Citrus Sinensis ID: 002944
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 863 | 2.2.26 [Sep-21-2011] | |||||||
| O43918 | 545 | Autoimmune regulator OS=H | yes | no | 0.061 | 0.097 | 0.527 | 7e-12 | |
| Q56R14 | 1091 | E3 ubiquitin-protein liga | N/A | no | 0.118 | 0.093 | 0.314 | 1e-11 | |
| Q6E2N3 | 1163 | E3 ubiquitin-protein liga | no | no | 0.063 | 0.047 | 0.491 | 3e-11 | |
| Q9Z0E3 | 552 | Autoimmune regulator OS=M | yes | no | 0.056 | 0.088 | 0.529 | 6e-11 | |
| O15016 | 1216 | Tripartite motif-containi | no | no | 0.070 | 0.050 | 0.430 | 3e-10 | |
| Q99PP7 | 1142 | E3 ubiquitin-protein liga | no | no | 0.091 | 0.069 | 0.359 | 3e-10 | |
| Q9UPN9 | 1127 | E3 ubiquitin-protein liga | no | no | 0.091 | 0.070 | 0.359 | 3e-10 | |
| O15164 | 1050 | Transcription intermediar | no | no | 0.067 | 0.055 | 0.435 | 5e-10 | |
| Q924W6 | 1242 | Tripartite motif-containi | no | no | 0.069 | 0.048 | 0.446 | 6e-10 | |
| Q04779 | 684 | Transcriptional regulator | yes | no | 0.077 | 0.097 | 0.341 | 3e-09 |
| >sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 73.6 bits (179), Expect = 7e-12, Method: Compositional matrix adjust.
Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 2/55 (3%)
Query: 713 KENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP--GIPSGTWHCRYCMNTFQKE 765
++N+D C +C DGG+L+CCD CPRAFH+ C+S P IPSGTW C C+ +E
Sbjct: 293 QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE 347
|
Transcriptional regulator that binds to DNA as a dimer or as a tetramer, but not as a monomer. Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Functions as a transcriptional activator and promotes the expression of otherwise tissue-specific self-antigens in the thymus, which is important for self tolerance and the avoidance of autoimmune reactions. Homo sapiens (taxid: 9606) |
| >sp|Q56R14|TRI33_XENLA E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O15016|TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q99PP7|TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus GN=Trim33 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9UPN9|TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens GN=TRIM33 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q924W6|TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus GN=Trim66 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q04779|RCO1_YEAST Transcriptional regulatory protein RCO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCO1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 863 | ||||||
| 255565495 | 1042 | protein binding protein, putative [Ricin | 0.893 | 0.739 | 0.449 | 1e-179 | |
| 224106864 | 955 | predicted protein [Populus trichocarpa] | 0.610 | 0.551 | 0.538 | 1e-170 | |
| 224118454 | 973 | predicted protein [Populus trichocarpa] | 0.602 | 0.534 | 0.546 | 1e-162 | |
| 449496288 | 972 | PREDICTED: uncharacterized LOC101214170 | 0.709 | 0.629 | 0.483 | 1e-162 | |
| 449456166 | 972 | PREDICTED: uncharacterized protein LOC10 | 0.710 | 0.630 | 0.482 | 1e-160 | |
| 45935119 | 1047 | putative PHD zinc finger protein [Ipomoe | 0.910 | 0.750 | 0.412 | 1e-158 | |
| 356547147 | 1006 | PREDICTED: uncharacterized protein LOC10 | 0.842 | 0.722 | 0.429 | 1e-157 | |
| 147843889 | 848 | hypothetical protein VITISV_017668 [Viti | 0.507 | 0.516 | 0.571 | 1e-152 | |
| 334184527 | 1072 | acyl-CoA N-acyltransferase with RING/FYV | 0.641 | 0.516 | 0.500 | 1e-152 | |
| 356541962 | 981 | PREDICTED: uncharacterized protein LOC10 | 0.590 | 0.519 | 0.496 | 1e-143 |
| >gi|255565495|ref|XP_002523738.1| protein binding protein, putative [Ricinus communis] gi|223537042|gb|EEF38678.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 636 bits (1640), Expect = e-179, Method: Compositional matrix adjust.
Identities = 395/878 (44%), Positives = 515/878 (58%), Gaps = 107/878 (12%)
Query: 1 MANGTDSEEKFVVLSKIRVGLKREFEFALKVQSEICGSLGRTRARKVQSNVDSGCVLGPP 60
MANG D+ + +V +++R GLKREF FA K SEI SLGRTRA + +S GCV P
Sbjct: 1 MANGKDNNKDMLV-AEVRPGLKREFAFAFKALSEISRSLGRTRASRTRSG--GGCV-SPA 56
Query: 61 EVKKLKTYESRKKRKRQEQSVVVKETEDKREEEVKSDVFDVINERERP----IREKESKD 116
K K + +K +K ++ E+K EE V SDV ++ + E + E S
Sbjct: 57 SNNKKKRLKGKKDQK-------ARDLEEKEEENV-SDVVELGSGDEEATIGGLIESVSVS 108
Query: 117 DSENMGVGERGALMNVEEVKVVSERREEGNDEFGKVVIGVEEEKKNECDEVLMNVEENKY 176
D+E G G G ++ V+E S EE EK+NE +EVL N
Sbjct: 109 DTEING-GNNGEIVEVKENGAGSMCLEE-------------TEKRNEHEEVLKN------ 148
Query: 177 GELDGMGGSARTEEEKNECGEPVVGVEEERRNECNQVLTNVEENE---HSEVDREKAEND 233
+ EE ++ + VE+E +NE ++ + E D K E+
Sbjct: 149 ---------DQCEERRSRSLPYSMKVEDESKNESDRTCEEIVSGSVPILMEEDSRKLEDV 199
Query: 234 LIGE---VKNEFEEVVAVVEEEKKDESDRVAMDVEEVKCEEVGLGKEYEPGRV---QMEM 287
I E +NE EEV+ D+ R A ++ CEE G + + +
Sbjct: 200 TIKEEIPKRNEPEEVLG------NDDLKRYADGNDQ--CEERISGSSPNSMNIDNFENQN 251
Query: 288 DEEKKNDIERELVENGVLESSM---------VGKHSSTLCNGESNVAKSVAVDGNDEGKT 338
E KN++E+ N +LES S L N E S+ + ND K
Sbjct: 252 GEHSKNEMEKVTAMNELLESKSDMNNVNEEGTSMSSVILMNSEGGAIDSLPI--NDSTK- 308
Query: 339 VNVVVERPLRRFTRSLLQQKVELAKGSLSKDGGKRSDVTEVANDGVGGPVKQE---TVMK 395
V E+P+RRFTRSLL+ K+E+ + KD + A D G P T++K
Sbjct: 309 --VEKEKPMRRFTRSLLKPKMEIGQEYAVKD-------SSSAADDAGSPSAASNSGTMLK 359
Query: 396 PRK--VMRKFYSKLKNFLESGILEGMSVMYIRGSKVKGPGVSGLRGVVKGSGISCFCDDC 453
K +KF +KLK+ L+SGILEG V Y+RGSK +G G + L+GV+ GS I CFC C
Sbjct: 360 VWKNDTSKKFPTKLKDLLDSGILEGQQVKYMRGSKARGAGETVLQGVISGSAILCFCRSC 419
Query: 454 KGNQVVTPAVFELHAGSSNKRPPEYIYLENGKTLRDIMNVCKDSPLETLEKAVRMVLGSS 513
+GN+VVTP++FE+HAGS+NKRPPEYIYLENG TLRD+MN CK++ LETL++A+ + G S
Sbjct: 420 RGNEVVTPSIFEVHAGSANKRPPEYIYLENGNTLRDVMNACKNASLETLDEALWLSTGCS 479
Query: 514 SMKKANFCLNCRVSFSNAGVEELMLLCKSCVELKESQAGSAEIKEPLSHSSEMEPQPPSV 573
S+K + FCL CR + A M LC C+ LK+SQA P +
Sbjct: 480 SLKNSTFCLKCRGKLAEASTGRSMTLCSQCMVLKDSQASI----------------PATT 523
Query: 574 ELEESPAPSGELTDTSNRSPEPNSAQTSSHSKMKSSSV--KSHGKITRKDLRMHKLVFEE 631
+ ++ A S +P+ + SS S +K S+ KS G++T KDLRMHKLVFEE
Sbjct: 524 DTDKGYAESDVCAYRIVLTPKSHPVSKSSDSVLKCSTSRSKSQGRLTVKDLRMHKLVFEE 583
Query: 632 GGLEDGAEVGYFVRGEKFLVGYKKGFGILCTCCNSEVSPSQFEAHAGWASRRKPFQHIYT 691
L DG EV Y+ RG+K LVGYKKGFGI C+CCN+EVSPSQFEAHAGWASRRKP+ HIYT
Sbjct: 584 DVLPDGTEVAYYSRGQKLLVGYKKGFGIFCSCCNTEVSPSQFEAHAGWASRRKPYLHIYT 643
Query: 692 SNGVSLHELSIKLSLERPFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLPGIPSG 751
SNGVSLHEL+I LS R FS+ +NDDLC IC DGGDLLCCD CPRA+H DC++LP IP+G
Sbjct: 644 SNGVSLHELAISLSKSRKFSTHQNDDLCQICRDGGDLLCCDVCPRAYHKDCLALPEIPTG 703
Query: 752 TWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDPFAQMVSRCIRIVQTPDTELGGCVLCR 811
W+C++C+N FQKEKFVE+NANA AAGR+ GVDP Q+ RCIRIV+T D + GGCV CR
Sbjct: 704 RWYCKFCLNNFQKEKFVEHNANAIAAGRVAGVDPIDQITRRCIRIVKTMDADFGGCVFCR 763
Query: 812 GRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDLQ 849
G DF K FG RTV+LCDQCE+E+HVGCLKDH MEDL+
Sbjct: 764 GHDFDKI-FGPRTVLLCDQCEKEFHVGCLKDHNMEDLK 800
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224106864|ref|XP_002314310.1| predicted protein [Populus trichocarpa] gi|222850718|gb|EEE88265.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224118454|ref|XP_002331486.1| predicted protein [Populus trichocarpa] gi|222873564|gb|EEF10695.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449496288|ref|XP_004160094.1| PREDICTED: uncharacterized LOC101214170 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449456166|ref|XP_004145821.1| PREDICTED: uncharacterized protein LOC101214170 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|45935119|gb|AAS79577.1| putative PHD zinc finger protein [Ipomoea trifida] gi|117165997|dbj|BAF36299.1| hypothetical protein [Ipomoea trifida] | Back alignment and taxonomy information |
|---|
| >gi|356547147|ref|XP_003541978.1| PREDICTED: uncharacterized protein LOC100804381 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147843889|emb|CAN79441.1| hypothetical protein VITISV_017668 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|334184527|ref|NP_180365.6| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] gi|330252972|gb|AEC08066.1| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356541962|ref|XP_003539441.1| PREDICTED: uncharacterized protein LOC100803825 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 863 | ||||||
| TAIR|locus:2040550 | 1007 | AT2G36720 "AT2G36720" [Arabido | 0.273 | 0.234 | 0.607 | 3.1e-108 | |
| TAIR|locus:2147391 | 1179 | AT5G36740 [Arabidopsis thalian | 0.133 | 0.097 | 0.403 | 3.1e-20 | |
| TAIR|locus:2832118 | 1193 | AT5G36670 [Arabidopsis thalian | 0.133 | 0.096 | 0.403 | 3.3e-20 | |
| TAIR|locus:2201021 | 1138 | AT1G05380 "AT1G05380" [Arabido | 0.155 | 0.117 | 0.382 | 5.3e-18 | |
| TAIR|locus:2086395 | 1189 | ROS4 "AT3G14980" [Arabidopsis | 0.115 | 0.084 | 0.380 | 4.4e-14 | |
| UNIPROTKB|C9JFR1 | 244 | AIRE "Autoimmune regulator" [H | 0.062 | 0.221 | 0.535 | 3e-13 | |
| TAIR|locus:2168088 | 425 | AT5G59830 "AT5G59830" [Arabido | 0.171 | 0.348 | 0.331 | 3e-13 | |
| TAIR|locus:2173179 | 537 | AT5G13660 "AT5G13660" [Arabido | 0.149 | 0.240 | 0.350 | 4.3e-13 | |
| ZFIN|ZDB-GENE-071008-4 | 513 | aire "autoimmune regulator" [D | 0.146 | 0.245 | 0.335 | 8.4e-13 | |
| UNIPROTKB|E1BIC4 | 561 | AIRE "Uncharacterized protein" | 0.066 | 0.101 | 0.508 | 8e-12 |
| TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 831 (297.6 bits), Expect = 3.1e-108, Sum P(2) = 3.1e-108
Identities = 144/237 (60%), Positives = 177/237 (74%)
Query: 617 ITRKDLRMHKLVFEEGGLEDGAEVGYFVRGEKFLVGYKKGFGILCTCCNSEVSPSQFEAH 676
+ RKD +HKLVF+ GGL +G E+GY+ RG+K L GYK G GI C CC EVSPS FEAH
Sbjct: 516 LARKDQGLHKLVFDRGGLPEGTELGYYARGQKLLGGYKMGAGIYCYCCKCEVSPSLFEAH 575
Query: 677 AGWASRRKPFQHIYTSNGVSLHELSIKLSLERPFSSKENDDLCGICMDGGDLLCCDSCPR 736
AGWASRRKP+ +IYTSNGVSLHE + S R +S+ +N+DLC IC DGG+LL CDSCPR
Sbjct: 576 AGWASRRKPYFYIYTSNGVSLHEWATTFSHGRKYSANDNNDLCVICADGGNLLLCDSCPR 635
Query: 737 AFHIDCVSLPGIPSGTWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDPFAQMVSRCIRI 796
AFHI+CVSLP IP G WHC+YC N F E EYN N+ A G++EGVDP Q+ RCIR+
Sbjct: 636 AFHIECVSLPSIPRGNWHCKYCENKFTSEIAGEYNVNSSAVGQLEGVDPVDQLAGRCIRV 695
Query: 797 VQTPDTELGGCVLCRGRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDL-QVPQ 852
V+ + E GCVLC G DFC+S FG RT+I+CDQCE+EYH+GCL + DL ++P+
Sbjct: 696 VKNMEAETNGCVLCSGSDFCRSGFGPRTIIICDQCEKEYHIGCLSSQNIVDLKELPK 752
|
|
| TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JFR1 AIRE "Autoimmune regulator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168088 AT5G59830 "AT5G59830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173179 AT5G13660 "AT5G13660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071008-4 aire "autoimmune regulator" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BIC4 AIRE "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 863 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 1e-11 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| cd11726 | 127 | cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.004 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 59.8 bits (145), Expect = 1e-11
Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 7/49 (14%)
Query: 719 CGICM---DGGDLLCCDSCPRAFHIDCVSLP----GIPSGTWHCRYCMN 760
C +C D G+LL CD C R FH+ C+ P IP G W+C C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 863 | |||
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 99.41 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 99.3 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 99.25 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 99.08 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.86 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.86 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.73 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.55 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.41 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.22 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 98.12 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 97.98 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.97 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.93 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.87 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.83 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.65 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.58 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.45 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.41 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.39 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.19 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.18 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.15 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.01 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.82 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 96.68 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.38 | |
| smart00258 | 73 | SAND SAND domain. | 95.84 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 95.63 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.62 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 95.44 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 95.3 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 95.04 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 94.67 | |
| smart00258 | 73 | SAND SAND domain. | 94.62 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 94.6 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 93.44 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 89.37 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 88.92 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 86.45 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 86.42 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 85.8 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 84.3 | |
| PF07897 | 284 | DUF1675: Protein of unknown function (DUF1675); In | 81.81 |
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.41 E-value=4.6e-14 Score=156.89 Aligned_cols=122 Identities=31% Similarity=0.663 Sum_probs=96.5
Q ss_pred cccccccccccCC-----ceEEcCCCCCccccCCCCCCCCCCCCcccccccc-----------cccchhhhh-------c
Q 002944 714 ENDDLCGICMDGG-----DLLCCDSCPRAFHIDCVSLPGIPSGTWHCRYCMN-----------TFQKEKFVE-------Y 770 (863)
Q Consensus 714 endd~C~VC~dgG-----dLL~CD~CpraFH~~CL~L~~vP~G~W~C~~C~~-----------~~~keKfve-------~ 770 (863)
.-++.|.+|.... -+++||+|.-++|+.|++++.+|+|.|+|..|.. +...|+|.. |
T Consensus 191 ~~d~~C~~c~~t~~eN~naiVfCdgC~i~VHq~CYGI~f~peG~WlCrkCi~~~~~i~~C~fCps~dGaFkqT~dgrW~H 270 (669)
T COG5141 191 EFDDICTKCTSTHNENSNAIVFCDGCEICVHQSCYGIQFLPEGFWLCRKCIYGEYQIRCCSFCPSSDGAFKQTSDGRWGH 270 (669)
T ss_pred hhhhhhHhccccccCCcceEEEecCcchhhhhhcccceecCcchhhhhhhcccccceeEEEeccCCCCceeeccCCchHh
Confidence 4678899998653 4999999999999999999999999999999963 223344433 3
Q ss_pred cccccc-----cCcccccCchhcccccccccccCCCCCcCccccCCCCCcCCCCCCCCceEecc--cccccccccccccC
Q 002944 771 NANARA-----AGRIEGVDPFAQMVSRCIRIVQTPDTELGGCVLCRGRDFCKSRFGRRTVILCD--QCEREYHVGCLKDH 843 (863)
Q Consensus 771 n~nava-----~Gri~GvdPieQi~kRC~RIvk~~~~e~~~C~ICkk~dfsks~f~~gtII~CD--qCeraYHV~CLr~a 843 (863)
+.+|.| ++....++|++.+.. + ...+|..+|.+|+.. .|++|+|. .|-++|||+|++++
T Consensus 271 ~iCA~~~pelsF~~l~~~dpI~~i~s-----V-s~srwkl~C~iCk~~--------~GtcIqCs~~nC~~aYHVtCArra 336 (669)
T COG5141 271 VICAMFNPELSFGHLLSKDPIDNIAS-----V-SSSRWKLGCLICKEF--------GGTCIQCSYFNCTRAYHVTCARRA 336 (669)
T ss_pred HhHHHhcchhccccccccchhhhhcc-----c-chhhHhheeeEEccc--------Ccceeeecccchhhhhhhhhhhhc
Confidence 444443 567778889887542 1 235788999999984 48999999 59999999999999
Q ss_pred CCCCCC
Q 002944 844 GMEDLQ 849 (863)
Q Consensus 844 GL~dLK 849 (863)
|+-+++
T Consensus 337 g~f~~~ 342 (669)
T COG5141 337 GYFDLN 342 (669)
T ss_pred chhhhh
Confidence 998886
|
|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07897 DUF1675: Protein of unknown function (DUF1675); InterPro: IPR012463 The members of this family are sequences derived from hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 863 | ||||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 5e-12 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 4e-11 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 4e-11 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 3e-10 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-10 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 5e-09 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 4e-07 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 8e-07 | ||
| 2yql_A | 56 | Solution Structure Of The Phd Domain In Phd Finger | 1e-06 | ||
| 2ku3_A | 71 | Solution Structure Of Brd1 Phd1 Finger Length = 71 | 1e-06 | ||
| 2l43_A | 88 | Structural Basis For Histone Code Recognition By Br | 2e-06 | ||
| 4gnd_A | 107 | Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains | 8e-04 |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
|
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 | Back alignment and structure |
| >pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71 | Back alignment and structure |
| >pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88 | Back alignment and structure |
| >pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
Score = 93.3 bits (231), Expect = 1e-22
Identities = 26/116 (22%), Positives = 41/116 (35%), Gaps = 18/116 (15%)
Query: 652 GYKKGFGILCTCCNSEVSPSQFEAHAGWASRRKPFQHIYTSNGVSLHELSIKLSLERPFS 711
+ CT C +V+ Q + R P + + +S +S
Sbjct: 2 PLGSMGIVSCTACGQQVNHFQK-----DSIYRHPSLQVLICKNCFKYYMSDDIS----RD 52
Query: 712 SKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP---------GIPSGTWHCRYC 758
S D+ C C +GG+L+CCD C AF C+ + W+C C
Sbjct: 53 SDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRRELSTIMDENNQWYCYIC 108
|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 863 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.7 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.61 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.56 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.52 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 99.27 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.26 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.15 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.13 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.07 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.07 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.03 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.03 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.02 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.02 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.01 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.99 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.89 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.88 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.87 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.86 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.85 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.85 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.83 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.71 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.7 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.69 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.66 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.65 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.48 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.46 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.4 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.39 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.37 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.35 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.35 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.34 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.32 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.26 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.22 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.22 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.2 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.17 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.16 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.16 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.15 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.09 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.07 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.04 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.02 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.93 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 97.79 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 97.75 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.74 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.71 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.71 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 97.7 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 97.55 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.46 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.43 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.37 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.37 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.35 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.35 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.35 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.27 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.27 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.25 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.14 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.11 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.93 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.93 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 96.91 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.91 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.9 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.87 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.84 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.82 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.77 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.61 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 96.53 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.39 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.38 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 96.37 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 96.27 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.26 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.24 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.23 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.1 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.08 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 96.06 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.04 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 95.99 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 95.8 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 95.79 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 95.75 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 95.52 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 95.28 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 95.15 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 94.62 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 94.24 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 93.35 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 92.98 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 91.7 | |
| 1ufn_A | 94 | Putative nuclear protein homolog 5830484A20RIK; SA | 90.88 | |
| 1h5p_A | 95 | Nuclear autoantigen SP100-B; transcription, DNA bi | 89.81 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 88.2 | |
| 1oqj_A | 97 | Glucocorticoid modulatory element binding protein- | 87.64 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 85.33 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 81.18 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 80.21 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.70 E-value=1.8e-17 Score=152.20 Aligned_cols=94 Identities=26% Similarity=0.656 Sum_probs=81.1
Q ss_pred CccccccccccccCCce---EEcCCCCCccccCCCCCCC--CCCCCcccccccccccchhhhhccccccccCcccccCch
Q 002944 712 SKENDDLCGICMDGGDL---LCCDSCPRAFHIDCVSLPG--IPSGTWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDPF 786 (863)
Q Consensus 712 ~~endd~C~VC~dgGdL---L~CD~CpraFH~~CL~L~~--vP~G~W~C~~C~~~~~keKfve~n~nava~Gri~GvdPi 786 (863)
+..++++|.+|+++|++ |+|+.|+++||+.|++++. ++.+.|+|+.|..
T Consensus 3 ~~~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~~-------------------------- 56 (111)
T 2ysm_A 3 SGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKV-------------------------- 56 (111)
T ss_dssp CCCCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTCC--------------------------
T ss_pred CCCCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCCc--------------------------
Confidence 45688999999999976 9999999999999998654 4579999999973
Q ss_pred hcccccccccccCCCCCcCccccCCCCCcCCCCCCCCceEecccccccccccccccCCCCCCC-CCCCCcceeeee
Q 002944 787 AQMVSRCIRIVQTPDTELGGCVLCRGRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDLQ-VPQLLVYDTISF 861 (863)
Q Consensus 787 eQi~kRC~RIvk~~~~e~~~C~ICkk~dfsks~f~~gtII~CDqCeraYHV~CLr~aGL~dLK-lPe~~wy~~iC~ 861 (863)
|.+|++.+ .+..++.||+|+++||..||++ .|+ +|++.|+++.|.
T Consensus 57 --------------------C~~C~~~~------~~~~ll~Cd~C~~~yH~~Cl~p----pl~~~P~g~W~C~~C~ 102 (111)
T 2ysm_A 57 --------------------CQNCKQSG------EDSKMLVCDTCDKGYHTFCLQP----VMKSVPTNGWKCKNCR 102 (111)
T ss_dssp --------------------CTTTCCCS------CCTTEEECSSSCCEEEGGGSSS----CCSSCCSSCCCCHHHH
T ss_pred --------------------ccccCccC------CCCCeeECCCCCcHHhHHhcCC----ccccCCCCCcCCcCCc
Confidence 88998853 3457999999999999999994 677 999999999874
|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >1ufn_A Putative nuclear protein homolog 5830484A20RIK; SAND domain, KDWK motif, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >1h5p_A Nuclear autoantigen SP100-B; transcription, DNA binding, SAND domain, KDWK, nuclear protein, alternative splicing; NMR {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1oqj_A Glucocorticoid modulatory element binding protein-1; SAND domain, alpha-beta fold, KDWK motif, zinc-binding motif, DNA binding protein; 1.55A {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 863 | ||||
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 5e-16 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 2e-13 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 3e-10 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 4e-09 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 9e-09 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 2e-08 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-07 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 9e-06 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 4e-05 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 8e-04 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 0.002 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.7 bits (173), Expect = 5e-16
Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
Query: 709 PFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCV--SLPGIPSGTWHCRYCMNTFQKEK 766
P S + + C +C DGG+LLCCD+CP ++HI C+ LP IP+G W C C K K
Sbjct: 2 PLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK 61
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 863 | |||
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.07 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.84 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.39 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.16 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.1 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.08 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 97.99 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.97 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.95 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.86 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.51 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.3 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.19 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.99 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 96.98 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.97 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.85 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.76 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.69 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.57 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 96.54 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.99 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 94.29 | |
| d1oqja_ | 90 | Glucocorticoid modulatory element binding protein- | 94.29 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 92.79 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 91.1 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 89.62 | |
| d1h5pa_ | 95 | Nuclear autoantigen Sp100b {Human (Homo sapiens) [ | 89.03 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 81.92 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.07 E-value=3.5e-11 Score=98.37 Aligned_cols=55 Identities=45% Similarity=1.188 Sum_probs=48.1
Q ss_pred CCccccccccccccCCceEEcCCCCCccccCCCC--CCCCCCCCcccccccccccch
Q 002944 711 SSKENDDLCGICMDGGDLLCCDSCPRAFHIDCVS--LPGIPSGTWHCRYCMNTFQKE 765 (863)
Q Consensus 711 s~~endd~C~VC~dgGdLL~CD~CpraFH~~CL~--L~~vP~G~W~C~~C~~~~~ke 765 (863)
..+.++++|.+|+++|+||+||.|+++||..|+. +..+|.+.|+|+.|+...+++
T Consensus 4 ~~d~~~~~C~~C~~~g~lv~Cd~C~~~~H~~C~~~~~~~~~~~~W~C~~C~~~~~kg 60 (61)
T d1mm2a_ 4 GSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKG 60 (61)
T ss_dssp CSCSSCSSCTTTCCCSSCBCCSSSCCCBCSSSSSSCCSSCCSSCCCCTTTTTTCCTT
T ss_pred CccCCcCCCcCCCCCCeEEEeCCCCccCchhhcCCCcCcCCCCcEECCCCcCcccCC
Confidence 4567789999999999999999999999999996 557788999999999866554
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oqja_ d.217.1.1 (A:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5pa_ d.217.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|