Citrus Sinensis ID: 002980

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-
MAGPNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQGSVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNISSDWLSGGAGGASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVPVSGAAQPSSKPYPLNSLQSAFSMQPAGSQIPQNQLSLNPGQKISSQSSSFASAGISVGSGNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASASPNTNSSVQMENTSPDGSPSADNFANVDERQRELMNAGERAFESESAYTHSEDESARSPHDSPAGKAAPESPSQNFSDVFRSSEADAETHR
ccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccHHHHHHHHHHcccccccEEcHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEcccccccccccccccccHcHHHcccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccc
MAGPNQDQFESFFRradldgdgrisGAEAVAffqgsnlpKQVLAQIWMHadhnhtsylgRQEFYNALKLVTVAQSKRELTPDIVKAAlygpaatkipppqinlsatpaqqinstaavsvpqmsvptqmapqnfgfrgpgapnvsqvqqqsirpyqaaphptqgsvgpdfsrggsvmgqtqvmpgstaprppqtmpagtaprppqsmpastsphppqsmpestaglnvpnsnissdwlsggaggastgsraispstplmptnpqtpvssssqlinnkskalvpsgngfasdsvfggdvfsaittspkqgpsssaysastsptssanvpvsgaaqpsskpyplnslqsafsmqpagsqipqnqlslnpgqkissqsssfasagisvgsgnstpdnsqvpwpkmkpsdiqKYSKVFMEVdtdrdgritgEQARNLFMSWRLPREVLKQVWdlsdqdsdsmLSLREFCFALYLMERYregrplpavlprnvmfdetllsmtsqppnagygnaawgpgpgfgpqqvmrpqamtpagalrppnlpthptadgarmlnqqkprapvlddnlanqldngeysadsklqdsttagkkvdeREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKhgidvkshavielpfgwqpgiqegagvwdedwdkfedagfgneitfdvknasaspntnssvqmentspdgspsadnfanVDERQRELMNAGErafesesaythsedesarsphdspagkaapespsqnfsdvfrsseadaethr
MAGPNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQGSVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNISSDWLSGGAGGASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVPVSGAAQPSSKPYPLNSLQSAFSMQPAGSQIPQNQLSLNPGQKISSQSSSFASAGISVGSgnstpdnsqvpwpkmkpSDIQKYSKVFMEVDTDRDGRITGEqarnlfmswrlPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNgeysadsklqdsttagkkvderekvildsrekiefYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMerggsadgLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASASPNTNSSVQMentspdgspsaDNFANVDERQRELMNAGERAFESESAYTHSEDESARSPHDSPAGkaapespsqnfsdvFRSSEADAETHR
MAGPNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQGSVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNISSDWLsggaggastgsraISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVFSAITTSPKQGpsssaysastsptssanvpvsGAAQPSSKPYPLNSLQSAFSMQPAGSQIPQNQLSLNPgqkissqsssfasagisvgsgNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWdlsdqdsdsmlslREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASASPNTNSSVQMENTSPDGSPSADNFANVDERQRELMNAGERAFESESAYTHSEDESARSPHDSPAGKAAPESPSQNFSDVFRSSEADAETHR
*********************GRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAA*******************************************************************************************************************************************************************************************************FGGDVF*****************************************************************************************************************VFMEVD****GRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLL*****************************************************************************************************IL**REKIEFYRSKMQELVLYKSRCDNRLNEITE*******************YKQVAEIASKLTIEDAKF**********HQAIVNM******DGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDV************************************************************************************************
*A**NQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPD******************************************************************************************************************************************************************************LMPTNPQTPVSSSSQLI**********************DVFS******************************************************************************************************KPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVL******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
********FESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAP**********************SVGPDFSRGGSVMGQTQV****************************************TAGLNVPNSNISSDWLS**********RAISPSTPLMPT************INNKSKALVPSGNGFASDSVFGGDVFSAITT**********************************PYPLNSLQSAFSMQPAGSQIPQNQLSLN**************AGISV*************WPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASA********************ADNFANVDERQRELMNAGER************************************SDVF***********
***PNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQGSVGP*****************************************************************************************************************************FGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVPVSGAAQPSSKPYPLNSLQSAFSMQ********************************************VPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQL*****************GKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKN**********************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGPNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQGSVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNISSDWLSGGAGGASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVPVSGAAQPSSKPYPLNSLQSAFSMQPAGSQIPQNQLSLNPGQKISSQSSSFASAGISVGSGNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASASPNTNSSVQMENTSPDGSPSADNFANVDERQRELMNAGERAFESESAYTHSEDESARSPHDSPAGKAAPESPSQNFSDVFRSSEADAETHR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query861 2.2.26 [Sep-21-2011]
Q9HGL2 1116 Uncharacterized calcium-b yes no 0.105 0.081 0.369 2e-15
Q6BNL1 1449 Actin cytoskeleton-regula yes no 0.491 0.291 0.261 2e-11
P42566896 Epidermal growth factor r yes no 0.137 0.131 0.307 2e-10
Q96D71796 RalBP1-associated Eps dom no no 0.124 0.134 0.342 2e-10
Q9WVE9 1217 Intersectin-1 OS=Rattus n yes no 0.077 0.055 0.415 3e-10
O54916795 RalBP1-associated Eps dom no no 0.105 0.114 0.369 4e-10
A4R8N4 1462 Actin cytoskeleton-regula N/A no 0.176 0.103 0.289 5e-10
Q15811 1721 Intersectin-1 OS=Homo sap no no 0.183 0.091 0.295 6e-10
O42287 1270 Intersectin-1 OS=Xenopus N/A no 0.089 0.060 0.402 6e-10
P34216 1381 EH domain-containing and yes no 0.109 0.068 0.317 7e-10
>sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=4 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 59/92 (64%), Gaps = 1/92 (1%)

Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
           PW  +   D+  + ++F  VD    G ++G +A + F++ +LP +VL Q+WDLSD +S+ 
Sbjct: 252 PW-AIPSQDLTSFCQLFSNVDKAHKGYVSGSEAYSFFLASKLPEDVLAQIWDLSDTNSNG 310

Query: 457 MLSLREFCFALYLMERYREGRPLPAVLPRNVM 488
            L++ EFC +LYL++    G+ LP VLP +++
Sbjct: 311 KLNIGEFCISLYLIKLKLSGKELPKVLPSSML 342

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q6BNL1|PAN1_DEBHA Actin cytoskeleton-regulatory complex protein PAN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN1 PE=3 SV=2 Back     alignment and function description
>sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 Back     alignment and function description
>sp|Q96D71|REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens GN=REPS1 PE=1 SV=3 Back     alignment and function description
>sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 Back     alignment and function description
>sp|O54916|REPS1_MOUSE RalBP1-associated Eps domain-containing protein 1 OS=Mus musculus GN=Reps1 PE=1 SV=2 Back     alignment and function description
>sp|A4R8N4|PAN1_MAGO7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN1 PE=3 SV=2 Back     alignment and function description
>sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 Back     alignment and function description
>sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 Back     alignment and function description
>sp|P34216|EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EDE1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query861
255539262 1006 calcium ion binding protein, putative [R 0.957 0.819 0.632 0.0
224065677933 predicted protein [Populus trichocarpa] 0.873 0.806 0.599 0.0
449485088 1050 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.902 0.74 0.577 0.0
449455615 1027 PREDICTED: uncharacterized protein LOC10 0.902 0.756 0.577 0.0
297745569 996 unnamed protein product [Vitis vinifera] 0.912 0.789 0.585 0.0
359491847 984 PREDICTED: uncharacterized protein LOC10 0.919 0.804 0.582 0.0
356517259 1076 PREDICTED: uncharacterized protein LOC10 0.918 0.735 0.561 0.0
356508604 1062 PREDICTED: uncharacterized protein LOC10 0.929 0.753 0.561 0.0
15218021 1019 calcium-binding EF hand-containing prote 0.912 0.771 0.549 0.0
359474793 1089 PREDICTED: uncharacterized protein LOC10 0.908 0.718 0.533 0.0
>gi|255539262|ref|XP_002510696.1| calcium ion binding protein, putative [Ricinus communis] gi|223551397|gb|EEF52883.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/877 (63%), Positives = 637/877 (72%), Gaps = 53/877 (6%)

Query: 1   MAG-PNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLG 59
           MAG PN DQFE++FRRADLDGDGRISG EAV FFQG+NLPKQVLAQIWMHAD + T +LG
Sbjct: 1   MAGQPNMDQFEAYFRRADLDGDGRISGTEAVNFFQGANLPKQVLAQIWMHADQSRTGFLG 60

Query: 60  RQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSV 119
           R EF+NALKLVTVAQSKRELTPDIVKAALYGPAA KIPPP+INL ATP QQ+N     S 
Sbjct: 61  RPEFFNALKLVTVAQSKRELTPDIVKAALYGPAAAKIPPPKINLLATPVQQVNPMMTPSA 120

Query: 120 PQMSVPTQMAPQNFGFRGPGAPNVSQVQQ-------QSIRPYQAAP-----HPTQGSVGP 167
           PQM  P     Q+ GFRGPG PN    QQ       Q++RP QA P      PTQG   P
Sbjct: 121 PQMGAPPPTPVQSLGFRGPGLPNAGINQQYFPSPQSQTMRPPQAIPPGIASRPTQGITNP 180

Query: 168 DFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNV 227
           +FSRG S+MG +QV+P  TA RPP                         SMP  TA  ++
Sbjct: 181 EFSRGSSMMGHSQVVPTGTASRPPH------------------------SMPVPTASPSI 216

Query: 228 PNSNISSDWLSGGAGGASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGF 287
           P SNIS+DWL G +  A +G     PSTP +    QT  S  SQ     SKA V SGNGF
Sbjct: 217 PTSNISTDWLGGKSSLAISGP----PSTPNVTLQSQTQFSMPSQPSATDSKASVVSGNGF 272

Query: 288 ASDSVFGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVP-VSGAAQPSSKPYPLNSLQS 346
           A+ S FG DVFSA  ++ +Q PS   YS+S++P S+  VP +SG    S K   L+SLQS
Sbjct: 273 ATGSSFGADVFSATPSTRRQEPSLPLYSSSSAPASATMVPAMSGGL--SVKSNSLDSLQS 330

Query: 347 AFSMQPAGSQIPQNQ-LSLNPGQKISSQSSSFASAGISVGSGNSTPDNSQVPWPKMKPSD 405
           A++MQP G Q+ + Q L  +  Q  +S SSS AS  ISVG GNS+ DNSQ PWPKMKPSD
Sbjct: 331 AYAMQPLGGQLQRTQSLPTSGQQVSTSVSSSVASPSISVGVGNSS-DNSQPPWPKMKPSD 389

Query: 406 IQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCF 465
           +QKY+KVFMEVDTDRDGRITGEQARNLF+SWRLPREVLKQVWDLSDQDSDSMLSLREFCF
Sbjct: 390 VQKYTKVFMEVDTDRDGRITGEQARNLFLSWRLPREVLKQVWDLSDQDSDSMLSLREFCF 449

Query: 466 ALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQ 525
           ALYLMERYREG  LPA LP ++MFDETLLSMT QP    +GNAAWGP PGFG Q  M  +
Sbjct: 450 ALYLMERYREGLRLPASLPSSIMFDETLLSMTGQP-KLIHGNAAWGPNPGFGQQPGMGAR 508

Query: 526 AMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTA 585
           +M PA  LRPP +      D   + NQQKPRAP L+D+  NQ D G    +S   D T +
Sbjct: 509 SMAPATGLRPP-VQVAAQPDSVLISNQQKPRAPALEDSFLNQSDTG--GQNSMQTDGTAS 565

Query: 586 GKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKY 645
             KV E EKVILDS+EKIEFYRSKMQ+LVLYKSRCDNRLNEITERALAD+REAE LGKKY
Sbjct: 566 ENKVGESEKVILDSKEKIEFYRSKMQDLVLYKSRCDNRLNEITERALADKREAEILGKKY 625

Query: 646 EEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLE 705
           EEKYKQVAE+ASKLTIE+A FR++QERK EL+QAI+N+E+GGSADG+LQVRADRIQSDL+
Sbjct: 626 EEKYKQVAEVASKLTIEEATFRDIQERKFELNQAIINIEQGGSADGILQVRADRIQSDLD 685

Query: 706 ELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDV 765
           ELL+ L ERCKKHG++ KS A+IELPFGWQPGIQEGA VWDE+WDKFED GF N++T DV
Sbjct: 686 ELLRVLIERCKKHGLEFKSTAMIELPFGWQPGIQEGAAVWDEEWDKFEDEGFANDLTIDV 745

Query: 766 KNASASPNTNSSVQMENTSPDGSPSADNFANVDERQRELMNAGERAFESESAYTHSEDES 825
           KN SAS N+ S+VQ E  S DGS + D+ +N         +  E A ESESAY HSEDE 
Sbjct: 746 KNVSAS-NSKSTVQKEKGSQDGSLTPDSLSN-GGGNANFFSTSEHALESESAYGHSEDEL 803

Query: 826 ARSPHDSPAGKAAPESPSQNFSDVF-RSSEADAETHR 861
           ARSP  S  G+ A ESPSQ FSDVF +S++ADAETHR
Sbjct: 804 ARSPQGSSTGRTALESPSQAFSDVFAKSTDADAETHR 840

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224065677|ref|XP_002301916.1| predicted protein [Populus trichocarpa] gi|222843642|gb|EEE81189.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449485088|ref|XP_004157066.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204624 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449455615|ref|XP_004145548.1| PREDICTED: uncharacterized protein LOC101204624 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297745569|emb|CBI40734.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491847|ref|XP_002272793.2| PREDICTED: uncharacterized protein LOC100240982 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356517259|ref|XP_003527306.1| PREDICTED: uncharacterized protein LOC100784075 [Glycine max] Back     alignment and taxonomy information
>gi|356508604|ref|XP_003523045.1| PREDICTED: uncharacterized protein LOC100818930 [Glycine max] Back     alignment and taxonomy information
>gi|15218021|ref|NP_173499.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] gi|8886934|gb|AAF80620.1|AC069251_13 F2D10.25 [Arabidopsis thaliana] gi|110742187|dbj|BAE99021.1| hypothetical protein [Arabidopsis thaliana] gi|332191898|gb|AEE30019.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359474793|ref|XP_003631533.1| PREDICTED: uncharacterized protein LOC100854676 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query861
TAIR|locus:2030432 1019 AT1G20760 [Arabidopsis thalian 0.821 0.693 0.463 5.1e-154
UNIPROTKB|F1NLF0919 EPS15 "Uncharacterized protein 0.119 0.112 0.321 1.4e-19
UNIPROTKB|E1C8N9921 EPS15 "Uncharacterized protein 0.119 0.111 0.321 1.4e-19
UNIPROTKB|F1LSZ0906 Eps15l1 "Protein Eps15l1" [Rat 0.114 0.109 0.345 1.9e-18
ZFIN|ZDB-GENE-060503-274915 eps15l1a "epidermal growth fac 0.113 0.107 0.355 2.3e-18
UNIPROTKB|P42566896 EPS15 "Epidermal growth factor 0.130 0.125 0.314 2.9e-18
UNIPROTKB|F1M9F5762 Eps15l1 "Protein Eps15l1" [Rat 0.114 0.129 0.345 6.5e-18
UNIPROTKB|F1M672686 Eps15l1 "Protein Eps15l1" [Rat 0.114 0.144 0.345 7.6e-18
UNIPROTKB|A5D7I1910 EPS15 "EPS15 protein" [Bos tau 0.130 0.123 0.314 1e-17
UNIPROTKB|A7MB30797 EPS15L1 "Uncharacterized prote 0.105 0.114 0.343 1.1e-17
TAIR|locus:2030432 AT1G20760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1502 (533.8 bits), Expect = 5.1e-154, P = 5.1e-154
 Identities = 350/755 (46%), Positives = 434/755 (57%)

Query:   112 NSTAAVSVPQMSVPTQMAPQ--NFGFRGPGAPNVSQVQ-QQSIRPYQAAPHPTQGSVGPD 168
             NS   V+V Q      + P+  N     P A  +   +   S  P    P+P   +VGP 
Sbjct:    67 NSLRLVTVAQSK--RDLTPEIVNAALNTPAAAKIPPPKINLSAIP-APRPNPAATTVGPV 123

Query:   169 FSRGG-----SVMGQTQVMPGSTAP-RPPQTMPAGTAPRP---PQSMPASTS----PHPP 215
                GG     +++ Q    P      RP Q +   T+ RP   P+  P++ S    P P 
Sbjct:   124 SGFGGPGAPNAIVNQNYFPPQQNQQMRPNQGISGLTSLRPAAGPEYRPSALSGQFQPVPV 183

Query:   216 QSMPESTAGLNVPNSNISSDWLXXXXXXXXXXXXXISPSTPLMPTNPQTPVSSSSQLINN 275
              S+      +    S   S                   S+     +   P     Q  + 
Sbjct:   184 GSVTHPPQPVPTSVSGPGSSTFNLNSLYAGAGNTS-GYSSGFGGGSLAAPSPGLKQESHI 242

Query:   276 KSKALVPSGNGFASDSVFGGDVFSAITTSPKQGXXXXXXXXXXXXXXXXXXXXXGAAQPS 335
               KALV SGNG        GD+FS+     KQ                         QP 
Sbjct:   243 DPKALVVSGNG--------GDMFSSF--QQKQ-----EPTLSNSSISSAIVPTSAGIQPP 287

Query:   336 SKPYPLNSLQSAFSMQPAGSQI--PQNQLSLNPXXXXXXXXXXXXXXXXXXXXXNSTPDN 393
             +KP  L+SLQS FSM P+G+Q+  P+   S  P                     ++   N
Sbjct:   288 TKPNALDSLQSTFSMLPSGNQLQQPRPAASSQPAVSSQGPSSGLPPGSAVGSGHSTPAGN 347

Query:   394 SQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWXXXXXX 453
             +Q PWPKMKPSD+QKY+KVFMEVD+D+DG+ITGEQARNLF+SWRLPREVLK VW      
Sbjct:   348 NQPPWPKMKPSDVQKYTKVFMEVDSDKDGKITGEQARNLFLSWRLPREVLKHVWELSDQD 407

Query:   454 XXXXXXXREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPG 513
                    REFC +LYLMERYREGRPLP  LP ++MFDETLLS++  P + GY NA WG G
Sbjct:   408 NDTMLSLREFCISLYLMERYREGRPLPTALPSSIMFDETLLSISGAPSH-GYANAGWGSG 466

Query:   514 PGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEY 573
              GF  Q  M  + +TP   +RPP     P        NQ + +APVLD   AN L NG Y
Sbjct:   467 QGFVQQPGMGARPITPTTGMRPPVPAPGPQPGSGIPPNQPRNQAPVLDAPFANHLGNG-Y 525

Query:   574 SADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALA 633
             SA S L ++    +KVDE++   +DSREK+++YR+KMQ++VLYKSRCDNRLNEI+ERA A
Sbjct:   526 SASSNLPEAAADEEKVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNRLNEISERASA 585

Query:   634 DRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLL 693
             D+REAETL KKYEEKYKQVAEI SKLTIE+A+FRE++ RKMEL QAIVNME+GGSADGLL
Sbjct:   586 DKREAETLAKKYEEKYKQVAEIGSKLTIEEARFREIEGRKMELSQAIVNMEQGGSADGLL 645

Query:   694 QVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFE 753
             QVRADRIQSDLEEL+KALTERCKKHG++V S A+++LP GWQPGIQEGA +WDE+WDKFE
Sbjct:   646 QVRADRIQSDLEELMKALTERCKKHGLEVNSKALVDLPAGWQPGIQEGAALWDEEWDKFE 705

Query:   754 DAGFGNEITFDVKNASASPNTNSSVQMEN-TSPDGSPSADNFANVDERQRELMNAGERAF 812
             D GFGNEITFD      S   NSS + EN T  DGS   D+  +V++         +R  
Sbjct:   706 DEGFGNEITFD-----KSKEQNSSGEKENGTVDDGSGPPDSPTHVEDNYGPFSETSDRHH 760

Query:   813 ESESAYTHSEDESARSPHDSPAGKAAPESPSQNFS 847
             ESE   THSED   RSP DSP  + A E PS ++S
Sbjct:   761 ESEYGTTHSED---RSPRDSPVSRNATEVPSPDYS 792
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0005829 "cytosol" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
GO:0051645 "Golgi localization" evidence=RCA
GO:0051646 "mitochondrion localization" evidence=RCA
GO:0060151 "peroxisome localization" evidence=RCA
UNIPROTKB|F1NLF0 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8N9 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSZ0 Eps15l1 "Protein Eps15l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-274 eps15l1a "epidermal growth factor receptor pathway substrate 15-like 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P42566 EPS15 "Epidermal growth factor receptor substrate 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9F5 Eps15l1 "Protein Eps15l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M672 Eps15l1 "Protein Eps15l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7I1 EPS15 "EPS15 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB30 EPS15L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query861
smart0002796 smart00027, EH, Eps15 homology domain 2e-24
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 7e-23
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 1e-22
smart0002796 smart00027, EH, Eps15 homology domain 4e-14
pfam12763104 pfam12763, efhand_3, Cytoskeletal-regulatory compl 2e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-06
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 8e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 1e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 4e-04
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
pfam12004489 pfam12004, DUF3498, Domain of unknown function (DU 0.002
pfam1320225 pfam13202, EF_hand_3, EF hand 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 0.004
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information 
 Score = 98.1 bits (245), Expect = 2e-24
 Identities = 34/88 (38%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
           PW  + P D  KY ++F  +D ++DG +TG QA+ + +   LP+ +L ++W+L+D D+D 
Sbjct: 1   PWA-ISPEDKAKYEQIFRSLDKNQDGTVTGAQAKPILLKSGLPQTLLAKIWNLADIDNDG 59

Query: 457 MLSLREFCFALYLMERYREGRPLPAVLP 484
            L   EF  A++L+ R   G P+PA LP
Sbjct: 60  ELDKDEFALAMHLIYRKLNGYPIPASLP 87

Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences. Length = 96
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|193239 pfam12763, efhand_3, Cytoskeletal-regulatory complex EF hand Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|221371 pfam12004, DUF3498, Domain of unknown function (DUF3498) Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 861
KOG0998 847 consensus Synaptic vesicle protein EHS-1 and relat 100.0
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 100.0
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 99.9
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 99.83
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 99.82
KOG0998 847 consensus Synaptic vesicle protein EHS-1 and relat 99.8
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.68
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 99.66
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 99.62
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 99.44
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.23
cd0005267 EH Eps15 homology domain; found in proteins implic 99.05
cd0005267 EH Eps15 homology domain; found in proteins implic 99.0
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 98.96
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.79
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 98.77
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.67
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.67
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.5
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.47
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.45
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.42
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.37
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.34
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.3
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.28
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.26
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.23
PTZ00183158 centrin; Provisional 98.23
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.23
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.18
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.16
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.16
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.16
PTZ00184149 calmodulin; Provisional 98.13
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.12
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.09
PTZ00183158 centrin; Provisional 98.08
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.07
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.05
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.05
PRK09039343 hypothetical protein; Validated 98.0
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.0
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.0
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.99
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.99
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.96
PTZ00184149 calmodulin; Provisional 97.96
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.93
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.91
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.85
PRK11637428 AmiB activator; Provisional 97.79
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.75
PRK11637428 AmiB activator; Provisional 97.74
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.71
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.64
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.63
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 97.62
PRK09039343 hypothetical protein; Validated 97.62
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.6
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.58
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.56
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.56
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 97.54
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.52
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.51
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.43
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.42
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.4
PF1465866 EF-hand_9: EF-hand domain 97.4
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.39
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.37
COG3883265 Uncharacterized protein conserved in bacteria [Fun 97.33
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.3
COG4372499 Uncharacterized protein conserved in bacteria with 97.3
PF1465866 EF-hand_9: EF-hand domain 97.3
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.29
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.29
PHA02562562 46 endonuclease subunit; Provisional 97.23
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 97.19
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.19
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.17
PRK02224880 chromosome segregation protein; Provisional 97.16
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.15
PLN02964644 phosphatidylserine decarboxylase 97.13
PF13851201 GAS: Growth-arrest specific micro-tubule binding 97.13
PRK03918 880 chromosome segregation protein; Provisional 97.09
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.07
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 97.07
PRK03918880 chromosome segregation protein; Provisional 97.06
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.06
PRK02224 880 chromosome segregation protein; Provisional 97.04
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.03
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 97.02
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.99
PHA02562562 46 endonuclease subunit; Provisional 96.99
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 96.98
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.97
PRK04863 1486 mukB cell division protein MukB; Provisional 96.96
PF10186302 Atg14: UV radiation resistance protein and autopha 96.96
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.96
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.96
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 96.93
PRK04863 1486 mukB cell division protein MukB; Provisional 96.92
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.91
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.91
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.9
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.9
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.89
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 96.89
PF00038312 Filament: Intermediate filament protein; InterPro: 96.87
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.87
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.87
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 96.87
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.86
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.74
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.73
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.72
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 96.72
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.72
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 96.69
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.65
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.61
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 96.61
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.58
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.57
PLN02964644 phosphatidylserine decarboxylase 96.57
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 96.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.56
KOG0963 629 consensus Transcription factor/CCAAT displacement 96.55
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.55
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.54
KOG4302 660 consensus Microtubule-associated protein essential 96.53
PF00038312 Filament: Intermediate filament protein; InterPro: 96.53
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.51
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 96.47
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.46
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 96.45
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 96.43
COG4372 499 Uncharacterized protein conserved in bacteria with 96.42
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.41
KOG09331174 consensus Structural maintenance of chromosome pro 96.41
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 96.41
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.39
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.38
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.38
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 96.37
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 96.35
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.27
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.24
PF10186302 Atg14: UV radiation resistance protein and autopha 96.24
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 96.22
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.19
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.19
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 96.15
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.11
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.1
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 96.09
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.09
KOG0933 1174 consensus Structural maintenance of chromosome pro 96.08
PRK01156 895 chromosome segregation protein; Provisional 96.08
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 96.07
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.05
KOG0038189 consensus Ca2+-binding kinase interacting protein 96.03
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 96.03
PRK10929 1109 putative mechanosensitive channel protein; Provisi 96.02
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.02
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 95.99
PRK11281 1113 hypothetical protein; Provisional 95.99
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.98
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.93
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.93
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 95.91
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.9
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 95.9
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 95.9
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 95.89
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 95.89
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.87
KOG0018 1141 consensus Structural maintenance of chromosome pro 95.86
KOG0964 1200 consensus Structural maintenance of chromosome pro 95.85
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.85
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 95.84
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 95.83
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 95.83
PF05701522 WEMBL: Weak chloroplast movement under blue light; 95.79
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 95.77
PRK04778569 septation ring formation regulator EzrA; Provision 95.76
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 95.74
KOG1003205 consensus Actin filament-coating protein tropomyos 95.71
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.71
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.7
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 95.7
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 95.7
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.67
KOG0971 1243 consensus Microtubule-associated protein dynactin 95.66
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.65
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.64
KOG0288 459 consensus WD40 repeat protein TipD [General functi 95.63
KOG4673 961 consensus Transcription factor TMF, TATA element m 95.63
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 95.63
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 95.63
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 95.6
COG5185622 HEC1 Protein involved in chromosome segregation, i 95.59
PF13514 1111 AAA_27: AAA domain 95.59
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.57
PF05010207 TACC: Transforming acidic coiled-coil-containing p 95.55
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.53
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.52
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 95.51
TIGR00634563 recN DNA repair protein RecN. All proteins in this 95.47
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 95.47
KOG1003205 consensus Actin filament-coating protein tropomyos 95.47
KOG0018 1141 consensus Structural maintenance of chromosome pro 95.46
KOG0036463 consensus Predicted mitochondrial carrier protein 95.44
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 95.4
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 95.39
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 95.38
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 95.38
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 95.36
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.35
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 95.32
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 95.32
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 95.31
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 95.31
PRK04778569 septation ring formation regulator EzrA; Provision 95.3
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 95.29
KOG0964 1200 consensus Structural maintenance of chromosome pro 95.29
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 95.25
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 95.25
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.17
PF05911769 DUF869: Plant protein of unknown function (DUF869) 95.16
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 95.15
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.13
COG4026290 Uncharacterized protein containing TOPRIM domain, 95.12
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 95.11
PRK03947140 prefoldin subunit alpha; Reviewed 95.1
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.1
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 95.08
PF15294278 Leu_zip: Leucine zipper 95.04
KOG2751447 consensus Beclin-like protein [Signal transduction 95.01
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 95.01
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 94.99
PF05701522 WEMBL: Weak chloroplast movement under blue light; 94.98
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 94.98
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 94.97
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.95
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 94.92
PRK00106 535 hypothetical protein; Provisional 94.92
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.91
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 94.9
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 94.9
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 94.9
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 94.89
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 94.87
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 94.87
PRK10884206 SH3 domain-containing protein; Provisional 94.86
KOG0979 1072 consensus Structural maintenance of chromosome pro 94.84
PF05911769 DUF869: Plant protein of unknown function (DUF869) 94.83
PRK09343121 prefoldin subunit beta; Provisional 94.79
PRK10476346 multidrug resistance protein MdtN; Provisional 94.78
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 94.78
COG2433652 Uncharacterized conserved protein [Function unknow 94.75
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 94.72
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 94.72
KOG4251362 consensus Calcium binding protein [General functio 94.72
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 94.69
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 94.64
COG5185622 HEC1 Protein involved in chromosome segregation, i 94.64
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 94.63
PRK12705 508 hypothetical protein; Provisional 94.61
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 94.52
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 94.51
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 94.5
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 94.49
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 94.45
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 94.44
PRK07720146 fliJ flagellar biosynthesis chaperone; Validated 94.43
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.43
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 94.42
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 94.37
PRK12704 520 phosphodiesterase; Provisional 94.35
KOG0036463 consensus Predicted mitochondrial carrier protein 94.33
cd00176213 SPEC Spectrin repeats, found in several proteins i 94.32
KOG2991330 consensus Splicing regulator [RNA processing and m 94.32
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 94.31
KOG3850455 consensus Predicted membrane protein [Function unk 94.3
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 94.28
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 94.24
KOG0963 629 consensus Transcription factor/CCAAT displacement 94.23
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 94.23
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 94.22
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 94.2
TIGR02231 525 conserved hypothetical protein. This family consis 94.12
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.07
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 94.05
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 94.02
PRK10698222 phage shock protein PspA; Provisional 94.02
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 93.95
PRK11519 719 tyrosine kinase; Provisional 93.91
PF13514 1111 AAA_27: AAA domain 93.88
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 93.84
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 93.82
PF15397258 DUF4618: Domain of unknown function (DUF4618) 93.79
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 93.76
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 93.76
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 93.72
KOG4065144 consensus Uncharacterized conserved protein [Funct 93.72
PRK12704 520 phosphodiesterase; Provisional 93.7
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 93.63
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 93.62
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 93.6
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 93.59
PF09731582 Mitofilin: Mitochondrial inner membrane protein; I 93.58
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 93.56
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 93.54
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.51
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 93.47
PF122521439 SidE: Dot/Icm substrate protein; InterPro: IPR0210 93.46
PF09602165 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion prot 93.45
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 93.42
PF07851330 TMPIT: TMPIT-like protein; InterPro: IPR012926 A n 93.41
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 93.32
PRK10476346 multidrug resistance protein MdtN; Provisional 93.31
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 93.3
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 93.29
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 93.28
PRK11281 1113 hypothetical protein; Provisional 93.2
KOG1937521 consensus Uncharacterized conserved protein [Funct 93.2
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 93.18
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 93.16
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 93.11
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 93.1
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 93.07
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 93.07
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 93.07
PRK09343121 prefoldin subunit beta; Provisional 93.06
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 93.03
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 93.02
COG2882148 FliJ Flagellar biosynthesis chaperone [Cell motili 92.99
PF15397258 DUF4618: Domain of unknown function (DUF4618) 92.97
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 92.94
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 92.94
KOG4251362 consensus Calcium binding protein [General functio 92.93
TIGR02977219 phageshock_pspA phage shock protein A. Members of 92.89
PRK10361 475 DNA recombination protein RmuC; Provisional 92.86
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 92.84
PF08702146 Fib_alpha: Fibrinogen alpha/beta chain family; Int 92.84
PRK00409782 recombination and DNA strand exchange inhibitor pr 92.8
TIGR02977219 phageshock_pspA phage shock protein A. Members of 92.79
PRK11519 719 tyrosine kinase; Provisional 92.79
PF06009138 Laminin_II: Laminin Domain II; InterPro: IPR010307 92.71
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 92.7
KOG4673 961 consensus Transcription factor TMF, TATA element m 92.69
KOG0249 916 consensus LAR-interacting protein and related prot 92.69
cd00176213 SPEC Spectrin repeats, found in several proteins i 92.67
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 92.67
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 92.64
KOG4807593 consensus F-actin binding protein, regulates actin 92.61
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 92.52
PF05546207 She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 92.52
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 92.51
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 92.46
KOG4302 660 consensus Microtubule-associated protein essential 92.44
KOG1962216 consensus B-cell receptor-associated protein and r 92.42
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 92.4
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.4
COG4026290 Uncharacterized protein containing TOPRIM domain, 92.35
PF06705247 SF-assemblin: SF-assemblin/beta giardin 92.35
PF05010207 TACC: Transforming acidic coiled-coil-containing p 92.33
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 92.32
KOG3091508 consensus Nuclear pore complex, p54 component (sc 92.31
KOG1937521 consensus Uncharacterized conserved protein [Funct 92.26
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 92.25
PRK00106 535 hypothetical protein; Provisional 92.25
PF15450531 DUF4631: Domain of unknown function (DUF4631) 92.19
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 92.17
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 92.15
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 92.15
KOG0979 1072 consensus Structural maintenance of chromosome pro 92.12
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 92.1
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 92.03
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 92.0
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 91.97
PF15272196 BBP1_C: Spindle pole body component BBP1, C-termin 91.94
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 91.93
PF15066527 CAGE1: Cancer-associated gene protein 1 family 91.92
COG3206458 GumC Uncharacterized protein involved in exopolysa 91.92
PF04949159 Transcrip_act: Transcriptional activator; InterPro 91.92
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 91.92
PF14992280 TMCO5: TMCO5 family 91.91
KOG0288 459 consensus WD40 repeat protein TipD [General functi 91.87
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 91.84
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.82
KOG2751447 consensus Beclin-like protein [Signal transduction 91.81
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 91.74
PRK03598331 putative efflux pump membrane fusion protein; Prov 91.74
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.74
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 91.74
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 91.67
PRK102461047 exonuclease subunit SbcC; Provisional 91.62
PRK10698222 phage shock protein PspA; Provisional 91.57
PRK00286438 xseA exodeoxyribonuclease VII large subunit; Revie 91.52
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 91.5
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 91.46
cd07667240 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of 91.41
PF13166712 AAA_13: AAA domain 91.4
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 91.39
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 91.38
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 91.37
PRK102461047 exonuclease subunit SbcC; Provisional 91.35
COG2433652 Uncharacterized conserved protein [Function unknow 91.35
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 91.34
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 91.3
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 91.26
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 91.19
PRK10361 475 DNA recombination protein RmuC; Provisional 91.16
KOG3433203 consensus Protein involved in meiotic recombinatio 91.13
PF13863126 DUF4200: Domain of unknown function (DUF4200) 91.11
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 91.1
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 91.04
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.02
PF15294278 Leu_zip: Leucine zipper 90.97
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 90.96
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 90.9
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 90.87
PF04912388 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit 90.85
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 90.85
PTZ00464211 SNF-7-like protein; Provisional 90.82
KOG4809654 consensus Rab6 GTPase-interacting protein involved 90.78
PRK10869553 recombination and repair protein; Provisional 90.76
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 90.72
TIGR02132189 phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR 90.7
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 90.68
cd07667240 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of 90.56
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 90.55
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 90.52
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 90.51
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 90.48
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.39
KOG0972384 consensus Huntingtin interacting protein 1 (Hip1) 90.36
KOG1760131 consensus Molecular chaperone Prefoldin, subunit 4 90.34
PF12072201 DUF3552: Domain of unknown function (DUF3552); Int 90.33
PF08702146 Fib_alpha: Fibrinogen alpha/beta chain family; Int 90.24
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 90.18
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 90.17
PF15456124 Uds1: Up-regulated During Septation 90.14
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 90.07
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 90.05
KOG3478120 consensus Prefoldin subunit 6, KE2 family [Posttra 90.03
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 90.02
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 90.02
KOG4572 1424 consensus Predicted DNA-binding transcription fact 90.01
PF15066527 CAGE1: Cancer-associated gene protein 1 family 89.99
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 89.98
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 89.91
KOG0038189 consensus Ca2+-binding kinase interacting protein 89.9
PF13166 712 AAA_13: AAA domain 89.89
PF02994370 Transposase_22: L1 transposable element; InterPro: 89.88
KOG4637464 consensus Adaptor for phosphoinositide 3-kinase [S 89.88
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 89.87
COG4717984 Uncharacterized conserved protein [Function unknow 89.86
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 89.71
KOG1655218 consensus Protein involved in vacuolar protein sor 89.68
PF12072201 DUF3552: Domain of unknown function (DUF3552); Int 89.67
KOG4807593 consensus F-actin binding protein, regulates actin 89.65
KOG2129552 consensus Uncharacterized conserved protein H4 [Fu 89.61
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 89.59
PRK10869553 recombination and repair protein; Provisional 89.52
TIGR02231 525 conserved hypothetical protein. This family consis 89.5
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 89.5
PF03904230 DUF334: Domain of unknown function (DUF334); Inter 89.48
TIGR00634563 recN DNA repair protein RecN. All proteins in this 89.47
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 89.47
COG5283 1213 Phage-related tail protein [Function unknown] 89.46
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.36
KOG2196254 consensus Nuclear porin [Nuclear structure] 89.34
KOG2991330 consensus Splicing regulator [RNA processing and m 89.31
PF02994370 Transposase_22: L1 transposable element; InterPro: 89.31
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 89.29
PF13949296 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI 89.28
COG4477570 EzrA Negative regulator of septation ring formatio 89.25
COG3206458 GumC Uncharacterized protein involved in exopolysa 89.11
PF04740204 LXG: LXG domain of WXG superfamily; InterPro: IPR0 89.06
PF09486158 HrpB7: Bacterial type III secretion protein (HrpB7 89.06
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 89.0
KOG2685421 consensus Cystoskeletal protein Tektin [Cytoskelet 88.96
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 88.95
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 88.89
PF00015213 MCPsignal: Methyl-accepting chemotaxis protein (MC 88.87
KOG2891445 consensus Surface glycoprotein [General function p 88.86
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 88.81
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 88.8
PRK00578367 prfB peptide chain release factor 2; Validated 88.69
KOG3647338 consensus Predicted coiled-coil protein [General f 88.69
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 88.67
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 88.67
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 88.66
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 88.54
PF04799171 Fzo_mitofusin: fzo-like conserved region; InterPro 88.48
>KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=5e-42  Score=412.44  Aligned_cols=590  Identities=29%  Similarity=0.378  Sum_probs=380.5

Q ss_pred             ccHHHHHHHHHhhCCCCCCccCHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCcCHHHHHHHHHHHHHHhcCCCCCHHH
Q 002980            4 PNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDI   83 (861)
Q Consensus         4 ~e~~~y~~iF~~~D~DgDG~ISg~E~~~~f~~SgLp~~~L~qIW~laD~d~DG~Ls~~EF~~Al~Li~~aQ~G~~lspdl   83 (861)
                      .+...|+.+|+.+|.+++|+|++.+++.||..+||+..+|.+||.++|..+.|||++.+||+++|||+++|+|..++...
T Consensus         8 ~~q~~~~~~~~~~d~~~~G~i~g~~a~~f~~~s~L~~qvl~qiws~~d~~~~g~l~~q~f~~~lrlva~aq~~~~~~~~~   87 (847)
T KOG0998|consen    8 PGQPLFDQYFKSADPQGDGRITGAEAVAFLSKSGLPDQVLGQIWSLADSSGKGFLNRQGFYAALRLVAQAQSGRELSAKK   87 (847)
T ss_pred             CccchHHHhhhccCcccCCcccHHHhhhhhhccccchhhhhccccccccccCCccccccccccchHhhhhhcccCcCccc
Confidence            35689999999999999999999999999999999999999999999999999999999999999999999999998766


Q ss_pred             HhhhhcCCCCCCCCCCCcCCCCCCccccccccccCCCCCCCCCcCCCCCCCCCCCCCCCCCcccc----c---ccCCCCC
Q 002980           84 VKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQ----Q---SIRPYQA  156 (861)
Q Consensus        84 l~~~l~gp~~~~iP~P~l~~~~~p~p~~~~~a~~~~~~~~~~~p~~~qn~~~~~~~~p~~s~~~q----q---~~~p~q~  156 (861)
                      +     +++....|+|++.....+.++....                   ...+..+|..+.+.+    |   .+.|..+
T Consensus        88 ~-----~~~~~~pp~~~~~~~~~~~~~~~~~-------------------~s~~~~~p~~~~qe~aky~q~f~s~~p~~g  143 (847)
T KOG0998|consen   88 V-----LPASAVPPPPKISHDTSPPSRPSSS-------------------TSAAPFVPAITPQEQAKYDQIFRSLSPSNG  143 (847)
T ss_pred             c-----ccccCCCCCCccCccCCCcccCCCC-------------------CCCcccCCCCCHHHHHHHHHHHhccCCCCC
Confidence            5     4566777888777666655554321                   112233444444443    2   2222211


Q ss_pred             CCCCCCCCCCCCCCCCCccccccccCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCC
Q 002980          157 APHPTQGSVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMP---AGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNIS  233 (861)
Q Consensus       157 ~~~~~~~~~~p~~~~~~~l~G~~~~l~~~~l~~iw~~~~---~g~~~~~~~~~~~~~~p~~~q~~~~~~~~~~~~~~~~~  233 (861)
                      ...|..  +.|     +.+   .++||..+|++||+|||   .|.+++.||.++|    |+|...+.    ..       
T Consensus       144 ~~sg~~--~~p-----il~---~s~Lp~~~l~~iw~l~d~d~~g~Ld~~ef~~am----~l~~~~l~----~~-------  198 (847)
T KOG0998|consen  144 LLSGDK--AKP-----ILL---NSKLPSDVLGRIWELSDIDKDGNLDRDEFAVAM----HLINDLLN----GN-------  198 (847)
T ss_pred             ccccch--hhh-----hhh---cCCCChhhhccccccccccccCCCChhhhhhhh----hHHHHHhh----cc-------
Confidence            111100  111     122   67999999999999999   4999999999999    98855331    00       


Q ss_pred             cccccCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCcchhccccccccccCCCCCCCCCcccCCccccccCCCCCCCC
Q 002980          234 SDWLSGGAGGASTGSRAISPST---PLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVFSAITTSPKQGPS  310 (861)
Q Consensus       234 ~~~~~g~~~~~~~~~~~~~p~~---p~~~p~p~~~~~~~~~~~~~~~~~~~~~gng~~s~s~~~~d~fsa~~~~~~q~~~  310 (861)
                                     .-.+|.+   .+++|.               .+.+...+..++.            +..+++.++
T Consensus       199 ---------------~~p~P~~~p~~lIpps---------------~~~~~~~~~~~~~------------~~~~~~~~~  236 (847)
T KOG0998|consen  199 ---------------SEPVPSRLPPSLIPPS---------------KSELSANSSSKAI------------PFSQPFLAS  236 (847)
T ss_pred             ---------------cCCCCccCCcccCCcc---------------hhcccccCccccc------------ccccccccc
Confidence                           0111110   011110               0111111222221            112222111


Q ss_pred             CCCCCCCCCCCCCCCcCCCCCCCCCCCCCCccchhhhcccCcccCCCCcCcCCCCCCCCCCCCCCCCCCCCcccCCCCCC
Q 002980          311 SSAYSASTSPTSSANVPVSGAAQPSSKPYPLNSLQSAFSMQPAGSQIPQNQLSLNPGQKISSQSSSFASAGISVGSGNST  390 (861)
Q Consensus       311 ~~~~~~~~~~~~~~~~p~~~~~~p~~~~~~~~~~q~~fs~~~~~~~lq~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  390 (861)
                      ....                     +          .++++.-+.++..++++.              ..-..+      
T Consensus       237 ~~~~---------------------~----------~~~~l~~~s~~~~~~s~~--------------~~~~~~------  265 (847)
T KOG0998|consen  237 MASP---------------------T----------TLSSLVDLSALNSNPSLS--------------SLSLAS------  265 (847)
T ss_pred             cccc---------------------c----------ccccccchhcccCCcccc--------------cccccc------
Confidence            0000                     0          111111222233333221              000000      


Q ss_pred             CCCCCCCC-CCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCccCHHHHHHHHHH
Q 002980          391 PDNSQVPW-PKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYL  469 (861)
Q Consensus       391 ~~~~~~~W-p~ISpedk~~Y~~iF~~lD~d~dG~Isg~ea~~~f~ksgLp~e~L~~IW~LaD~d~dG~LdkdEF~vAMhL  469 (861)
                      .......| |+|++.++.+|.+||.++|.+.+|+|++.+++++|+.+||++..|++||.|||++++|+|+++|||++|||
T Consensus       266 ~~q~~~s~~~~vsp~d~~~~~~if~q~d~~~dG~I~s~~~~~~f~~~gl~~~~l~~~w~l~d~~n~~~ls~~ef~~~~~~  345 (847)
T KOG0998|consen  266 SMQLIVSWSPKVSPSDKQKYSKIFSQVDKDNDGSISSNEARNIFLPFGLSKPRLAHVWLLADTQNTGTLSKDEFALAMHL  345 (847)
T ss_pred             ccccccccCcccChHHHHHHHHHHHhccccCCCcccccccccccccCCCChhhhhhhhhhcchhccCcccccccchhhhh
Confidence            12334556 68999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHH-hcCCCCCCCCCCCCcCcccccccCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCcc
Q 002980          470 MERY-REGRPLPAVLPRNVMFDETLLSMTSQPPN-AGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGA  547 (861)
Q Consensus       470 I~~~-~~G~~lP~~LPp~L~pp~~~~~~~~~ps~-~~~~l~s~~~~~~~~~Q~~~~~~~~~pt~~~~Pp~~~~~p~~d~~  547 (861)
                      +.++ .+|+.||.+||.+|+|++.+.  ...+.. ..++ ..|....+...+..+..........-+++..    ..+..
T Consensus       346 ~~~~~~~g~~lP~vl~~s~~p~~~~~--~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~----~~~~~  418 (847)
T KOG0998|consen  346 LEQKRAEGRSLPSVLPSSLIPSENRK--QTNPTTRASTA-ESPSSEQSSLAELKSLALSIASNPREKPRLE----QSSSE  418 (847)
T ss_pred             hhhhhhcCCCCcccccccccCccccc--cCCcccccccc-ccCCccccccccccccccccccccccccccc----ccccc
Confidence            9999 789999999999999987543  211110 0111 1232111111111111111111111112110    00000


Q ss_pred             cccCCCCCCCCccchhhhhccCCCcccccccchhhhHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHH
Q 002980          548 RMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEI  627 (861)
Q Consensus       548 ~~~~~~~s~~p~~d~~~~~~l~~~~~~s~~~~qE~~elekela~Le~qi~~sree~e~LrsQlQEL~~~Ksr~e~~L~ei  627 (861)
                      ....+.....+..+  +..+|.+.+....++.....+..+++.++..++..++++...++.++++...+.++|.++++++
T Consensus       419 ~~~~~~~~~s~~~~--~~~~l~~~~s~~~~l~~~~~~~~~k~~e~~~~~s~s~~~~~~~~~k~~~~~~~~s~~~~~~~~~  496 (847)
T KOG0998|consen  419 APRTTPVKTSPVLE--LANELSNLASTSQQLPAQKDTVQDKLNELDAQKSQSKEKFSTTRKKKQEEPQWISSLDNDLNLL  496 (847)
T ss_pred             ccccCccccccccc--chhhhhhcchhhhccccccchhhhhhhhhhhhhhHHHhhhhhhhhhhhccccccccccchhhhc
Confidence            00000000111111  1344555555555555444555677889999999999999999999999999999999999999


Q ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcchhhHHHHHHHHHHHHHHH
Q 002980          628 TERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEEL  707 (861)
Q Consensus       628 ~e~~s~~kreIesLr~k~ee~~kqv~elEsQL~~lEa~L~d~Q~EL~eLqqeIqkLe~~~~~n~~Lkera~~in~el~eL  707 (861)
                      ..++...+++++++.++|++..+|+..|+..|...+..+..++.+|..|..++.   ......+.|...........++|
T Consensus       497 ~~~~~~~~~ei~~~~~~ln~~~qq~~~l~~~v~~~~~~ve~l~~~L~~~~~~~~---~~~s~~~~l~~~~~~~~~~~~~~  573 (847)
T KOG0998|consen  497 PLQLSNDNREISSLEKELNELQQQLSVLEGSVKAIESQVENLQKELLDLIYEMA---DTRSKSTLLDDSFKVGMELFEQL  573 (847)
T ss_pred             ccccccchhhHHHHHHHHhhhHHHHhHHhhhhhhhhhhhhhhHhHHHHHHHHHH---hhcccchhhhhhhhhhhhhhhhh
Confidence            999999999999999888888888777777777776666666666666655555   44556667777777666666666


Q ss_pred             HHHHHHHhHhcCccccccceeecCCCCCCCcccccccchhhhhhcccCCCC
Q 002980          708 LKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFG  758 (861)
Q Consensus       708 ~~~L~e~~~~~g~~~~~~~~~e~p~gw~~~~~e~a~~w~e~wd~~~d~~f~  758 (861)
                      .+.....|.+++  .-.+.+.+..-||+.|        . .|-.+.|+...
T Consensus       574 ~~~~k~~n~~~~--~s~~~l~~~~e~~~~~--------~-~~~~~~d~~~~  613 (847)
T KOG0998|consen  574 LKGSKLVNGKDQ--NSSTELAGYLEGTING--------K-GLETSMDDSKE  613 (847)
T ss_pred             hhhhhccccccc--cchhhhhhhccccccc--------c-cccccccchhh
Confidence            666666676666  3445666777777766        1 45555555544

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK07720 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG3850 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria Back     alignment and domain information
>PF09602 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg); InterPro: IPR011728 This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2882 FliJ Flagellar biosynthesis chaperone [Cell motility and secretion / Intracellular trafficking and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF06009 Laminin_II: Laminin Domain II; InterPro: IPR010307 It has been suggested that the domains I and II from laminin A, B1 and B2 may come together to form a triple helical coiled-coil structure [] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF06705 SF-assemblin: SF-assemblin/beta giardin Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PF15450 DUF4631: Domain of unknown function (DUF4631) Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF14992 TMCO5: TMCO5 family Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PTZ00464 SNF-7-like protein; Provisional Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>TIGR02132 phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR subunit Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] Back     alignment and domain information
>KOG1760 consensus Molecular chaperone Prefoldin, subunit 4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF15456 Uds1: Up-regulated During Septation Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG5283 Phage-related tail protein [Function unknown] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>KOG2196 consensus Nuclear porin [Nuclear structure] Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04740 LXG: LXG domain of WXG superfamily; InterPro: IPR006829 This group of putative transposases is found in Gram-positive bacteria, mostly Bacillus members and is thought to be a Cytosolic protein Back     alignment and domain information
>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF00015 MCPsignal: Methyl-accepting chemotaxis protein (MCP) signalling domain; InterPro: IPR004089 Methyl-accepting chemotaxis proteins (MCPs) are a family of bacterial receptors that mediate chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behaviour [] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK00578 prfB peptide chain release factor 2; Validated Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PF04799 Fzo_mitofusin: fzo-like conserved region; InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query861
1qjt_A99 Solution Structure Of The Apo Eh1 Domain Of Mouse E 4e-08
2kgr_A111 Solution Structure Of Protein Itsn1 From Homo Sapie 1e-06
2khn_A121 Nmr Solution Structure Of The Eh 1 Domain From Huma 4e-05
2qpt_A550 Crystal Structure Of An Ehd Atpase Involved In Memb 8e-05
3fia_A121 Crystal Structure Of The Eh 1 Domain From Human Int 1e-04
1c07_A95 Structure Of The Third Eps15 Homology Domain Of Hum 3e-04
>pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 8/94 (8%)
Query: 9   FESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALK 68
           +E ++R+ +    GR+   +A AF + S LP  +L +IW  AD +    L +QEF+ AL+
Sbjct: 13  YEKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLADTDGKGVLSKQEFFVALR 72
Query: 69  LVTVAQSKRELTPDIVKAALYGPAATKIPPPQIN 102
           LV  AQ+  E++   +  A        +PPP+ +
Sbjct: 73  LVACAQNGLEVSLSSLSLA--------VPPPRFH 98
>pdb|2KGR|A Chain A, Solution Structure Of Protein Itsn1 From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr5524a Length = 111 Back     alignment and structure
>pdb|2KHN|A Chain A, Nmr Solution Structure Of The Eh 1 Domain From Human Intersectin-1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|2QPT|A Chain A, Crystal Structure Of An Ehd Atpase Involved In Membrane Remodelling Length = 550 Back     alignment and structure
>pdb|3FIA|A Chain A, Crystal Structure Of The Eh 1 Domain From Human Intersectin- 1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|1C07|A Chain A, Structure Of The Third Eps15 Homology Domain Of Human Eps15 Length = 95 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query861
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-32
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 4e-18
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 8e-31
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 1e-20
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-30
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 7e-20
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-28
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-19
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 2e-27
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 5e-17
2jq6_A139 EH domain-containing protein 1; metal binding prot 3e-27
2jq6_A139 EH domain-containing protein 1; metal binding prot 4e-15
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 1e-26
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 4e-15
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 2e-26
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 4e-16
1qjt_A99 EH1, epidermal growth factor receptor substrate su 2e-24
1qjt_A99 EH1, epidermal growth factor receptor substrate su 5e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-10
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-10
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-09
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 8e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-06
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 8e-07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-04
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-05
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-05
3akb_A166 Putative calcium binding protein; EF-hand, metal b 7e-04
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-04
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-05
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 7e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 7e-05
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 8e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1y1x_A191 Leishmania major homolog of programmed cell death 2e-04
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 3e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 6e-04
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
 Score =  120 bits (302), Expect = 3e-32
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 385 GSGNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLK 444
           GS          PW ++     + Y   F  +  D    I+G  A+N F   +L    L 
Sbjct: 1   GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59

Query: 445 QVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLP 484
            +W+LSD D D  L+L EFC A +L+   + G PLP  LP
Sbjct: 60  YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLP 99
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query861
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.92
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.86
1c07_A95 Protein (epidermal growth factor receptor pathway 99.84
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.84
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.83
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.82
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.82
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.75
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.71
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.7
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.64
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.6
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.58
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.55
1c07_A95 Protein (epidermal growth factor receptor pathway 99.54
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.52
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.44
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.39
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.94
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.92
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.88
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.87
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.86
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.85
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.85
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.84
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.84
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.81
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.8
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.79
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.79
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.77
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.77
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.76
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.76
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.76
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.75
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.75
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.75
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.74
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.73
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.73
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.73
3li6_A66 Calcium-binding protein; calcium signaling protein 98.72
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.7
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.69
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.69
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.66
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.65
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.65
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.64
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.64
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.64
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.63
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.62
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.61
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.61
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.61
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.61
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.6
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.6
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.6
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.6
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.59
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.59
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.59
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.59
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.59
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.58
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.58
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.58
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.58
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.58
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.58
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.57
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.57
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.57
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.57
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.57
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.57
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.57
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.56
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.56
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.55
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.55
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.55
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.55
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.54
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.54
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.54
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.53
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.53
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.53
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.53
3li6_A66 Calcium-binding protein; calcium signaling protein 98.53
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.52
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.52
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.51
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.51
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.51
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.51
3fwb_A161 Cell division control protein 31; gene gating, com 98.51
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.51
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.5
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.5
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.5
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.49
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.49
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.49
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.49
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.48
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.48
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.48
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.48
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.48
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.47
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.47
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.47
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.47
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.47
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.47
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.47
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.46
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.46
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.46
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.46
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.46
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.46
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.46
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.45
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.45
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.45
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.45
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.44
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.44
3fwb_A161 Cell division control protein 31; gene gating, com 98.44
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.44
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.44
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.44
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.43
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.42
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.42
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.42
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.42
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.42
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.42
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.41
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.41
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.41
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.41
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.41
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.41
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.4
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.4
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.4
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.4
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.4
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.39
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.39
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.39
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.39
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.38
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.38
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.38
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.38
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.38
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.37
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.37
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.36
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.36
1y1x_A191 Leishmania major homolog of programmed cell death 98.36
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.36
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.36
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.36
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.35
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.35
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.35
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.35
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.34
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.34
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.34
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.34
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.34
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.34
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.33
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.33
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.33
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.33
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.33
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.32
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.31
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.31
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.31
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.3
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.3
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.3
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.3
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.29
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.28
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.28
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.27
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.27
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.27
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.26
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.26
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.26
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.25
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.25
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.25
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.24
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.24
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.24
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.23
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.22
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.21
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.21
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.21
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.2
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.2
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.2
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.2
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.2
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.2
1y1x_A191 Leishmania major homolog of programmed cell death 98.19
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.19
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.19
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.19
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.19
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.19
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.19
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.18
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.18
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.17
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.17
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.17
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.17
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.17
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.16
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.16
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.16
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.16
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.16
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.15
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.12
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.12
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.11
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.11
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.11
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.11
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.09
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.08
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.08
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.05
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.03
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.03
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.02
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.01
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.0
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.99
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.99
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.99
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 97.97
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.97
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.96
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.96
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 97.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.95
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.94
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.92
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.91
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.91
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.91
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.91
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.91
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.9
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 97.89
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.89
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.89
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.88
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 97.87
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.87
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.86
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.85
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.85
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.79
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.77
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.71
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.69
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.69
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.66
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.61
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.59
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.56
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.55
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 97.53
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.53
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 97.51
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 97.51
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.48
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.46
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.46
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 97.45
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.44
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 97.44
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 97.31
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.28
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.26
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.24
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.21
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 97.17
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.14
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.09
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 96.74
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.7
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.7
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.66
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.63
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.54
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.52
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 96.44
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.43
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.43
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 96.32
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 96.29
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.19
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 96.13
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.11
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.08
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.96
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.86
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 95.82
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.77
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.7
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 95.6
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.5
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.44
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.43
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.38
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 95.3
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.16
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.09
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.08
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 95.05
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 95.02
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.02
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 95.01
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 95.01
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rin 94.96
3ajw_A150 Flagellar FLIJ protein; flagellum, type III secret 94.96
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 94.92
3l4q_C170 Phosphatidylinositol 3-kinase regulatory subunit b 94.81
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 94.8
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 94.72
1d7m_A101 Cortexillin I; coiled-coil, coiled-coil trigger si 94.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 94.55
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 94.55
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.49
2v4h_A110 NF-kappa-B essential modulator; transcription, met 94.46
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.44
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 94.15
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.13
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 94.02
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 94.01
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 93.89
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 93.85
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 93.8
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 93.79
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 93.67
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 93.58
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 93.57
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 93.53
3plt_A234 Sphingolipid long chain base-responsive protein L; 93.21
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 93.08
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 92.99
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 92.89
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 92.87
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 92.66
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 92.49
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 92.45
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 92.44
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 92.24
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 92.14
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 91.91
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 91.8
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 91.34
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 91.28
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 90.97
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 90.94
1m1j_C 409 Fibrinogen gamma chain; coiled coils, disulfide ri 90.61
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 90.56
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 90.47
2v4h_A110 NF-kappa-B essential modulator; transcription, met 90.34
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.33
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 90.15
3bas_A89 Myosin heavy chain, striated muscle/general contro 90.11
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 90.02
2jrf_A184 Tubulin polymerization-promoting protein family me 89.96
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 89.67
3ghg_B461 Fibrinogen beta chain; triple-stranded coiled coil 89.54
3k29_A169 Putative uncharacterized protein; YSCO, type III s 89.46
1t3j_A96 Mitofusin 1; coiled coil antiparallel, dimer, memb 89.32
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 89.31
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 89.29
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 89.27
2zdi_C151 Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 89.24
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 89.21
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 89.19
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 89.02
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 88.99
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 88.8
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 88.57
3r2p_A185 Apolipoprotein A-I; amphipathic alpha-helix, major 88.52
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 88.35
3uux_B242 Mitochondrial division protein 1; tetratricopeptid 88.12
3uun_A119 Dystrophin; triple helical, cell structure and sta 88.07
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 87.66
3ghg_B 461 Fibrinogen beta chain; triple-stranded coiled coil 87.65
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 87.61
2nrj_A346 HBL B protein; enterotoxin, hemolysis, transmembra 87.49
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 87.45
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 87.13
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 87.11
4fi5_A113 Nucleoprotein; structural genomics, niaid, nationa 87.11
2pms_C125 Pneumococcal surface protein A (PSPA); lactoferrin 86.83
4h22_A103 Leucine-rich repeat flightless-interacting protei; 86.77
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 86.63
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 86.42
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 86.05
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 85.97
3ni0_A99 Bone marrow stromal antigen 2; coiled-coil, antivi 85.87
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 85.8
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 85.33
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 85.2
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 85.16
2efl_A305 Formin-binding protein 1; EFC domain, structural g 85.14
3cl3_D130 NF-kappa-B essential modulator; death effector dom 85.1
2ic6_A78 Nucleocapsid protein; hantavirus, bunyaviridae, ss 84.98
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 84.94
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 84.84
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 84.78
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 84.77
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 84.75
1bf5_A 575 Signal transducer and activator of transcription 1 84.74
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 84.56
2xu6_A72 MDV1 coiled coil; protein binding, mitochondrial o 84.54
3cve_A72 Homer protein homolog 1; coiled coil, alternative 84.54
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 84.5
3vem_A115 Helicase protein MOM1; coiled-coil, hendecad, tran 84.46
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 84.4
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 84.32
3r6n_A 450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 84.2
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 84.17
2c5k_T95 Syntaxin TLG1, T-snare affecting A late golgi comp 84.02
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 83.93
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 83.9
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 83.84
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 83.8
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 83.37
2l7b_A307 Apolipoprotein E, APO-E; lipid transport, atherosc 83.13
2ic9_A96 Nucleocapsid protein; hantavirus, bunyaviridae, ss 82.95
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 82.87
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 82.61
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 82.5
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 82.49
1gqe_A365 Release factor 2, RF2; protein synthesis, ribosome 82.44
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 82.29
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 82.14
2avr_X119 Adhesion A; antiparallel helix-loop-helix, leucine 82.07
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 81.97
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 81.54
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 81.49
2qyw_A102 Vesicle transport through interaction with T-SNAR 81.46
3etw_A119 Adhesin A; antiparallel helix-loop-helix, leucine 81.36
1y1u_A 585 Signal transducer and activator of transcription; 81.01
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 80.88
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 80.67
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 80.57
4h22_A103 Leucine-rich repeat flightless-interacting protei; 80.51
3lay_A175 Zinc resistance-associated protein; salmonella typ 80.38
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 80.24
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 80.21
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 80.17
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
Probab=99.92  E-value=4.2e-25  Score=209.21  Aligned_cols=95  Identities=32%  Similarity=0.540  Sum_probs=90.0

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCccCHHHHHHHHHHHHHHh
Q 002980          395 QVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERYR  474 (861)
Q Consensus       395 ~~~Wp~ISpedk~~Y~~iF~~lD~d~dG~Isg~ea~~~f~ksgLp~e~L~~IW~LaD~d~dG~LdkdEF~vAMhLI~~~~  474 (861)
                      ..+| .|+++|+++|+++|+.+|+ ++|+|++++++.+|+++||+.++|++||+|+|.|+||+|+++||++|||||++++
T Consensus        22 ~~~W-~it~ee~~~y~~iF~~lD~-~dG~Isg~elr~~~~~sgLp~~~L~~Iw~laD~d~dG~Ld~~EF~~aM~Li~~~~   99 (121)
T 3fia_A           22 LDTW-AITVEERAKHDQQFHSLKP-ISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKL   99 (121)
T ss_dssp             TTTS-CCCHHHHHHHHHHHHHTCC-BTTBEEHHHHHHHHGGGCCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHHHHH
T ss_pred             CCCC-CCCHHHHHHHHHHHHHhCC-CCCeECHHHHHHHHHHcCCCHHHHHHHHHHHcCCCCCcCCHHHHHHHHHHHHHHH
Confidence            4679 7999999999999999998 8999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCcCcc
Q 002980          475 EGRPLPAVLPRNVMFDE  491 (861)
Q Consensus       475 ~G~~lP~~LPp~L~pp~  491 (861)
                      +|++||.+||+.|+.+.
T Consensus       100 ~G~~lP~~LP~~l~~~~  116 (121)
T 3fia_A          100 QGYQLPSALPPVMKQQP  116 (121)
T ss_dssp             TTCCCCSSCCGGGC---
T ss_pred             cCCCCCCCCCHHHHcCC
Confidence            99999999999999654
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Back     alignment and structure
>3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis} Back     alignment and structure
>1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>3r2p_A Apolipoprotein A-I; amphipathic alpha-helix, major protein of high density lipop (HDL), lipid binding, plasma, lipid transport; 2.20A {Homo sapiens} PDB: 1gw3_A 1gw4_A Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3uux_B Mitochondrial division protein 1; tetratricopeptide repeat, mitochondrial fission, mitochondri cytoplasm, apoptosis; 3.90A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fi5_A Nucleoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.20A {Hantaan virus} Back     alignment and structure
>2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} Back     alignment and structure
>2ic6_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 1.15A {Sin nombre virus} Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2xu6_A MDV1 coiled coil; protein binding, mitochondrial outer membrane, adapter prote organelle division; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>3vem_A Helicase protein MOM1; coiled-coil, hendecad, transcriptional gene silencing, siRNA nucleus, chromatin, transcription; 3.20A {Arabidopsis thaliana} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2c5k_T Syntaxin TLG1, T-snare affecting A late golgi compartment protein 1; protein transport/complex, snare, VFT complex, protein transport, phosphorylation; 2.05A {Saccharomyces cerevisiae} PDB: 2c5j_A 2c5i_T Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure
>2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} Back     alignment and structure
>2ic9_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 2.00A {Sin nombre virus} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V Back     alignment and structure
>3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 861
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 5e-20
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 3e-13
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-19
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-12
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 5e-19
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 1e-09
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 2e-18
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 2e-13
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 1e-17
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 5e-17
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 6e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-06
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 7e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 3e-04
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.001
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 5e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.002
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.002
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 2e-05
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 2e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 8e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-05
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 5e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 5e-04
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-04
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-04
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.002
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 8e-04
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 3e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 7e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 3e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 4e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 5e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.001
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 0.001
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.001
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.001
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.002
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.003
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.003
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 0.004
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Eps15 homology domain (EH domain)
domain: Eps15
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 83.5 bits (206), Expect = 5e-20
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
           PW  +KP D  KY  +F  +    +G ++G++ + + ++ +LP ++L +VW+LSD D D 
Sbjct: 1   PWA-VKPEDKAKYDAIFDSLS-PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDG 58

Query: 457 MLSLREFCFALYLMERYREGRPLPAVLP 484
           ML   EF  A++L+    E  P+P  LP
Sbjct: 59  MLDRDEFAVAMFLVYCALEKEPVPMSLP 86
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query861
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.91
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.06
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.03
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.0
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.97
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.93
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.92
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.92
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.88
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.88
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.87
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.86
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.86
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.84
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.83
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.82
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.79
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.78
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.78
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.76
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.73
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.73
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.73
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.73
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.73
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.72
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.72
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.72
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.72
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.72
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.71
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.7
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.66
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.65
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.64
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.63
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.62
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.61
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.6
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.6
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.59
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.58
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.56
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.56
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.5
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.49
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.48
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.47
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.47
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.46
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.46
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.44
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.44
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.42
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.41
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.39
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.39
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.38
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.37
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.37
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.36
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.36
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.35
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.35
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.33
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.32
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.3
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.29
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.28
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.28
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.27
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.27
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.26
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.25
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.24
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.23
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.23
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.22
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.21
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.21
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.21
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.19
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.17
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.16
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.16
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.15
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.15
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.15
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.13
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.12
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.12
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.11
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.1
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.1
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.1
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.1
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.1
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.09
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.09
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.08
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.07
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.07
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.07
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.05
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.04
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.03
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.02
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.01
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.97
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.95
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.94
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.92
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.91
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.88
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.87
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.86
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.8
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.79
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.76
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.75
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.73
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.72
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.72
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.71
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.71
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.71
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.7
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.65
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.58
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.51
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.27
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.2
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.05
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.02
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.01
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.88
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.79
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.63
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 96.54
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.49
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.48
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.6
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.49
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 95.37
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.19
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 94.97
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.45
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 94.29
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 93.16
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 91.75
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 91.44
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 91.34
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 91.13
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 90.26
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 89.82
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 89.44
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 89.1
d1gqea_ 362 Polypeptide chain release factor 2 (RF2) {Escheric 86.84
d1lrza165 Methicillin resistance protein FemA probable tRNA- 86.54
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 84.7
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 84.62
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 84.15
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 83.22
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 83.19
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 83.07
d1bg1a1186 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 82.55
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 81.98
d1bf5a1181 STAT-1, coiled coil domain {Human (Homo sapiens) [ 81.23
d1ez3a_124 Syntaxin 1A N-terminal domain {Rat (Rattus norvegi 81.01
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Eps15 homology domain (EH domain)
domain: Pob1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=1.1e-25  Score=207.37  Aligned_cols=99  Identities=31%  Similarity=0.597  Sum_probs=95.4

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCccCHHHHHHHHHHH
Q 002980          391 PDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLM  470 (861)
Q Consensus       391 ~~~~~~~Wp~ISpedk~~Y~~iF~~lD~d~dG~Isg~ea~~~f~ksgLp~e~L~~IW~LaD~d~dG~LdkdEF~vAMhLI  470 (861)
                      ++....+| +||++|+.+|+++|+.+|+|++|+|++++++.+|+++||+.++|++||+++|.|+||+|+++|||+|||||
T Consensus         7 ~~~~~~~~-~lt~ee~~~y~~lF~~~D~d~~G~Is~~e~~~~l~~s~L~~~~L~~Iw~l~D~d~dG~l~~~EF~~am~Li   85 (110)
T d1iq3a_           7 SSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLI   85 (110)
T ss_dssp             CCCCCSSC-CCSSSSHHHHHHHHHHHCCSSSSEEEHHHHHHHCCSSSCSSCCHHHHHHHHCSSSCSEEEHHHHHHHHHHH
T ss_pred             CCCCCCCC-ccCHHHHHHHHHHHHHhCCCcccchhHHHHHHHHHhhccchHHHHHHHHHhccCCCCeECHHHHHHHHHHH
Confidence            45677889 89999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCCCCCCCCcCc
Q 002980          471 ERYREGRPLPAVLPRNVMFD  490 (861)
Q Consensus       471 ~~~~~G~~lP~~LPp~L~pp  490 (861)
                      .++++|++||..||+.|+|.
T Consensus        86 ~~~~~G~~lP~~LP~~l~p~  105 (110)
T d1iq3a_          86 VARKNGYPLPEGLPPTLQPE  105 (110)
T ss_dssp             HHHHHTCCCCCCSSCCSCSS
T ss_pred             HHHHcCCCCCcccCcccCcc
Confidence            99999999999999999964
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lrza1 a.2.7.4 (A:245-309) Methicillin resistance protein FemA probable tRNA-binding arm {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1bg1a1 a.47.1.1 (A:136-321) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure