicase DN 0.702 0.315 0.520 5.6e-180
UNIPROTKB|F1ST12 2002 CHD3 "Uncharacterized protein" 0.700 0.302 0.520 1.5e-179
UNIPROTKB|E9PG89 2059 CHD3 "Chromodomain-helicase-DN 0.700 0.293 0.522 5e-179
UNIPROTKB|Q12873 2000 CHD3 "Chromodomain-helicase-DN 0.700 0.302 0.522 5e-179
UNIPROTKB|E2RTI2 1998 CHD3 "Uncharacterized protein" 0.700 0.302 0.520 8.1e-179
TAIR|locus:2040184 PKL "PICKLE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3329 (1176.9 bits), Expect = 0., P = 0.
 Identities = 644/832 (77%), Positives = 703/832 (84%)

Query:     1 MSSLVERLRVRSDRKPIYQLDESDDDADFEQGKPGTTVEKFERIVRIDAKDDSCQACGES 60
             MSSLVERLR+RSDRKP+Y LD+SDDD DF   K   T E+ E IVR DAK+++CQACGES
Sbjct:     1 MSSLVERLRIRSDRKPVYNLDDSDDD-DFVP-KKDRTFEQVEAIVRTDAKENACQACGES 58

Query:    61 ENLMSCDTCTYAYHAKCLVPPLKAPPSGSWRCPECVSPLNDIDKILDCEMRPTVAGDSDV 120
              NL+SC+TCTYA+HAKCLVPPLK     +WRCPECVSPLN+IDKILDCEMRPT + +   
Sbjct:    59 TNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVSPLNEIDKILDCEMRPTKSSEQGS 118

Query:   121 SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNNA 180
             S    K IFVKQYLVKWKGLSYLHC+WVPEKEF KA+KSN RL+T+VNNFHRQM S NN+
Sbjct:   119 SDAEPKPIFVKQYLVKWKGLSYLHCSWVPEKEFQKAYKSNHRLKTRVNNFHRQMESFNNS 178

Query:   181 EEDFVAIRPEWTTVDRILACRGEDDEKEYLVKYKELSYDECYWEYESDISAFQPEIERFI 240
             E+DFVAIRPEWTTVDRILACR ED E EYLVKYKELSYDECYWE ESDIS FQ EI+RF 
Sbjct:   179 EDDFVAIRPEWTTVDRILACREEDGELEYLVKYKELSYDECYWESESDISTFQNEIQRFK 238

Query:   241 KIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFS 300
              + SR+ RS         +DV +  + P++FQQ++H+PEFL G  LHPYQLEGLNFLRFS
Sbjct:   239 DVNSRTRRS---------KDV-DHKRNPRDFQQFDHTPEFLKG-LLHPYQLEGLNFLRFS 287

Query:   301 WSKQTHVILADEMGLGKTIQSIAFLASLFGERISPHLVVAPLSTLRNWEREFATWAPQMN 360
             WSKQTHVILADEMGLGKTIQSIA LASLF E + PHLV+APLSTLRNWEREFATWAPQMN
Sbjct:   288 WSKQTHVILADEMGLGKTIQSIALLASLFEENLIPHLVIAPLSTLRNWEREFATWAPQMN 347

Query:   361 VVMYVGTSQARNIIREYEFYFPXXXXXXXXXXXXXXXXXXXQDRIKFDVLLTSYEMINLD 420
             VVMY GT+QAR +IRE+EFY                     Q RIKFDVLLTSYEMINLD
Sbjct:   348 VVMYFGTAQARAVIREHEFYLSKDQKKIKKKKSGQISSESKQKRIKFDVLLTSYEMINLD 407

Query:   421 SASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHF 480
             SA LKPIKW+CMIVDEGHRLKNKDSKLFSSL QYS+ HR+LLTGTPLQNNLDELFMLMHF
Sbjct:   408 SAVLKPIKWECMIVDEGHRLKNKDSKLFSSLTQYSSNHRILLTGTPLQNNLDELFMLMHF 467

Query:   481 LDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVEL 540
             LDAGKFGSLEEFQEEFKDINQEEQISRLH+MLAPHLLRRVKKDVMK++PPKKELILRV+L
Sbjct:   468 LDAGKFGSLEEFQEEFKDINQEEQISRLHKMLAPHLLRRVKKDVMKDMPPKKELILRVDL 527

Query:   541 SSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRKLCCHPYMLEGVEPDIEDTNESF 600
             SS QKEYYKAI TRNYQ+LT++GGAQISL N++MELRK+CCHPYMLEGVEP I D NE+F
Sbjct:   528 SSLQKEYYKAIFTRNYQVLTKKGGAQISLNNIMMELRKVCCHPYMLEGVEPVIHDANEAF 587

Query:   601 KQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGG 660
             KQLLES GKLQLLDKMMVKLKEQGHRVLIY+QFQHMLDLLEDY T KKWQYERIDGKVGG
Sbjct:   588 KQLLESCGKLQLLDKMMVKLKEQGHRVLIYTQFQHMLDLLEDYCTHKKWQYERIDGKVGG 647

Query:   661 AERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 720
             AERQIRIDRFNAKNS++FCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR
Sbjct:   648 AERQIRIDRFNAKNSNKFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHR 707

Query:   721 LGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLKAQNINQEELDDIIRYGSKE 780
             LGQTNKVMI+RLI RG+IEERMMQ+TKKKMVLEHLVVG+LK QNINQEELDDIIRYGSKE
Sbjct:   708 LGQTNKVMIYRLINRGTIEERMMQLTKKKMVLEHLVVGKLKTQNINQEELDDIIRYGSKE 767

Query:   781 LFADENDEGGKSRQIHYXXXXXXXXXXXXQVGXXXXXXXXXXXXGFLKAFKV 832
             LFA E+DE GKS +IHY             V             GFLKAFKV
Sbjct:   768 LFASEDDEAGKSGKIHYDDAAIDKLLDRDLVEAEEVSVDDEEENGFLKAFKV 819
GO:0003674 "molecular_function" evidence=ND
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003678 "DNA helicase activity" evidence=ISS
GO:0016568 "chromatin modification" evidence=ISS
GO:0016887 "ATPase activity" evidence=ISS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:2000023 "regulation of lateral root development" evidence=IMP
GO:0009788 "negative regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0008283 "cell proliferation" evidence=IMP
GO:0009739 "response to gibberellin stimulus" evidence=IMP
GO:0048364 "root development" evidence=IMP
TAIR|locus:2116747 PKR2 "PICKLE RELATED 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3F6 CHD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPP7 Chd3 "Protein Chd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7Q0 Chd3 "Protein Chd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1311923 Chd3 "chromodomain helicase DNA binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST12 CHD3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PG89 CHD3 "Chromodomain-helicase-DNA-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q12873 CHD3 "Chromodomain-helicase-DNA-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTI2 CHD3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9S775PKL_ARATH3, ., 6, ., 4, ., -0.81000.94790.5917yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-163
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 1e-105
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-97
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-27
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-24
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-21
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-20
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-20
smart0024947 smart00249, PHD, PHD zinc finger 7e-11
pfam0062851 pfam00628, PHD, PHD-finger 1e-10
smart0029855 smart00298, CHROMO, Chromatin organization modifie 1e-09
pfam0038552 pfam00385, Chromo, Chromo (CHRromatin Organisation 2e-09
pfam11496279 pfam11496, HDA2-3, Class II histone deacetylase co 6e-09
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 4e-08
pfam0038552 pfam00385, Chromo, Chromo (CHRromatin Organisation 2e-07
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 2e-07
smart0029855 smart00298, CHROMO, Chromatin organization modifie 5e-07
cd11726127 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha 0.001
PRK04914 956 PRK04914, PRK04914, ATP-dependent helicase HepA; V 0.002
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information 
 Score =  501 bits (1291), Expect = e-163
 Identities = 245/551 (44%), Positives = 341/551 (61%), Gaps = 45/551 (8%)

Query: 284 GSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGER--ISPHLVVAP 341
           G +  YQL GLN+L   +    + ILADEMGLGKT+Q+I+ L  L   R    PH+VVAP
Sbjct: 168 GKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLGYLHEYRGITGPHMVVAP 227

Query: 342 LSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESK 401
            STL NW  E   + P +  V + G  + R   RE E                       
Sbjct: 228 KSTLGNWMNEIRRFCPVLRAVKFHGNPEERAHQRE-ELLVAG------------------ 268

Query: 402 QDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVL 461
               KFDV +TS+EM   +  +LK   W+ +I+DE HR+KN++S L  +++ +ST +R+L
Sbjct: 269 ----KFDVCVTSFEMAIKEKTALKRFSWRYIIIDEAHRIKNENSLLSKTMRLFSTNYRLL 324

Query: 462 LTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFK---DINQEEQISRLHRMLAPHLLR 518
           +TGTPLQNNL EL+ L++FL    F S E F E F+   + +Q+E + +LH++L P LLR
Sbjct: 325 ITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQISGENDQQEVVQQLHKVLRPFLLR 384

Query: 519 RVKKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRGGAQISLINVVMELRK 578
           R+K DV K LPPKKE IL+V +S  QK+YYKA+L ++  ++   GG +  L+N+ M+LRK
Sbjct: 385 RLKSDVEKGLPPKKETILKVGMSQMQKQYYKALLQKDLDVVNA-GGERKRLLNIAMQLRK 443

Query: 579 LCCHPYMLEGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLD 638
            C HPY+ +G EP    T  + + L+E+SGK+ LLDK++ KLKE+  RVLI+SQ   +LD
Sbjct: 444 CCNHPYLFQGAEPGPPYT--TGEHLVENSGKMVLLDKLLPKLKERDSRVLIFSQMTRLLD 501

Query: 639 LLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADT 698
           +LEDYL ++ +QY RIDG  GG +R   ID FN   S +F FLLSTRAGGLGINLATAD 
Sbjct: 502 ILEDYLMYRGYQYCRIDGNTGGEDRDASIDAFNKPGSEKFVFLLSTRAGGLGINLATADI 561

Query: 699 VIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVV- 757
           VI+YDSDWNP  DLQA  RAHR+GQ  +V +FR  T  +IEE++++   KK+ L+ LV+ 
Sbjct: 562 VILYDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTEYTIEEKVIERAYKKLALDALVIQ 621

Query: 758 -GRLKAQ-NINQEELDDIIRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEE 815
            GRL  Q  +N++EL  ++RYG++ +F        K   I   D  IDR++ +   G+E 
Sbjct: 622 QGRLAEQKTVNKDELLQMVRYGAEMVF------SSKDSTI--TDEDIDRIIAK---GEEA 670

Query: 816 ASLDDEDEDGF 826
            +  D     F
Sbjct: 671 TAELDAKMKKF 681

Length = 1033
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain Back     alignment and domain information
>gnl|CDD|221124 pfam11496, HDA2-3, Class II histone deacetylase complex subunits 2 and 3 Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) Back     alignment and domain information
>gnl|CDD|235319 PRK04914, PRK04914, ATP-dependent helicase HepA; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 864
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 100.0
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 100.0
KOG0387 923 consensus Transcription-coupled repair protein CSB 100.0
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 100.0
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 100.0
KOG0383696 consensus Predicted helicase [General function pre 100.0
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 100.0
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 100.0
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 100.0
KOG1002791 consensus Nucleotide excision repair protein RAD16 100.0
KOG4439901 consensus RNA polymerase II transcription terminat 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 100.0
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG1001674 consensus Helicase-like transcription factor HLTF/ 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0298 1394 consensus DEAD box-containing helicase-like transc 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.98
PHA02558501 uvsW UvsW helicase; Provisional 99.97
PTZ00110545 helicase; Provisional 99.94
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.93
KOG0354746 consensus DEAD-box like helicase [General function 99.93
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.93
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.93
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.93
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.92
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.92
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.92
KOG1123776 consensus RNA polymerase II transcription initiati 99.92
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.92
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.91
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.91
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.91
PTZ00424401 helicase 45; Provisional 99.91
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.91
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.9
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.9
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.89
PRK13767 876 ATP-dependent helicase; Provisional 99.89
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.89
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.88
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.88
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.87
PRK106891147 transcription-repair coupling factor; Provisional 99.86
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.84
PRK02362 737 ski2-like helicase; Provisional 99.84
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.83
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.83
PRK00254 720 ski2-like helicase; Provisional 99.83
PRK01172 674 ski2-like helicase; Provisional 99.82
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.82
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.81
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.8
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.8
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 99.79
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.79
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.78
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.78
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.78
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.77
COG4096 875 HsdR Type I site-specific restriction-modification 99.77
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.77
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.76
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.76
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.76
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.75
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.75
KOG4284 980 consensus DEAD box protein [Transcription] 99.74
PHA02653675 RNA helicase NPH-II; Provisional 99.74
PRK09401 1176 reverse gyrase; Reviewed 99.73
COG4889 1518 Predicted helicase [General function prediction on 99.73
COG1205 851 Distinct helicase family with a unique C-terminal 99.73
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.73
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.72
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.72
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.72
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.69
PRK05580679 primosome assembly protein PriA; Validated 99.69
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.67
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.67
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.67
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.66
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.66
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.66
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.66
COG1202 830 Superfamily II helicase, archaea-specific [General 99.65
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.65
COG1204 766 Superfamily II helicase [General function predicti 99.64
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.64
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.64
KOG0347731 consensus RNA helicase [RNA processing and modific 99.63
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.62
PRK09694878 helicase Cas3; Provisional 99.62
PRK14701 1638 reverse gyrase; Provisional 99.61
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.6
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.59
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.58
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.58
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.57
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.56
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.54
KOG0346569 consensus RNA helicase [RNA processing and modific 99.53
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.52
KOG0327397 consensus Translation initiation factor 4F, helica 99.52
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.49
smart00487201 DEXDc DEAD-like helicases superfamily. 99.49
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.47
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.45
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.45
PRK05298652 excinuclease ABC subunit B; Provisional 99.43
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.42
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.42
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.42
smart0049082 HELICc helicase superfamily c-terminal domain. 99.4
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.39
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.38
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.37
PF11496297 HDA2-3: Class II histone deacetylase complex subun 99.36
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.33
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.33
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.3
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.3
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.28
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.27
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.25
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.19
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.18
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.13
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.01
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.0
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.99
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.9
KOG1244336 consensus Predicted transcription factor Requiem/N 98.9
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 98.88
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.87
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.87
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 98.84
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.84
COG0610 962 Type I site-specific restriction-modification syst 98.78
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.77
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.76
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 98.71
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.69
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 98.69
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.68
KOG4299613 consensus PHD Zn-finger protein [General function 98.67
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.65
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 98.64
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.59
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 98.54
PRK15483 986 type III restriction-modification system StyLTI en 98.53
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.51
cd0002455 CHROMO Chromatin organization modifier (chromo) do 98.45
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 98.44
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.42
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.42
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 98.41
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.39
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.38
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 98.38
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.34
PF13871278 Helicase_C_4: Helicase_C-like 98.29
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.26
smart0029855 CHROMO Chromatin organization modifier domain. 98.22
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.22
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 98.22
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.2
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.17
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.17
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.15
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.12
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.12
cd0002455 CHROMO Chromatin organization modifier (chromo) do 98.11
KOG1973274 consensus Chromatin remodeling protein, contains P 97.99
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 97.93
KOG1512381 consensus PHD Zn-finger protein [General function 97.89
KOG2748369 consensus Uncharacterized conserved protein, conta 97.89
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 97.85
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.85
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.82
KOG0957707 consensus PHD finger protein [General function pre 97.75
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 97.65
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.64
smart0029855 CHROMO Chromatin organization modifier domain. 97.61
KOG0954893 consensus PHD finger protein [General function pre 97.48
KOG4443694 consensus Putative transcription factor HALR/MLL3, 97.47
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 97.37
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 97.31
PRK10536262 hypothetical protein; Provisional 97.31
KOG09551051 consensus PHD finger protein BR140/LIN-49 [General 97.29
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.26
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.2
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.18
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.15
KOG1911270 consensus Heterochromatin-associated protein HP1 a 97.01
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.0
COG5141669 PHD zinc finger-containing protein [General functi 96.96
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.86
KOG2748369 consensus Uncharacterized conserved protein, conta 96.82
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.77
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.65
KOG0956900 consensus PHD finger protein AF10 [General functio 96.58
PRK14873665 primosome assembly protein PriA; Provisional 96.56
KOG1131 755 consensus RNA polymerase II transcription initiati 96.48
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.48
TIGR00376637 DNA helicase, putative. The gene product may repre 96.23
KOG1803649 consensus DNA helicase [Replication, recombination 96.23
KOG1911270 consensus Heterochromatin-associated protein HP1 a 96.09
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 95.98
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 95.91
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 95.86
PLN03025319 replication factor C subunit; Provisional 95.77
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.48
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 95.45
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.41
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 95.24
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 95.13
PRK04296190 thymidine kinase; Provisional 95.08
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.02
PRK10875615 recD exonuclease V subunit alpha; Provisional 94.81
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.61
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 94.6
PRK06526254 transposase; Provisional 94.51
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.49
KOG0383696 consensus Predicted helicase [General function pre 94.4
PRK09112351 DNA polymerase III subunit delta'; Validated 94.35
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 94.29
PRK12402337 replication factor C small subunit 2; Reviewed 94.16
smart00382148 AAA ATPases associated with a variety of cellular 94.03
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.89
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.75
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.66
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.59
PRK08181269 transposase; Validated 93.58
PRK05707328 DNA polymerase III subunit delta'; Validated 93.43
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.36
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 93.14
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.01
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.94
smart00491142 HELICc2 helicase superfamily c-terminal domain. 92.93
PRK07940394 DNA polymerase III subunit delta'; Validated 92.78
CHL00181287 cbbX CbbX; Provisional 92.77
PRK00440319 rfc replication factor C small subunit; Reviewed 92.76
PRK08084235 DNA replication initiation factor; Provisional 92.68
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 92.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.5
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 92.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 92.35
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.21
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.17
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 92.14
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 91.85
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.74
PF1324576 AAA_19: Part of AAA domain 91.69
KOG4299613 consensus PHD Zn-finger protein [General function 91.68
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 91.64
PRK08769319 DNA polymerase III subunit delta'; Validated 91.49
PRK08116268 hypothetical protein; Validated 91.44
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.41
PRK14974336 cell division protein FtsY; Provisional 91.29
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.27
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 91.25
PHA02544316 44 clamp loader, small subunit; Provisional 91.24
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 91.12
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.97
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 90.93
PF13173128 AAA_14: AAA domain 90.93
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 90.91
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 90.72
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 90.69
PRK08058329 DNA polymerase III subunit delta'; Validated 90.68
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 90.61
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 90.55
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 90.4
KOG4443694 consensus Putative transcription factor HALR/MLL3, 90.36
PHA02533534 17 large terminase protein; Provisional 90.32
PRK08727233 hypothetical protein; Validated 90.31
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 90.25
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 90.19
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 90.16
KOG18051100 consensus DNA replication helicase [Replication, r 90.1
TIGR02928365 orc1/cdc6 family replication initiation protein. M 90.02
PRK00149450 dnaA chromosomal replication initiation protein; R 89.6
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.37
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 89.26
PRK07471365 DNA polymerase III subunit delta'; Validated 89.22
PRK13889988 conjugal transfer relaxase TraA; Provisional 88.98
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 88.97
KOG0957707 consensus PHD finger protein [General function pre 88.93
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 88.89
TIGR00362405 DnaA chromosomal replication initiator protein Dna 88.87
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 88.85
PHA03368738 DNA packaging terminase subunit 1; Provisional 88.78
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 88.76
PHA03372668 DNA packaging terminase subunit 1; Provisional 88.57
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 88.38
PHA03333752 putative ATPase subunit of terminase; Provisional 88.3
PRK06871325 DNA polymerase III subunit delta'; Validated 88.26
PRK00411394 cdc6 cell division control protein 6; Reviewed 88.19
COG2256436 MGS1 ATPase related to the helicase subunit of the 88.13
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 88.11
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 88.06
PRK14087450 dnaA chromosomal replication initiation protein; P 88.03
COG1484254 DnaC DNA replication protein [DNA replication, rec 87.94
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 87.27
PRK04132846 replication factor C small subunit; Provisional 87.15
TIGR00595 505 priA primosomal protein N'. All proteins in this f 87.08
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.95
PRK11054684 helD DNA helicase IV; Provisional 86.88
PRK06090319 DNA polymerase III subunit delta'; Validated 86.72
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 86.61
PRK05642234 DNA replication initiation factor; Validated 86.49
PRK06964342 DNA polymerase III subunit delta'; Validated 86.34
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 86.3
PRK06893229 DNA replication initiation factor; Validated 86.2
COG0593408 DnaA ATPase involved in DNA replication initiation 86.18
PRK04195482 replication factor C large subunit; Provisional 86.13
smart00492141 HELICc3 helicase superfamily c-terminal domain. 86.05
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 85.95
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 85.91
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 85.63
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 85.62
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 85.5
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 85.43
KOG1246904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 85.34
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 85.24
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 85.23
PRK00771437 signal recognition particle protein Srp54; Provisi 85.18
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 85.16
PRK05580 679 primosome assembly protein PriA; Validated 85.14
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 84.89
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 84.82
COG1198 730 PriA Primosomal protein N' (replication factor Y) 84.59
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 84.56
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 84.53
PRK14088440 dnaA chromosomal replication initiation protein; P 84.53
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 84.5
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 84.39
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 84.26
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 84.19
PRK13342413 recombination factor protein RarA; Reviewed 84.16
PF0139358 Chromo_shadow: Chromo shadow domain Web page maint 83.81
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 83.71
PRK14086617 dnaA chromosomal replication initiation protein; P 83.53
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 83.42
KOG1512381 consensus PHD Zn-finger protein [General function 83.41
PRK07993334 DNA polymerase III subunit delta'; Validated 82.94
PRK12422445 chromosomal replication initiation protein; Provis 82.93
COG3973747 Superfamily I DNA and RNA helicases [General funct 82.87
PF00004132 AAA: ATPase family associated with various cellula 82.77
PRK11823446 DNA repair protein RadA; Provisional 82.68
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 82.37
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 81.95
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 81.75
smart0030061 ChSh Chromo Shadow Domain. 81.49
PRK08699325 DNA polymerase III subunit delta'; Validated 81.04
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 80.68
PRK06835329 DNA replication protein DnaC; Validated 80.68
PRK13826 1102 Dtr system oriT relaxase; Provisional 80.45
PTZ001121164 origin recognition complex 1 protein; Provisional 80.31
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-151  Score=1287.69  Aligned_cols=672  Identities=49%  Similarity=0.852  Sum_probs=607.6

Q ss_pred             hhheeeeeeecCCccccccccChHHHHHHhhcChhHHHHHHhHHhhhccCCC--CchhhhhcCCccchhhhHhhhhcCCc
Q 002937          128 IFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSSNNN--AEEDFVAIRPEWTTVDRILACRGEDD  205 (864)
Q Consensus       128 ~~~~eylVKw~~~S~~h~~W~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~verIi~~~~~~~  205 (864)
                      ....+|||||+|+||+||||++++.|...   ..++-+|++||.++.....-  -.++...+.++|.+|||||++.....
T Consensus       223 ~e~~qFlIKWkg~SyLHctWet~~~L~~~---~~rG~kKv~nf~kK~~e~~~~~r~E~~~~~~~dy~~VdRIia~~~~~d  299 (1373)
T KOG0384|consen  223 EEEEQFLIKWKGWSYLHCTWETESELLEM---NVRGLKKVDNFKKKVIEEDRWRRQEREEDLNKDYVIVDRIIAEQTSKD  299 (1373)
T ss_pred             chhhhhheeeccccceeccccchHHHHhh---hHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhhhhhcccCCC
Confidence            34579999999999999999999998643   23444699999987543211  12344568899999999999986555


Q ss_pred             cceeeeeeccccccccccccCCCCCc-cHHHHHHHHHHhhhccccccCccCCCCcccccccCCCccccccccCCCCCCCC
Q 002937          206 EKEYLVKYKELSYDECYWEYESDISA-FQPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGG  284 (864)
Q Consensus       206 ~~~ylVKW~~l~y~~~tWe~~~~~~~-~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  284 (864)
                       .+|||||+||||++||||.+.++.. .+.+++.|..+.....         .+.......+....|.++..||.|+.|.
T Consensus       300 -~eYLvKW~~LpY~e~TWE~~~~I~~~~~~~~~~~~~Re~sk~---------~p~~~~~~~~~rp~~~Kle~qp~~~~g~  369 (1373)
T KOG0384|consen  300 -PEYLVKWRGLPYEECTWEDAEDIAKKAQEEIEEFQSRENSKT---------LPNKGCKYRPQRPRFRKLEKQPEYKGGN  369 (1373)
T ss_pred             -ceeEEEecCCCcccccccchhhhhhhHHHHHHHHhhhhcccc---------CCCCccccCccchhHHHhhcCccccccc
Confidence             9999999999999999999998865 5667888876532211         1112223345567899999999999999


Q ss_pred             CCchHHHHHHHHHHHhhcCCCceEEEcCCCCcHHHHHHHHHHHHhcCC--CCceEEEeccccHHHHHHHHHHHcCCCeEE
Q 002937          285 SLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASLFGER--ISPHLVVAPLSTLRNWEREFATWAPQMNVV  362 (864)
Q Consensus       285 ~L~~yQ~~~v~~l~~~~~~~~~~ILade~GlGKTi~ai~~i~~l~~~~--~~~~LIV~P~sll~qW~~E~~~~~p~~~~~  362 (864)
                      +||+||++|+|||.+.|+++.+||||||||||||+|+++|+.+|+...  .||+|||||+|++.+|++||..|+ +++++
T Consensus       370 ~LRdyQLeGlNWl~~~W~~~~n~ILADEmgLgktvqti~fl~~l~~~~~~~gpflvvvplst~~~W~~ef~~w~-~mn~i  448 (1373)
T KOG0384|consen  370 ELRDYQLEGLNWLLYSWYKRNNCILADEMGLGKTVQTITFLSYLFHSLQIHGPFLVVVPLSTITAWEREFETWT-DMNVI  448 (1373)
T ss_pred             hhhhhhcccchhHHHHHHhcccceehhhcCCCcchHHHHHHHHHHHhhhccCCeEEEeehhhhHHHHHHHHHHh-hhcee
Confidence            999999999999999999999999999999999999999999998754  689999999999999999999999 99999


Q ss_pred             EEecChHHHHHHHHhhhcCCCCchhhhcccCCccccccccccCCCcEEEccHHHHHhcccccCCcceeEEEecccccccC
Q 002937          363 MYVGTSQARNIIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKN  442 (864)
Q Consensus       363 ~~~g~~~~r~~i~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvitty~~~~~~~~~l~~~~w~~vIvDEaH~lkn  442 (864)
                      +|+|+..+|..|++|||++....                 ...+|+++||||+++.+|...|..++|.+++|||||||||
T Consensus       449 ~y~g~~~sr~~i~~ye~~~~~~~-----------------~~lkf~~lltTye~~LkDk~~L~~i~w~~~~vDeahrLkN  511 (1373)
T KOG0384|consen  449 VYHGNLESRQLIRQYEFYHSSNT-----------------KKLKFNALLTTYEIVLKDKAELSKIPWRYLLVDEAHRLKN  511 (1373)
T ss_pred             eeecchhHHHHHHHHHheecCCc-----------------cccccceeehhhHHHhccHhhhccCCcceeeecHHhhcCc
Confidence            99999999999999999976642                 2468999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHhcccccEEEeecCCCCCCHhHHHhhhhhcCCCCCCChHHHHHHHhccchHHHHHHHHHHHhHHHHHHHHh
Q 002937          443 KDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKK  522 (864)
Q Consensus       443 ~~s~~~~~l~~l~~~~rllLTgTP~~n~~~el~~ll~~l~p~~~~~~~~f~~~~~~~~~~~~~~~L~~~l~~~~lrr~k~  522 (864)
                      ..++++..|..+...||||+||||+||++.|||+|+|||.|+.|.+..+|...| +..++.++..|+..|+|+|+||.++
T Consensus       512 ~~~~l~~~l~~f~~~~rllitgTPlQNsikEL~sLl~Fl~P~kf~~~~~f~~~~-~~~~e~~~~~L~~~L~P~~lRr~kk  590 (1373)
T KOG0384|consen  512 DESKLYESLNQFKMNHRLLITGTPLQNSLKELWSLLHFLMPGKFDSWDEFLEEF-DEETEEQVRKLQQILKPFLLRRLKK  590 (1373)
T ss_pred             hHHHHHHHHHHhcccceeeecCCCccccHHHHHHHhcccCCCCCCcHHHHHHhh-cchhHHHHHHHHHHhhHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999999 7888999999999999999999999


Q ss_pred             hHhhcCCCcEEEEEEecCCHHHHHHHHHHHHHHHHHHHhcC-CCcchHHHHHHHHHHHhCcccccCCCCCCccC------
Q 002937          523 DVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRG-GAQISLINVVMELRKLCCHPYMLEGVEPDIED------  595 (864)
Q Consensus       523 dv~~~lp~~~~~~v~v~ls~~q~~~Y~~i~~~~~~~l~~~~-~~~~~~~~~~~~lrk~~~hp~l~~~~~~~~~~------  595 (864)
                      ||.+.||++.+.++.|+||+.|+++|++|+++|+..|.++. ++..+++|++|+||||||||||+.+.+.....      
T Consensus       591 dvekslp~k~E~IlrVels~lQk~yYk~ILtkN~~~LtKG~~g~~~~lLNimmELkKccNHpyLi~gaee~~~~~~~~~~  670 (1373)
T KOG0384|consen  591 DVEKSLPPKEETILRVELSDLQKQYYKAILTKNFSALTKGAKGSTPSLLNIMMELKKCCNHPYLIKGAEEKILGDFRDKM  670 (1373)
T ss_pred             hhccCCCCCcceEEEeehhHHHHHHHHHHHHhhHHHHhccCCCCCchHHHHHHHHHHhcCCccccCcHHHHHHHhhhhcc
Confidence            99999999999999999999999999999999999998764 44578999999999999999999988765433      


Q ss_pred             chHHHHHhhhcccHHHHHHHHHHHHHHcCceEEEEeccHHHHHHHHHHHhhCCCcEEEEeccCCHHHHHHHHHHhcCCCC
Q 002937          596 TNESFKQLLESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNS  675 (864)
Q Consensus       596 ~~~~~~~l~~~s~Kl~~l~~ll~~l~~~g~kvlIFsq~~~~ld~L~~~L~~~g~~~~~i~G~~~~~~R~~~i~~Fn~~~~  675 (864)
                      .++.+..++.+|||+.+|++||.+|++.||||||||||+.|||+|++||..+||+|.||||++.++.|+++|++||++++
T Consensus       671 ~d~~L~~lI~sSGKlVLLDKLL~rLk~~GHrVLIFSQMVRmLDIL~eYL~~r~ypfQRLDGsvrgelRq~AIDhFnap~S  750 (1373)
T KOG0384|consen  671 RDEALQALIQSSGKLVLLDKLLPRLKEGGHRVLIFSQMVRMLDILAEYLSLRGYPFQRLDGSVRGELRQQAIDHFNAPDS  750 (1373)
T ss_pred             hHHHHHHHHHhcCcEEeHHHHHHHHhcCCceEEEhHHHHHHHHHHHHHHHHcCCcceeccCCcchHHHHHHHHhccCCCC
Confidence            34688999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEeeccccccCcCCCCCCEEEEeCCCCCcchhhHHHHHHHHhCCCCcEEEEEEEeCCCHHHHHHHHHHHhhhHHHH
Q 002937          676 SRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHL  755 (864)
Q Consensus       676 ~~~v~Llst~a~~~GinL~~a~~VI~~d~~wnp~~~~Qa~gR~~RiGQ~~~V~Vy~lv~~~TiEe~i~~~~~~K~~l~~~  755 (864)
                      .+||||+||||||.||||++||||||||+||||++++||++|||||||++.|.||||||++||||.|+++|++||.|+++
T Consensus       751 ddFvFLLSTRAGGLGINLatADTVIIFDSDWNPQNDLQAqARaHRIGQkk~VnVYRLVTk~TvEeEilERAk~KmvLD~a  830 (1373)
T KOG0384|consen  751 DDFVFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKKHVNVYRLVTKNTVEEEILERAKLKMVLDHA  830 (1373)
T ss_pred             CceEEEEecccCcccccccccceEEEeCCCCCcchHHHHHHHHHhhcccceEEEEEEecCCchHHHHHHHHHHHhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhhhhh-------hcCCCHHHHHHHHhhchhhhcccccccCCCcccCCCCHHHHHHHhcCCCCCCccccCCccchhhhhc
Q 002937          756 VVGRLK-------AQNINQEELDDIIRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDGFLK  828 (864)
Q Consensus       756 v~~~~~-------~~~~~~~~l~~ll~~g~~~l~~~~~~~~~~~~~~~~~~~~~d~~l~~~~~~~~~~~~~~~~~~~~~~  828 (864)
                      |++.|.       .+.++++||.+||++||+++|.++++++.     .+++++||+||.|+...+++.++ -..++++++
T Consensus       831 VIQ~m~t~~~~s~~~~f~K~ELsaILKfGA~~lfke~ene~s-----~~~e~DIDeIL~rae~~~t~~~~-~~~a~e~ls  904 (1373)
T KOG0384|consen  831 VIQRMDTKGKTSKSNPFSKEELSAILKFGAYELFKEEENEES-----KFCEMDIDEILERAETRITEESD-FMKASELLS  904 (1373)
T ss_pred             HHHhhccccccCCCCCCCHHHHHHHHHhchHHhhhccccccc-----cccccCHHHHHhhcccccccccc-cchhHHHHh
Confidence            998775       35689999999999999999999876654     46789999999999877666443 356889999


Q ss_pred             ccccchhhh
Q 002937          829 AFKVLSSII  837 (864)
Q Consensus       829 ~~~~~~~~~  837 (864)
                      +|+||++.+
T Consensus       905 ~fkvad~~~  913 (1373)
T KOG0384|consen  905 QFKVADIKA  913 (1373)
T ss_pred             hcccccccc
Confidence            999999987

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF01393 Chromo_shadow: Chromo shadow domain Web page maintained by Rein Aasland; InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>smart00300 ChSh Chromo Shadow Domain Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 1e-145
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 3e-60
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 6e-60
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 2e-57
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 3e-19
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 3e-09
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 3e-09
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 4e-09
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-08
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 3e-08
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 6e-08
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 1e-07
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 2e-07
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 9e-07
2ysm_A111 Solution Structure Of The First And Second Phd Doma 1e-06
1f62_A51 Wstf-Phd Length = 51 3e-06
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 1e-05
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 2e-05
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 2e-05
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 2e-05
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 3e-05
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 4e-05
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 4e-05
2b2t_A187 Tandem Chromodomains Of Human Chd1 Complexed With H 1e-04
2b2u_A187 Tandem Chromodomains Of Human Chd1 Complexed With H 3e-04
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 4e-04
4gnd_A107 Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains 6e-04
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score =  514 bits (1323), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 292/705 (41%), Positives = 414/705 (58%), Gaps = 81/705 (11%)
Query: 132 QYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLR--TKVNNFHRQMSSNNNAEEDFVAIRP 189
           ++L+KW   S+LH TW       + ++S  ++R   +++N+ +Q       E+  V + P
Sbjct: 73  EFLIKWTDESHLHNTW-------ETYESIGQVRGLKRLDNYCKQFI----IEDQQVRLDP 121
Query: 190 EWTTVD----------------------RILACRGEDDEK-----EYLVKYKELSYDECY 222
             T  D                      RI+  +    E      +YLVK++ L+YDE  
Sbjct: 122 YVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT 181
Query: 223 WEYESDISAFQPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLS 282
           WE  +DI    PE           H  +    K  PQ  +  T +   F++    P F+ 
Sbjct: 182 WENATDIVKLAPE--------QVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIK 233
Query: 283 GGSLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIAFLASL-FGERIS-PHLVVA 340
           GG L  +QL G+N++ F WSK  + ILADEMGLGKT+Q++AF++ L F  R + PH++V 
Sbjct: 234 GGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVV 293
Query: 341 PLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPXXXXXXXXXXXXXXXXXX 400
           PLST+  W   F  WAP +N + Y+G  ++R+ IREYEFY                    
Sbjct: 294 PLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFY--------------TNPRAK 339
Query: 401 XQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRV 460
            +  +KF+VLLT+YE I  D A L  IKWQ M VDE HRLKN +S L+ SL  +   +R+
Sbjct: 340 GKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRM 399
Query: 461 LLTGTPLQNNLDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRV 520
           L+TGTPLQNN+ EL  L++FL  G+F   +E   E +D  QEE I  LHR + P +LRR+
Sbjct: 400 LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRL 459
Query: 521 KKDVMKELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRG-GAQISLINVVMELRKL 579
           KKDV K LP K E ILRVELS  Q EYYK ILT+NY  LT    G   SL+N++ EL+K 
Sbjct: 460 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKA 519
Query: 580 CCHPYMLEGVEP-------DIEDTNES-FKQLLESSGKLQLLDKMMVKLKEQGHRVLIYS 631
             HPY+ +  E        D + T E+  + L+ SSGK+ LLD+++ +LK+ GHRVLI+S
Sbjct: 520 SNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFS 579
Query: 632 QFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGI 691
           Q   MLD+L DYL+ K   ++R+DG V  A+R+I ID FN+ +S+ F FLLSTRAGGLGI
Sbjct: 580 QMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGI 639
Query: 692 NLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMV 751
           NL TADTV+I+DSDWNP ADLQAMARAHR+GQ N VM++RL+++ ++EE +++  +KKM+
Sbjct: 640 NLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 699
Query: 752 LEHLVVG--------RLKAQNINQEELDDIIRYGSKELFADENDE 788
           LE+ ++           K    N  EL  I+++G+  +F   +++
Sbjct: 700 LEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQ 744
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|2B2T|A Chain A, Tandem Chromodomains Of Human Chd1 Complexed With Histone H3 Tail Containing Trimethyllysine 4 And Phosphothreonine 3 Length = 187 Back     alignment and structure
>pdb|2B2U|A Chain A, Tandem Chromodomains Of Human Chd1 Complexed With Histone H3 Tail Containing Trimethyllysine 4 And Dimethylarginine 2 Length = 187 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 0.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 0.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-140
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-83
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 5e-76
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 2e-74
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 2e-22
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 1e-21
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-20
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 9e-20
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-19
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 8e-19
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 8e-19
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 9e-19
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 5e-18
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 6e-17
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 4e-04
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 1e-15
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-15
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-14
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-14
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-05
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 1e-14
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 5e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 2e-14
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-14
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-14
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-11
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 5e-14
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 7e-14
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 8e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-13
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-07
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-12
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 5e-12
2yt5_A66 Metal-response element-binding transcription facto 1e-10
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 2e-10
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 5e-09
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 6e-09
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-08
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 2e-08
2k16_A75 Transcription initiation factor TFIID subunit 3; p 3e-08
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 2e-07
1we9_A64 PHD finger family protein; structural genomics, PH 3e-07
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 7e-07
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 2e-06
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 3e-06
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 2e-04
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 9e-06
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 2e-05
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 9e-05
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 1e-04
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 1e-04
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 9e-04
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 2e-04
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 6e-04
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 2e-04
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 4e-04
1pfb_A55 Polycomb protein; chromatin, histone methylation, 2e-04
1pfb_A55 Polycomb protein; chromatin, histone methylation, 3e-04
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 2e-04
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 4e-04
3h91_A54 Chromobox protein homolog 2; human chromobox homol 3e-04
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-04
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 4e-04
2kvm_A74 Chromobox protein homolog 7; histone modification, 7e-04
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 7e-04
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 8e-04
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 8e-04
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 8e-04
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  939 bits (2430), Expect = 0.0
 Identities = 297/779 (38%), Positives = 431/779 (55%), Gaps = 74/779 (9%)

Query: 98  PLNDIDKILDCEMRPTVAGDSDVSKLGSKQIF---VKQYLVKWKGLSYLHCTWVPEKEFL 154
             + ID +++  ++ ++     + K            ++L+KW   S+LH TW    E +
Sbjct: 36  DFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETY-ESI 94

Query: 155 KAFKSNPRLRTKVNNFHRQMSSNNNAE--------------EDFVAIRPEWTTVDRILAC 200
              +   RL      F  +                      E  +    E+   +RI+  
Sbjct: 95  GQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDS 154

Query: 201 R-----GEDDEKEYLVKYKELSYDECYWEYESDIS-AFQPEIERFIKIQSRSHRSSCNKQ 254
           +         + +YLVK++ L+YDE  WE  +DI      +++ F   ++          
Sbjct: 155 QRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENS--------- 205

Query: 255 KSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADEMG 314
           K  PQ  +  T +   F++    P F+ GG L  +QL G+N++ F WSK  + ILADEMG
Sbjct: 206 KILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMG 265

Query: 315 LGKTIQSIAFLASLFGER--ISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARN 372
           LGKT+Q++AF++ L   R    PH++V PLST+  W   F  WAP +N + Y+G  ++R+
Sbjct: 266 LGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRD 325

Query: 373 IIREYEFYFPKNPKKVKKKKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCM 432
            IREYEFY     K  K               +KF+VLLT+YE I  D A L  IKWQ M
Sbjct: 326 TIREYEFYTNPRAKGKK--------------TMKFNVLLTTYEYILKDRAELGSIKWQFM 371

Query: 433 IVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNNLDELFMLMHFLDAGKFGSLEEF 492
            VDE HRLKN +S L+ SL  +   +R+L+TGTPLQNN+ EL  L++FL  G+F   +E 
Sbjct: 372 AVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEI 431

Query: 493 QEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKAIL 552
             E +D  QEE I  LHR + P +LRR+KKDV K LP K E ILRVELS  Q EYYK IL
Sbjct: 432 DFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNIL 491

Query: 553 TRNYQILTRRG-GAQISLINVVMELRKLCCHPYMLEGVEPDI--------EDTNESFKQL 603
           T+NY  LT    G   SL+N++ EL+K   HPY+ +  E  +               + L
Sbjct: 492 TKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGL 551

Query: 604 LESSGKLQLLDKMMVKLKEQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAER 663
           + SSGK+ LLD+++ +LK+ GHRVLI+SQ   MLD+L DYL+ K   ++R+DG V  A+R
Sbjct: 552 IMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQR 611

Query: 664 QIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQ 723
           +I ID FN+ +S+ F FLLSTRAGGLGINL TADTV+I+DSDWNP ADLQAMARAHR+GQ
Sbjct: 612 RISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQ 671

Query: 724 TNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGR--------LKAQNINQEELDDIIR 775
            N VM++RL+++ ++EE +++  +KKM+LE+ ++           K    N  EL  I++
Sbjct: 672 KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILK 731

Query: 776 YGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDDEDEDG--FLKAFKV 832
           +G+  +F   +++         +D  +D +L+  +       L +    G  FLK F+V
Sbjct: 732 FGAGNMFTATDNQ------KKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEV 784
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Length = 177 Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Length = 187 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Length = 115 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Length = 64 Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Length = 64 Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 72 Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 72 Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} PDB: 3gv6_A* 3i90_A* Length = 54 Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} PDB: 3gv6_A* 3i90_A* Length = 54 Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 55 Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 55 Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Length = 55 Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Length = 55 Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} PDB: 2k28_A 3i8z_A Length = 54 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} PDB: 3r93_A* 3svm_A* 3qo2_A* Length = 62 Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Length = 74 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Length = 73 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Length = 73 Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Length = 59 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.96
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.96
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.96
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.96
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.96
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.95
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.95
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.95
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.95
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.94
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.93
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.93
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.93
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.92
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.92
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.91
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.9
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.9
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.89
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.88
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.88
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.88
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.87
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 99.87
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.86
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 99.85
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.82
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.77
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.77
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.76
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.74
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.74
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.73
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.72
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.72
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.72
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.72
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.72
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.71
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.7
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.69
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.69
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.68
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.68
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.67
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.66
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.66
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.65
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.44
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.63
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.63
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.6
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.59
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.58
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.57
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.57
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.56
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.54
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.54
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.53
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.52
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.52
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 99.52
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.5
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.5
3bor_A237 Human initiation factor 4A-II; translation initiat 99.48
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.47
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.45
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.44
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.43
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 99.43
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.41
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.38
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.38
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.38
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.36
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.36
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.36
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.29
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.26
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.25
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.25
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.22
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.18
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.16
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.15
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.14
2yt5_A66 Metal-response element-binding transcription facto 99.13
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.13
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.12
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.06
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.06
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.06
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.97
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.97
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.95
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.91
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.86
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 98.86
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.83
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 98.8
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 98.8
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 98.78
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.76
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 98.73
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 98.73
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 98.72
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 98.7
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.69
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 98.69
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 98.69
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 98.68
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.68
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 98.67
1weu_A91 Inhibitor of growth family, member 4; structural g 98.66
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.65
1pfb_A55 Polycomb protein; chromatin, histone methylation, 98.64
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.64
3h91_A54 Chromobox protein homolog 2; human chromobox homol 98.64
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 98.63
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.62
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.61
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 98.61
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.6
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 98.6
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 98.6
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 98.59
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.57
2kvm_A74 Chromobox protein homolog 7; histone modification, 98.57
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.49
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 98.46
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.46
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 98.43
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 98.37
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 98.35
3h91_A54 Chromobox protein homolog 2; human chromobox homol 98.32
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 98.31
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 98.3
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 98.28
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 98.28
1pfb_A55 Polycomb protein; chromatin, histone methylation, 98.27
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 98.25
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 98.22
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 98.21
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 98.2
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 98.2
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 98.19
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 98.18
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 98.17
1wil_A89 KIAA1045 protein; ring finger domain, structural g 98.15
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.14
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 98.13
2kvm_A74 Chromobox protein homolog 7; histone modification, 98.13
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 98.13
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 98.06
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.99
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.98
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.97
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 97.92
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 97.89
1we9_A64 PHD finger family protein; structural genomics, PH 97.82
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 97.78
1wee_A72 PHD finger family protein; structural genomics, PH 97.67
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.66
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.65
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.57
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.56
1wem_A76 Death associated transcription factor 1; structura 97.51
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.45
1wew_A78 DNA-binding family protein; structural genomics, P 97.39
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.34
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 97.29
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.26
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.24
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.22
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 97.2
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.19
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.11
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.1
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.06
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 97.02
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.0
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.99
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.72
3kv5_D488 JMJC domain-containing histone demethylation prote 96.54
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.42
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.1
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.1
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 95.93
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 95.86
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 95.79
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.74
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 95.6
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 95.36
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.25
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.16
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 94.93
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 94.89
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.88
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 94.79
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.7
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 94.5
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 94.43
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.39
3p7j_A87 Heterochromatin protein 1; chromo shadow domain, g 94.3
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 94.25
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.95
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.93
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 93.92
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 93.71
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.25
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.18
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.06
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.97
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.13
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.03
3bos_A242 Putative DNA replication factor; P-loop containing 91.8
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.36
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.33
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.29
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 90.02
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 89.95
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 89.88
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 89.73
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 89.68
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 89.38
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 89.33
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 89.2
2chq_A319 Replication factor C small subunit; DNA-binding pr 88.33
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 88.32
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 88.31
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 87.26
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.25
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 86.8
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 86.59
2v1u_A387 Cell division control protein 6 homolog; DNA repli 86.52
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 85.47
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 85.33
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 85.25
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 85.23
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 85.23
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 83.94
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 83.63
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 83.26
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 82.87
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 82.22
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 82.22
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 81.32
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 80.86
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 80.85
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 80.68
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 80.62
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 80.35
3pvs_A447 Replication-associated recombination protein A; ma 80.22
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.7e-109  Score=1011.52  Aligned_cols=704  Identities=41%  Similarity=0.703  Sum_probs=561.8

Q ss_pred             cccccccccccccCccCCCCc---ccccccchhheeeeeeecCCccccccccChHHHHHHhhcChhHHHHHHhHHhhhcc
Q 002937          100 NDIDKILDCEMRPTVAGDSDV---SKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFLKAFKSNPRLRTKVNNFHRQMSS  176 (864)
Q Consensus       100 ~~~~kil~~r~~p~~~~~~~~---~~~~~~~~~~~eylVKw~~~S~~h~~W~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  176 (864)
                      ..||+||++|.++........   .+.........||||||+|+||+||||+|+++|.+    .++.+ ++.+|.++...
T Consensus        38 ~~ve~vl~~r~~~~~~~~~~~~~~~~~~~~~~~~~eylvKWkg~s~~hntWe~~e~L~~----~~~~~-~~~~~~k~~~~  112 (800)
T 3mwy_W           38 HGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQ----VRGLK-RLDNYCKQFII  112 (800)
T ss_dssp             CBCSEEEEEECCCC--------CCSCCHHHHHHHCEEEEECSSSCTTSCEEECHHHHCS----CBTTH-HHHHHHHHHTH
T ss_pred             CchhhhccccccccccCCccccccCcCcCCCcCceEEEEEeCCcceeeccccCHHHHhh----cchHH-HHHHHHHHhhh
Confidence            468999999886433222111   11111123458999999999999999999999863    34443 67777765321


Q ss_pred             --------CCCCchh----------hhhcCCccchhhhHhhhhc-----CCccceeeeeeccccccccccccCCCCCc-c
Q 002937          177 --------NNNAEED----------FVAIRPEWTTVDRILACRG-----EDDEKEYLVKYKELSYDECYWEYESDISA-F  232 (864)
Q Consensus       177 --------~~~~~~~----------~~~~~~~~~~verIi~~~~-----~~~~~~ylVKW~~l~y~~~tWe~~~~~~~-~  232 (864)
                              +....++          .....++|++|||||+++.     ..++.+|||||++|||++||||....+.. .
T Consensus       113 ~~~~~~~~~~~~~e~~e~~~~~~e~~~~~~~~~~~veRii~~~~~~~~~~~~~~~yLvKW~~L~y~~~tWe~~~~~~~~~  192 (800)
T 3mwy_W          113 EDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLA  192 (800)
T ss_dssp             HHHHHTCSTTSCHHHHHHHHHHHHHHHHHHTTTTCEEEECCCCCEECTTSCEECBCCEEETTSCSTTCBCCBHHHHTTTC
T ss_pred             HHHHHhcCCCCCHHHHHHHhhhhhhhccccccccceeEEEeecccccCCCCCceEEEEEecCCCcccccccchhhhhhhh
Confidence                    1111121          1223478999999999986     55678999999999999999998776543 4


Q ss_pred             HHHHHHHHHHhhhccccccCccCCCCcccccccCCCccccccccCCCCCCCCCCchHHHHHHHHHHHhhcCCCceEEEcC
Q 002937          233 QPEIERFIKIQSRSHRSSCNKQKSSPQDVTESTKKPKEFQQYEHSPEFLSGGSLHPYQLEGLNFLRFSWSKQTHVILADE  312 (864)
Q Consensus       233 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~L~~yQ~~~v~~l~~~~~~~~~~ILade  312 (864)
                      ++.++.|..+.......  .       ...........|.++..+|.+..+++|||||++||+||.+.+.++.+|||||+
T Consensus       193 ~~~i~~~~~r~~~~~~~--~-------~~~~~~~~~~~~~~~~~~p~~~~~~~Lr~yQ~egv~~l~~~~~~~~~~ILade  263 (800)
T 3mwy_W          193 PEQVKHFQNRENSKILP--Q-------YSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADE  263 (800)
T ss_dssp             HHHHHHHHHTTTCTTCS--T-------TCCCCCSCCCCCCCCSSCCTTCCSSCCCTHHHHHHHHHHHHHTTTCCEEECCC
T ss_pred             HHHHHHHHHhhhcccCC--c-------chhcccccCCcccccccCCCccCCCCcCHHHHHHHHHHHHHhhcCCCEEEEeC
Confidence            66788887643221110  0       00011122345778888999998999999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHHHhc--CCCCceEEEeccccHHHHHHHHHHHcCCCeEEEEecChHHHHHHHHhhhcCCCCchhhhc
Q 002937          313 MGLGKTIQSIAFLASLFG--ERISPHLVVAPLSTLRNWEREFATWAPQMNVVMYVGTSQARNIIREYEFYFPKNPKKVKK  390 (864)
Q Consensus       313 ~GlGKTi~ai~~i~~l~~--~~~~~~LIV~P~sll~qW~~E~~~~~p~~~~~~~~g~~~~r~~i~~~e~~~~~~~~~~~~  390 (864)
                      ||+|||+|+++++.+++.  ...+|+|||||.+++.||.+||.+|+|++++++|+|....+..++.++++......    
T Consensus       264 mGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~~~~~~----  339 (800)
T 3mwy_W          264 MGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAK----  339 (800)
T ss_dssp             TTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHHHHHHSTTCCEEECCCSSHHHHHHHHHHSCSCC-------
T ss_pred             CCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHHHHHHCCCceEEEEeCCHHHHHHHHHHHhhcccccc----
Confidence            999999999999988753  34569999999999999999999999999999999999999999988876533211    


Q ss_pred             ccCCccccccccccCCCcEEEccHHHHHhcccccCCcceeEEEecccccccCcccHHHHHHHhcccccEEEeecCCCCCC
Q 002937          391 KKSGQVVSESKQDRIKFDVLLTSYEMINLDSASLKPIKWQCMIVDEGHRLKNKDSKLFSSLKQYSTRHRVLLTGTPLQNN  470 (864)
Q Consensus       391 ~~~~~~~~~~~~~~~~~~vvitty~~~~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~~~l~~l~~~~rllLTgTP~~n~  470 (864)
                                .....+++|+||||+++.++...+..++|++|||||||++||..++.++++..+.+.+||+|||||++|+
T Consensus       340 ----------~~~~~~~dvvitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~~~l~~l~~~~rl~LTgTPiqN~  409 (800)
T 3mwy_W          340 ----------GKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNN  409 (800)
T ss_dssp             ------------CCCCCSEEEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCCSSC
T ss_pred             ----------ccccccCCEEEecHHHHHhhHHHHhcCCcceeehhhhhhhcCchhHHHHHHHHhhhccEEEeeCCcCCCC
Confidence                      1223578999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHhhhhhcCCCCCCChHHHHHHHhccchHHHHHHHHHHHhHHHHHHHHhhHhhcCCCcEEEEEEecCCHHHHHHHHH
Q 002937          471 LDELFMLMHFLDAGKFGSLEEFQEEFKDINQEEQISRLHRMLAPHLLRRVKKDVMKELPPKKELILRVELSSKQKEYYKA  550 (864)
Q Consensus       471 ~~el~~ll~~l~p~~~~~~~~f~~~~~~~~~~~~~~~L~~~l~~~~lrr~k~dv~~~lp~~~~~~v~v~ls~~q~~~Y~~  550 (864)
                      +.|||++++||.|+.|.....|............+..|+.++.|+++||++.++...+|++.+.++.|+|++.|+.+|+.
T Consensus       410 l~el~~ll~fL~p~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~p~~lRR~k~dv~~~LP~k~~~~v~v~ls~~q~~~Y~~  489 (800)
T 3mwy_W          410 IKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKN  489 (800)
T ss_dssp             SHHHHHHHHHHCSCCC---------CCTTHHHHHHHHHHHTTGGGEEECCGGGGTTTSCCEEEEEEEECCCHHHHHHHHH
T ss_pred             HHHHHHHHHHhCccccCchhhhcccccchhHHHHHHHHHHHHhHHHhhhhHHhhhhccCCcEEEEEEeCCCHHHHHHHHH
Confidence            99999999999999998877776554444556778899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhc-CCCcchHHHHHHHHHHHhCcccccCCCCC--------CccCchHHHHHhhhcccHHHHHHHHHHHHH
Q 002937          551 ILTRNYQILTRR-GGAQISLINVVMELRKLCCHPYMLEGVEP--------DIEDTNESFKQLLESSGKLQLLDKMMVKLK  621 (864)
Q Consensus       551 i~~~~~~~l~~~-~~~~~~~~~~~~~lrk~~~hp~l~~~~~~--------~~~~~~~~~~~l~~~s~Kl~~l~~ll~~l~  621 (864)
                      ++.++...+... .+...+++++++.||++|+||+++...+.        ...........++..|+|+.+|.++|..+.
T Consensus       490 i~~~~~~~l~~~~~~~~~~~l~~l~~Lrk~~~hp~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~s~K~~~L~~lL~~~~  569 (800)
T 3mwy_W          490 ILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLK  569 (800)
T ss_dssp             HHHHCCC----------CTHHHHHHHHHHHHHCGGGSSSHHHHHCCCC----CCSHHHHHHHHHTCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHhhccccchhhHHHHHHHHHHHhcChhhhcchHHHHHHhcccccccHHHHHHHhhhcChHHHHHHHHHHHHh
Confidence            988766555432 33456789999999999999999865322        122344556778889999999999999999


Q ss_pred             HcCceEEEEeccHHHHHHHHHHHhhCCCcEEEEeccCCHHHHHHHHHHhcCCCCCceEEEeeccccccCcCCCCCCEEEE
Q 002937          622 EQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAGGLGINLATADTVII  701 (864)
Q Consensus       622 ~~g~kvlIFsq~~~~ld~L~~~L~~~g~~~~~i~G~~~~~~R~~~i~~Fn~~~~~~~v~Llst~a~~~GinL~~a~~VI~  701 (864)
                      +.|+|+|||||++.++++|+++|...|+++.+++|+++..+|++++++|+++++..++||+||++||+||||++|++||+
T Consensus       570 ~~g~kvLIFsq~~~~ld~L~~~L~~~g~~~~~i~G~~~~~eR~~~i~~F~~~~~~~~v~LlSt~agg~GlNL~~a~~VI~  649 (800)
T 3mwy_W          570 KDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVI  649 (800)
T ss_dssp             TTTCCEEEEESCHHHHHHHHHHHHHHTCCCEEESTTSCHHHHHHHHHTTSSTTCSCCCEEEEHHHHTTTCCCTTCCEEEE
T ss_pred             hCCCeEEEEechHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHhhCCCCCceEEEEecccccCCCCccccceEEE
Confidence            99999999999999999999999999999999999999999999999999988888889999999999999999999999


Q ss_pred             eCCCCCcchhhHHHHHHHHhCCCCcEEEEEEEeCCCHHHHHHHHHHHhhhHHHHHhhhhh--------hcCCCHHHHHHH
Q 002937          702 YDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKKKMVLEHLVVGRLK--------AQNINQEELDDI  773 (864)
Q Consensus       702 ~d~~wnp~~~~Qa~gR~~RiGQ~~~V~Vy~lv~~~TiEe~i~~~~~~K~~l~~~v~~~~~--------~~~~~~~~l~~l  773 (864)
                      ||++|||+.++||+||+||+||+++|.||+|++++|+||+|++++.+|+.+.+++++.+.        ...++.+++.+|
T Consensus       650 ~D~~wnp~~~~Qa~gR~~RiGQ~k~V~Vyrlv~~~TiEe~i~~~~~~K~~l~~~vi~~~~~~~~~~~~~~~~~~~el~~l  729 (800)
T 3mwy_W          650 FDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAI  729 (800)
T ss_dssp             SSCCSCSHHHHHHHTTTSCSSCCSCEEEEEEEETTSHHHHHHHHHHHHTTSCC----------------CCCCHHHHHHH
T ss_pred             ecCCCChhhHHHHHHHHHhcCCCceEEEEEEecCCCHHHHHHHHHHHHHHHHHHHHccCcccccccccccCCCHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999996542        246789999999


Q ss_pred             HhhchhhhcccccccCCCcccCCCCHHHHHHHhcCCCCCCccccCCc--cchhhhhcccccchhhh
Q 002937          774 IRYGSKELFADENDEGGKSRQIHYDDAAIDRLLDRDQVGDEEASLDD--EDEDGFLKAFKVLSSII  837 (864)
Q Consensus       774 l~~g~~~l~~~~~~~~~~~~~~~~~~~~~d~~l~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~  837 (864)
                      |++|+..+|.+.+.+      ..+.+++||.||+|+....+..++..  ..+++|+++|+|+++..
T Consensus       730 l~~g~~~~~~~~~~~------~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  789 (800)
T 3mwy_W          730 LKFGAGNMFTATDNQ------KKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKA  789 (800)
T ss_dssp             HSSCSSSSCCSHHHH------HHHHTCCHHHHHHHCEECCCSCCCCCCEESCHHHHHTTC------
T ss_pred             HHcchHhhhhccCcc------ccccccCHHHHHHhhhhccccccccccccchHHHHhhceeeeccc
Confidence            999999999876531      12456789999999987776654432  34688999999999864
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Back     alignment and structure
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 864
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 1e-49
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 4e-38
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 4e-35
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 4e-29
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 8e-25
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-20
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-15
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-14
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-13
d2dy7a181 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 2e-12
d2dy7a181 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 2e-05
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 9e-12
d2dy8a169 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 6e-11
d2dy8a169 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 2e-08
d2b2ya180 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 3e-10
d2b2ya180 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 4e-05
d2b2ya295 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( 2e-09
d2b2ya295 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( 0.002
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 3e-09
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 7e-09
d1g6za_70 b.34.13.2 (A:) Histone methyltransferase clr4, chr 9e-09
d1g6za_70 b.34.13.2 (A:) Histone methyltransferase clr4, chr 2e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-08
d2dnta166 b.34.13.2 (A:8-73) Chromodomain protein, Y-like is 1e-08
d2dnta166 b.34.13.2 (A:8-73) Chromodomain protein, Y-like is 6e-05
d1q3la_52 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru 2e-08
d1q3la_52 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru 3e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 4e-08
d2dnva152 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo 5e-07
d2dnva152 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo 7e-05
d1guwa_73 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou 8e-07
d1guwa_73 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou 2e-04
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-05
d2huga155 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidops 3e-05
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 3e-05
d1pfba_55 b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr 4e-05
d1pfba_55 b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr 1e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 3e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.001
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 0.002
d1x3pa154 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops 0.002
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score =  176 bits (447), Expect = 1e-49
 Identities = 89/322 (27%), Positives = 154/322 (47%), Gaps = 22/322 (6%)

Query: 522 KDVM-KELPPKKELILRVELSSKQKEYYKAILTRNYQILT-RRGGAQISLINVVMELRKL 579
            D++ K LP K E ++   L+  QKE YK  L +   + + + G   +S ++ +  L+KL
Sbjct: 2   SDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKL 61

Query: 580 CCHPYML-----------EGVEPDIEDTNESFKQLLESSGKLQLLDKMMVKLK-EQGHRV 627
           C HP ++           +G          +     + SGK+ +LD ++   +     +V
Sbjct: 62  CNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKV 121

Query: 628 LIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRIDRFNAKNSSRFCFLLSTRAG 687
           ++ S +   LDL E     +++ Y R+DG +   +R   ++RFN  +S  F F+LS++AG
Sbjct: 122 VLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAG 181

Query: 688 GLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTK 747
           G G+NL  A+ ++++D DWNP  D QAMAR  R GQ     I+RL++ G+IEE+++Q   
Sbjct: 182 GCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQA 241

Query: 748 KKMVLEHLVVGRLKA--QNINQEELDDIIRYGSK------ELFADENDEGGKSRQIHYDD 799
            K  L   VV   +   ++ +  EL ++     K      + F       G+  +   DD
Sbjct: 242 HKKALSSCVVDEEQDVERHFSLGELRELFSLNEKTLSDTHDRFRCRRCVNGRQVRPPPDD 301

Query: 800 AAIDRLLDRDQVGDEEASLDDE 821
           +     L       ++  L D 
Sbjct: 302 SDCTCDLSNWHHCADKRGLRDP 323
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 55 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.89
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.82
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.79
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.78
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.77
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.76
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.76
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.73
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.71
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.69
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.66
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.64
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.58
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.57
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.49
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.4
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.36
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.35
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.32
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.25
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.21
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.18
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.18
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 99.15
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 99.14
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.13
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 99.1
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.07
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.06
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.05
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.05
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.05
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.01
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.0
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 98.97
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 98.93
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.89
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.88
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.83
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 98.82
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.81
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.8
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 98.79
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.78
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 98.77
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 98.77
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.74
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 98.7
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 98.57
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.55
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.42
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 98.4
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.34
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 98.33
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 98.31
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 98.29
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 98.28
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.18
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.17
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.17
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.16
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 98.15
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 98.12
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 98.08
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 98.06
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 98.02
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.84
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.61
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.48
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 97.41
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.35
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.34
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.21
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 96.85
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.72
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.02
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 95.67
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.31
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.05
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.76
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.67
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.01
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.87
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.86
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.85
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.76
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.69
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 91.59
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.55
d2fmma168 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 91.42
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.9
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.94
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 89.55
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.42
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 88.7
d3deoa144 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 87.46
d1okkd2207 GTPase domain of the signal recognition particle r 85.4
d2qy9a2211 GTPase domain of the signal recognition particle r 85.22
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 84.97
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.38
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 83.84
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.75
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 81.1
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 81.03
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 80.53
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.41
d1vmaa2213 GTPase domain of the signal recognition particle r 80.07
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=2.3e-44  Score=389.71  Aligned_cols=257  Identities=31%  Similarity=0.546  Sum_probs=216.6

Q ss_pred             hHh-hcCCCcEEEEEEecCCHHHHHHHHHHHHHHHHHHHhcC-CCcchHHHHHHHHHHHhCcccccCCC--------CCC
Q 002937          523 DVM-KELPPKKELILRVELSSKQKEYYKAILTRNYQILTRRG-GAQISLINVVMELRKLCCHPYMLEGV--------EPD  592 (864)
Q Consensus       523 dv~-~~lp~~~~~~v~v~ls~~q~~~Y~~i~~~~~~~l~~~~-~~~~~~~~~~~~lrk~~~hp~l~~~~--------~~~  592 (864)
                      +++ +.||||.+++|+|+||+.|+++|+.++.+......... ....+.++.++.||++||||+|+...        ...
T Consensus         3 ~vl~k~LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~~~~~~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~~~~~~~~~~   82 (346)
T d1z3ix1           3 DILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEEGFDGA   82 (346)
T ss_dssp             GGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHHCGGGSSCTTCCCHHHHHHHHHHHHHHHCTHHHHHHHHHTCTTCTTG
T ss_pred             hhhhccCCCCEEEEEEeCCCHHHHHHHHHHHHHHHHHHhhhcCCchHHHHHHHHHHHHHhCCHHHhhhhhccccccccch
Confidence            454 58999999999999999999999999876543332222 23456788999999999999985211        000


Q ss_pred             ---ccCchHHHHHhhhcccHHHHHHHHHHHHH-HcCceEEEEeccHHHHHHHHHHHhhCCCcEEEEeccCCHHHHHHHHH
Q 002937          593 ---IEDTNESFKQLLESSGKLQLLDKMMVKLK-EQGHRVLIYSQFQHMLDLLEDYLTFKKWQYERIDGKVGGAERQIRID  668 (864)
Q Consensus       593 ---~~~~~~~~~~l~~~s~Kl~~l~~ll~~l~-~~g~kvlIFsq~~~~ld~L~~~L~~~g~~~~~i~G~~~~~~R~~~i~  668 (864)
                         ..............|+|+.+|.++|..+. ..|+||||||+|+.++++|+++|...|+++.+++|+++..+|+++++
T Consensus        83 ~~~~~~~~~~~~~~~~~S~Kl~~L~~ll~~~~~~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~  162 (346)
T d1z3ix1          83 LDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVE  162 (346)
T ss_dssp             GGTSCSSCCSSSCCGGGSHHHHHHHHHHHHHHHHCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHH
T ss_pred             hhhccccccccccccccCHHHHHHHHHHHHHHHhcCCceeEEeehhhhhHHHHHHHhhhhccccccccchhHHHHHHHHH
Confidence               00000001122456999999999998875 56899999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCceEEEeeccccccCcCCCCCCEEEEeCCCCCcchhhHHHHHHHHhCCCCcEEEEEEEeCCCHHHHHHHHHHH
Q 002937          669 RFNAKNSSRFCFLLSTRAGGLGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLITRGSIEERMMQMTKK  748 (864)
Q Consensus       669 ~Fn~~~~~~~v~Llst~a~~~GinL~~a~~VI~~d~~wnp~~~~Qa~gR~~RiGQ~~~V~Vy~lv~~~TiEe~i~~~~~~  748 (864)
                      +||++....++||+++++||+||||+.|++||+||++|||..+.||+||+||+||+++|.||+|+++||+||+|++++..
T Consensus       163 ~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~rli~~~TiEe~i~~~~~~  242 (346)
T d1z3ix1         163 RFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAH  242 (346)
T ss_dssp             HHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEEEEETTSHHHHHHHHHHH
T ss_pred             hhhcccccceeeeecchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEEEEEeCCCHHHHHHHHHHH
Confidence            99998877778999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHhhhhh--hcCCCHHHHHHHHhhchh
Q 002937          749 KMVLEHLVVGRLK--AQNINQEELDDIIRYGSK  779 (864)
Q Consensus       749 K~~l~~~v~~~~~--~~~~~~~~l~~ll~~g~~  779 (864)
                      |+.+.+.|++...  ...++.+++.+||.+...
T Consensus       243 K~~l~~~v~~~~~~~~~~~~~~~l~~lf~~~~~  275 (346)
T d1z3ix1         243 KKALSSCVVDEEQDVERHFSLGELRELFSLNEK  275 (346)
T ss_dssp             HHHTSCCCCSCSSSCCCSSCHHHHHHHTCCCSS
T ss_pred             HHHHHHHHhCCchhhhhcCCHHHHHHHhcCCCc
Confidence            9999999997653  346889999998876543
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure