Citrus Sinensis ID: 003011

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------

MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPLTANTNETKSKIFTENSATSSEEECTKIRKFHNVSDYHKVHDWASAKGSTGIICISGEEKLEPNLKRICREKDKPNSIFSYV

cccHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHccccccccHHcccEEEEEEEEcccccHHHHHHHHcccccHHHHHHHHHccccEEEEcccEEEccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccEEEEEEEccccEEEEccccHHccccccccEEEEccccccccccEEEcccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccHHHHccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccEEEEEccccccccEEEEEEEEEEEcccccccccEEEEEEEEEccccccccccccEEEEEccccccccccccccccEEEEEEEccccccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEcccccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEccccccccccHHHHHHcccccccccccc

cHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHccccccEEEEEEEEccccccccccHHHHHHccccEEEEEEccccccccccEEEcccccccccHHcEEEEEcccccccccccccHHHHEEEcccccHHHHHHcccccccccEEEEcccccHcccccccccccccHEEEcccccccEEccccHHHHHHcEEEEccccccHccccccccHHHHEEEEccccccHccccHHHHHHHHEEcccccHEEccccHHHHcccEEEEccccccHccccccHHcHHcccEEEccccHHHHcccHHccccHHHHEEEccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEccccccHcccccccccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEEcccccccccccccHHHHHHHHHcccccccccccccccccEEEEEcccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccHHccccccccEEEEEccccccccccEEEEEEEEccccccccccEEEEEEEEEEccccccccccccEccccccccccccccEEcccEEEEEEccccccccccccccEEEEEEEEEEccccccEEEEEcEEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHccccccEEEEEccccccccccHEEEccccccccEEEc

MVLSTRVVDYAKGNPLALKVLGsffygrrkVDWENALHnlkrisdrdVYEVLKISYDELNWEEKNIFLDIacffkgedkdyvtriqddpDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVrcesvkepgkrsrlwhhEDIYHVLkknkgtdsieGIFLDMSKIREIHLSSRAFACMTNLRMLKfyvpklsklsdVKVHLHNGLDYLSDELRYLhwhgyplktlpsnfspenlielnlpyskveqMWEGKKESFKLKWIDLHHcqylirfpdpletpnlericlsdcidlpcipssienfNNLSILCLQgceslrrfpsnihfrspitldfsdclnltefpqfsgnikQLYLCGtaieevpsSVECLTELAELYMRQCTRLKSISSRICKlkslhllslddccrlerfpeiTETMECLEYFSlasttiqeqpssnedrilpssianwsygcrglilpplpglssltglnlsfrniteipkdigclsslrtldlrgnnfvslpasIKQFTQMEELILSNCNllqslpelppslILLEARNckqlqslpELSSYLEELDASKLETLSEysdvfaqpritftftnclklnRKSYNILADSELRMQHMATASLRLFYEKvfdvppqfsiclpgngipdwfsyqslgtsitiqlpqcNRRFIGLALSVVIEFEevfyggysfgvrceyqfetetlsgnqkgnwvcyltsasdykveDLLIYSNHvllgfdpclniqlpdgdlhataTFHFSLLCddcitenrigckvkcigvcpltantnetkskiftensatsseEECTKIrkfhnvsdyhkvhdwasakgstgiicisgeeklepNLKRIcrekdkpnsifsyv

mvlstrvvdyakgnplalkVLGSFFYGRRKVDWENAlhnlkrisdrdvyEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCEsvkepgkrsrlwhhediyhvlkknkgtdsIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLkslhllslddcCRLERFPEITETMECLEYFSLASTtiqeqpssneDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFtftnclklnRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETEtlsgnqkgnWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPltantnetkskiftensatsseeECTKIRKFHNVSDYHKVHDwasakgstgiicisgeeklepnlkricrekdkpnsifsyv

MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICklkslhllslddccrlERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCRglilpplpglssltglnlsFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNllqslpelppslilleARNCKQlqslpelssyleelDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPLTANTNETKSKIFTENSATSSEEECTKIRKFHNVSDYHKVHDWASAKGSTGIICISGEEKLEPNLKRICREKDKPNSIFSYV

*****RVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTT***********ILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPLTANT*******************CTKIRKFHNVSDYHKVHDWASAKGSTGIICISGE************************

MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPLT******************************************************************************YV

MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTT*********DRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPLTANTNETKSKIFT**********CTKIRKFHNVSDYHKVHDWASAKGSTGIICISGEEKLEPNLKRICREKDKPNSIFSYV

MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWEEKNIFLDIACFFKGEDKDYVTRIQDDPDFVRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITIQLPQCNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQKGNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPL************************************HKVHDWASAKGSTGIICISGEEKLEPNLKRICREKDKPNSIFSYV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		857	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.731	0.548	0.330	1e-85
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.502	0.227	0.399	5e-77
O82500		1095	Putative disease resistan	no	no	0.430	0.336	0.408	5e-68
Q9FH83		1288	Probable WRKY transcripti	no	no	0.707	0.470	0.296	1e-63
Q9FL92		1372	Probable WRKY transcripti	no	no	0.474	0.296	0.343	2e-58
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.689	0.454	0.295	2e-51
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.675	0.358	0.272	1e-48
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.249	0.208	0.280	3e-13
P0CB16		1201	Putative disease resistan	no	no	0.429	0.306	0.239	2e-10
Q3KQF4		345	Leucine-rich repeat-conta	N/A	no	0.207	0.515	0.313	1e-09

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  318 bits (815), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 224/677 (33%), Positives = 356/677 (52%), Gaps = 50/677 (7%)

Query: 3    LSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWE 62
            LS  VV+YAKG PLALKV GS  +  R  +W++A+ ++K  S   + + LKISYD L  +
Sbjct: 374  LSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPK 433

Query: 63   EKNIFLDIACFFKGEDKDYVTRIQDDPDF-VRYVLNVLVNKSLITISSYNKLEMHDLLEE 121
            ++ +FLDIACF +GE+KDY+ +I +       Y L +L++KSL+ IS YN+++MHDL+++
Sbjct: 434  QQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQD 493

Query: 122  MGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSRAFA 181
            MG+ IV  +  K+PG+RSRLW  +++  V+  N GT ++E I++  S    +  S++A  
Sbjct: 494  MGKYIVNFQ--KDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVS-SYSSTLRFSNQAVK 550

Query: 182  CMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIE 241
             M  LR+              +   H  +DYL + LR      YP ++ PS F  + L+ 
Sbjct: 551  NMKRLRVFNM----------GRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVH 600

Query: 242  LNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPS 301
            L L ++ +  +W   K    L+ IDL   + L R PD    PNLE + L  C +L  +  
Sbjct: 601  LQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHH 660

Query: 302  SIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIK---QLYL 358
            S+   + +  L L  C+SL+RFP  ++  S   L    C +L + P+  G +K   Q+++
Sbjct: 661  SLGCCSKVIGLYLNDCKSLKRFPC-VNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHM 719

Query: 359  CGTAIEEVPSSV-ECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEI 417
             G+ I E+PSS+ +  T + +L +     L ++ S IC+LKSL  LS+  C +LE  PE 
Sbjct: 720  QGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEE 779

Query: 418  TETMECLEYFSLASTTIQEQPSS--NEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLN 475
               ++ L  F  + T I   PSS    ++++      +  G      P   GL SL  LN
Sbjct: 780  IGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLN 839

Query: 476  LSFRNITE--IPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPE 533
            LS+ N+ +  +P++IG LSSL+ LDL  NNF  LP+SI Q   ++ L L +C  L  LPE
Sbjct: 840  LSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPE 899

Query: 534  LPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLN 593
            LPP L  L       L+ +  L +  ++L   KL+    ++D        F +T    ++
Sbjct: 900  LPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLD--DAHNDTMYN---LFAYTMFQNIS 954

Query: 594  RKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWFSYQSLGTSITI 653
               ++I A   L        SL +F  + +   P+         IP WF +Q   +S+++
Sbjct: 955  SMRHDISASDSL--------SLTVFTGQPY---PE--------KIPSWFHHQGWDSSVSV 995

Query: 654  QLPQ---CNRRFIGLAL 667
             LP+      +F+G A+
Sbjct: 996  NLPENWYIPDKFLGFAV 1012

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

>sp\|Q3KQF4\|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		857
297813715		1212	hypothetical protein ARALYDRAFT_327329 [	0.850	0.601	0.389	1e-131
359496026		1250	PREDICTED: TMV resistance protein N-like	0.815	0.559	0.392	1e-128
359486071		1261	PREDICTED: TMV resistance protein N-like	0.904	0.614	0.361	1e-127
15234388		1219	TIR-NBS-LRR class disease resistance pro	0.851	0.598	0.389	1e-126
359486073		1296	PREDICTED: TMV resistance protein N-like	0.858	0.567	0.372	1e-125
227438275		1226	disease resistance protein [Brassica rap	0.870	0.608	0.376	1e-124
224127750		1018	tir-nbs-lrr resistance protein [Populus	0.789	0.665	0.380	1e-122
359493273		1233	PREDICTED: TMV resistance protein N-like	0.917	0.637	0.358	1e-122
224127754		1125	tir-nbs-lrr resistance protein [Populus	0.704	0.536	0.412	1e-122
255537139		1137	leucine-rich repeat-containing protein,	0.782	0.590	0.394	1e-121

>gi\|297813715\|ref\|XP_002874741.1\| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] gi\|297320578\|gb\|EFH51000.1\| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

 Score =  476 bits (1224), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 308/790 (38%), Positives = 443/790 (56%), Gaps = 61/790 (7%)

Query: 3    LSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWE 62
            L+  V+DYAKG+PLALKVLGS    R  + WE  L  LK  S  D+YEVL+ SY+EL  E
Sbjct: 360  LTNMVLDYAKGHPLALKVLGSDLCERDNLYWEAKLDRLKCRSHGDIYEVLETSYEELTIE 419

Query: 63   EKNIFLDIACFFKGEDKDYVTRIQDDPDF-VRYVLNVLVNKSLITISSYNKLEMHDLLEE 121
            +KN+FLDIACFF+ E+ DYVT + +     V  V+  LV+K LIT+S  N++EMHD+L+ 
Sbjct: 420  QKNVFLDIACFFRSENVDYVTSLLNSHGVDVSSVIKDLVDKCLITLSD-NRIEMHDMLQT 478

Query: 122  MGREI-VRCESVKEPGKRS---------------RLWHHEDIYHVLKKNKGTDSIEGIFL 165
            MG+EI ++ E++   G R                RLW  EDI  +L K +GTD I GIFL
Sbjct: 479  MGKEISLKAETI---GIRDFTWLSRHGNQCQWHIRLWDSEDICDILTKGQGTDKIRGIFL 535

Query: 166  DMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDV--KVHLHNGLDYLSDELRYLHWH 223
            D SK+R + LS++A   M NL+ LK Y    S+  +V  K+HL  GLDYL +EL YLHWH
Sbjct: 536  DTSKLRAMRLSAKALKGMYNLKYLKIYDSHCSRGCEVEFKLHLRKGLDYLPNELTYLHWH 595

Query: 224  GYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETP 283
            GYPL+++P +F P+NL++L LP+S++ ++W+ +K++  LKW+DL H   L +        
Sbjct: 596  GYPLQSIPLDFDPKNLVDLKLPHSQLAEIWDDEKDAGMLKWVDLSHSLNLHQCLGLANAQ 655

Query: 284  NLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNL 343
            NLER+ L  C  L  +P++I     L  L L+ C SLR  P  +  +S  TL  S C  L
Sbjct: 656  NLERLNLEGCTSLKKLPTTINGLEKLVYLNLRDCTSLRSLPKGLKTQSLQTLILSGCSRL 715

Query: 344  TEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLL 403
             +FP  S N++ L L GTAI+ +P S+E L  LA L ++ C +LK +SS + KLK L  L
Sbjct: 716  KKFPLISENVEVLLLDGTAIKSLPESIETLRRLALLNLKNCKKLKHLSSDLYKLKCLQEL 775

Query: 404  SLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNE-DRILPSSIANWS--YGCRGL 460
             L  C RLE FPEI E ME LE   +  T I E P       I   S+   S        
Sbjct: 776  ILSGCSRLEVFPEIKEDMESLEILLMDDTAITEMPKMMHLSNIQTFSLCGTSSQVSVSMF 835

Query: 461  ILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEEL 520
             +PP  G S LT L LS  ++ ++P +IG LSSL++L L GNN  +LP S  Q   ++  
Sbjct: 836  FMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLHNLKWF 895

Query: 521  ILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQP 580
             L  C +L+SLP LP +L  L+A  C+ L++L            + L  L+    V  + 
Sbjct: 896  DLKFCKMLKSLPVLPQNLQYLDAHECESLETL-----------ENPLTPLT----VGERI 940

Query: 581  RITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPD 640
               F F+NC KLN+ + +++  + ++ Q MA AS++ +Y + F   P   IC     IP 
Sbjct: 941  HSMFIFSNCYKLNQDAQSLVGHARIKSQLMANASVKRYY-RGFIPEPLVGICYAATDIPS 999

Query: 641  WFSYQSLGTSITIQLPQ--CNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSG 698
            WF +Q LG S+ I LP   C+  F+GLALSVV+ F +       F V+C  +FE      
Sbjct: 1000 WFCHQRLGRSLEIPLPPHWCDTDFVGLALSVVVSFMDYEDSAKRFSVKCCGKFE------ 1053

Query: 699  NQKGNWVCYLTSASDYKV-------EDLLIYSNHVLLGFDPCLNIQLPDGD----LHATA 747
            NQ G++  +  + + +         E   + S+HV +G++ C +++   G+     +  A
Sbjct: 1054 NQDGSFTRFDFTLAGWNEPCGSLSHEPRKLASDHVFMGYNSCFHVKNLHGESKNCCYTKA 1113

Query: 748  TFHFSLLCDD 757
            +F F +  D+
Sbjct: 1114 SFEFYVTDDE 1123

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359496026\|ref\|XP_002277166.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359486071\|ref\|XP_002272667.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|15234388\|ref\|NP_192938.1\| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi\|4586106\|emb\|CAB40942.1\| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi\|7267902\|emb\|CAB78244.1\| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi\|332657683\|gb\|AEE83083.1\| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|359486073\|ref\|XP_002272820.2\| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|227438275\|gb\|ACP30627.1\| disease resistance protein [Brassica rapa subsp. pekinensis]	Back alignment and taxonomy information

>gi\|224127750\|ref\|XP_002329168.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870949\|gb\|EEF08080.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359493273\|ref\|XP_002272034.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224127754\|ref\|XP_002329169.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870950\|gb\|EEF08081.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255537139\|ref\|XP_002509636.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223549535\|gb\|EEF51023.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		857
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.873	0.614	0.352	2.3e-110
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.505	0.334	0.410	2.7e-96
TAIR\|locus:2122965		1210	AT4G19510 [Arabidopsis thalian	0.815	0.577	0.312	7.6e-90
TAIR\|locus:2122209		1179	AT4G36150 [Arabidopsis thalian	0.498	0.362	0.364	9.1e-85
TAIR\|locus:2153363		1261	AT5G45200 [Arabidopsis thalian	0.584	0.397	0.330	6.6e-82
TAIR\|locus:2155189		980	AT5G49140 [Arabidopsis thalian	0.499	0.436	0.374	6.3e-77
TAIR\|locus:2146243		900	AT5G18360 [Arabidopsis thalian	0.449	0.427	0.423	8.5e-75
TAIR\|locus:2158475		1217	RPS4 "RESISTANT TO P. SYRINGAE	0.502	0.354	0.356	2.2e-74
TAIR\|locus:2136108		1095	AT4G11170 [Arabidopsis thalian	0.429	0.336	0.409	4.8e-74
TAIR\|locus:2170333		1197	CSA1 "constitutive shade-avoid	0.502	0.360	0.370	1.1e-73

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1090 (388.8 bits), Expect = 2.3e-110, P = 2.3e-110
 Identities = 281/797 (35%), Positives = 409/797 (51%)

Query:     3 LSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNWE 62
             L+  V+DYAKG+PLALKVLGS    R  + WE  L  LK  S  D+YEVL+ SY+EL  E
Sbjct:   371 LTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTE 430

Query:    63 EKNIFLDIACFFKGEDKDYVTRIQDDPDF-VRYVLNVLVNKSLITISSYNKLEMHDLLEE 121
             +KN+FLDIACFF+ E+ DYVT + +     V  V+  LV+K LIT+S  N++EMHD+L+ 
Sbjct:   431 QKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSD-NRIEMHDMLQT 489

Query:   122 MGREI--------VR-CESVKEPGKRS----RLWHHEDIYHVLKKNKGTDSIEGIFLDMS 168
             M +EI        +R C  +   G +     RLW  EDI  +L +  GTD I GIFLD S
Sbjct:   490 MAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTS 549

Query:   169 KIREIHLSSRAFACMTNLRMLKFYVPKLSK--LSDVKVHLHNGLDYLSDELRYLHWHGYP 226
             K+R + LS++AF  M NL+ LK Y    S+   ++ K+HL  GL +L +EL YLHWHGYP
Sbjct:   550 KLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYP 609

Query:   227 LKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLE 286
             L+++P +F P+NL++L LP+S++E++W+ +K+   LKW+DL H   L +        NLE
Sbjct:   610 LQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLE 669

Query:   287 RICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEF 346
             R+ L  C  L  +PS+I     L  L L+ C SLR  P  I  +S  TL  S C +L +F
Sbjct:   670 RLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKF 729

Query:   347 PQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICXXXXXXXXXXX 406
             P  S N++ L L GT I+ +P S++    LA L ++ C +LK +SS +            
Sbjct:   730 PLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILS 789

Query:   407 XXXXXERFPEITETMECLEYFSLASTTIQEQPSSNE-DRILPSSIANWSYGCRXXXXXXX 465
                  E FPEI E ME LE   +  T+I E P       I   S+   S           
Sbjct:   790 GCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMP 849

Query:   466 XXXXXXXXXXXXFR--NITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILS 523
                             ++ ++P +IG LSSL++L L GNN  +LP S  Q   ++   L 
Sbjct:   850 PTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLK 909

Query:   524 NCNXXXXXXXXXXXXXXXXARNCKQXXXXXXXXXXXXXXDASKLETLSEYSDVFAQPRIT 583
              C                 A  C+                A+ L  L+    + +     
Sbjct:   910 FCKMLKSLPVLPQNLQYLDAHECESLETL-----------ANPLTPLTVGERIHSM---- 954

Query:   584 FTFTNCLKLNRKSY-NILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPDWF 642
             F F+NC KLN+ +  +++  + ++ Q MA AS + +Y + F   P   IC P   IP WF
Sbjct:   955 FIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYY-RGFVPEPLVGICYPATEIPSWF 1013

Query:   643 SYQSLGTSITIQLPQ--CNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQ 700
              +Q LG S+ I LP   C+  F+GLALSVV+ F++       F V+C   FE +  S  +
Sbjct:  1014 CHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTR 1073

Query:   701 KGNWVC-YLTSASDYKVEDLLIYSNHVLLGFDPCLNIQLPDGD----LHATATFHFSLLC 755
                 +  +         E   + S+HV +G++ C  ++   G+     +  A+F F +  
Sbjct:  1074 FDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTD 1133

Query:   756 DDCITENRIG-CKV-KC 770
             D+  T  +I  C+V KC
Sbjct:  1134 DE--TRKKIETCEVIKC 1148

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

GO:0006612 "protein targeting to membrane" evidence=RCA

GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA

GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		857
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-94
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-10
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-07
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-07
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	3e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	4e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	2e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	5e-04
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	0.001
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	0.001
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.002
pfam07725		20	pfam07725, LRR_3, Leucine Rich Repeat	0.002
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.004

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  319 bits (820), Expect = 4e-94
 Identities = 240/714 (33%), Positives = 337/714 (47%), Gaps = 90/714 (12%)

Query: 1    MVLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELN 60
            M L++ V   A   PL L VLGS+  GR K DW + L  L+   D  + + L++SYD LN
Sbjct: 375  MELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLN 434

Query: 61   -WEEKNIFLDIACFFKGEDKDYVTRIQDDPDF-VRYVLNVLVNKSLITISSYNKLEMHDL 118
              ++K IF  IAC F GE  + +  +  + D  V   L  LV+KSLI +   + +EMH L
Sbjct: 435  NKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSL 493

Query: 119  LEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSR 178
            L+EMG+EIVR +S  EPG+R  L   +DI  VL+ N GT  + GI LD+ +I E+H+   
Sbjct: 494  LQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHEN 552

Query: 179  AFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPEN 238
            AF  M NL  LKFY  K  +  +V+ HL  G DYL  +LR L W  YPL+ +PSNF PEN
Sbjct: 553  AFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPEN 612

Query: 239  LIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPC 298
            L++L +  SK+E++W+G      L+ IDL   + L   PD     NLE + LSDC  L  
Sbjct: 613  LVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVE 672

Query: 299  IPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYL 358
            +PSSI+  N L  L +  CE+L   P+ I+ +S   L+ S C  L  FP  S NI  L L
Sbjct: 673  LPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDL 732

Query: 359  CGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEIT 418
              TAIEE PS++  L  L EL +             C++KS  L         ER   +T
Sbjct: 733  DETAIEEFPSNLR-LENLDELIL-------------CEMKSEKL--------WERVQPLT 770

Query: 419  ETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWS-------YGCRGLI-LPPLPGLSS 470
              M  L   SL    + + PS  E   LPSSI N           C  L  LP    L S
Sbjct: 771  PLMTMLSP-SLTRLFLSDIPSLVE---LPSSIQNLHKLEHLEIENCINLETLPTGINLES 826

Query: 471  LTGLNLSFRNITEIPKDIGCLSSLRT----------LDLRGNNFVSLPASIKQFTQMEEL 520
            L  L+LS           GC S LRT          L+L       +P  I++F+ +  L
Sbjct: 827  LESLDLS-----------GC-SRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFL 874

Query: 521  ILSNCNLLQSLPELPPSLILLEARNCKQLQSLPELSSYLEELDASKLETLSEYSDVFAQP 580
             ++ CN LQ +      L  LE  +     +L E S        S++   ++        
Sbjct: 875  DMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASW---NGSPSEVAMATDNIHSKLPS 931

Query: 581  RITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPPQFSICLPGNGIPD 640
             +   F NC  L++++        L  Q      L L  E+V                P 
Sbjct: 932  TVCINFINCFNLDQEA--------LLQQQSIFKQLILSGEEV----------------PS 967

Query: 641  WFSYQSLGTSIT-IQLPQCN--RRFIGLALSVVIEFEEVFYGGYSFGVRCEYQF 691
            +F++++ G S+T I L   +  + F       V++ E  F    SF ++   +F
Sbjct: 968  YFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRF 1021

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|191828 pfam07725, LRR_3, Leucine Rich Repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		857
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.94
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.94
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.93
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.92
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.9
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.9
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.83
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.83
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.79
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.72
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.69
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.64
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.49
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.48
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.47
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.46
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.4
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.37
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.16
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.96
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.92
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.87
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.86
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.77
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.75
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.67
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.66
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.66
PRK15386		426	type III secretion protein GogB; Provisional	98.58
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.54
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.51
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.44
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.43
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.36
PRK15386		426	type III secretion protein GogB; Provisional	98.36
PLN03150		623	hypothetical protein; Provisional	98.35
PLN03150		623	hypothetical protein; Provisional	98.32
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.26
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.09
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.01
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.0
KOG4341		483	consensus F-box protein containing LRR [General fu	97.95
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.94
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.94
KOG4341		483	consensus F-box protein containing LRR [General fu	97.79
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.74
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.73
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.56
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.54
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.49
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.21
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.19
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.13
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.01
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.88
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.82
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.7
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.34
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.69
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.6
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.01
KOG1947		482	consensus Leucine rich repeat proteins, some prote	94.88
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.8
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.49
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.62
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.54
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.49
PRK04841		903	transcriptional regulator MalT; Provisional	92.44
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.65
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.26
KOG0473		326	consensus Leucine-rich repeat protein [Function un	89.52
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	89.36
KOG4308		478	consensus LRR-containing protein [Function unknown	84.76
smart00370		26	LRR Leucine-rich repeats, outliers.	83.62
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.62
KOG0473		326	consensus Leucine-rich repeat protein [Function un	82.87
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.65
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	81.37
smart00370		26	LRR Leucine-rich repeats, outliers.	81.37

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=1.9e-83  Score=803.81  Aligned_cols=697  Identities=32%  Similarity=0.474  Sum_probs=578.7

Q ss_pred             chHHHHHHhcCCChHHHHHHHhhhcCCCHHHHHHHHHHHhhcCChhHHHHHHHhHhccCH-HHHHHhhhhhcCCCCCCHH
Q 003011            2 VLSTRVVDYAKGNPLALKVLGSFFYGRRKVDWENALHNLKRISDRDVYEVLKISYDELNW-EEKNIFLDIACFFKGEDKD   80 (857)
Q Consensus         2 ~l~~~iv~~c~GlPLAlkvlG~~L~~k~~~~W~~~l~~L~~~~~~~i~~~Lk~SYd~L~~-~~K~cFl~~a~Fp~~~~~~   80 (857)
                      +++++||++|+|+||||+++|+.|++|+.++|++++++|++.++.+|+++|++|||+|++ .+|.||+||||||++++++
T Consensus       376 ~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~  455 (1153)
T PLN03210        376 ELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVN  455 (1153)
T ss_pred             HHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHH
Confidence            689999999999999999999999999999999999999998889999999999999986 5999999999999999999


Q ss_pred             HHHHHhcCCCc-hHHHHHHhhcccceeeecCCeEeccHHHHHHHHHHhhhccCCCCCcceeeccccchhhhcccCcccCc
Q 003011           81 YVTRIQDDPDF-VRYVLNVLVNKSLITISSYNKLEMHDLLEEMGREIVRCESVKEPGKRSRLWHHEDIYHVLKKNKGTDS  159 (857)
Q Consensus        81 ~l~~~~~~~g~-~~~~l~~Li~rsLi~~~~~~~~~MHDLl~dl~~~i~~~e~~~~~~~~~rl~~~~di~~vl~~~~~~~~  159 (857)
                      ++..++.++|+ ++.+++.|++||||+++ .++++||||+|+||++|+++++ .+|++|+|+|+++||++++.+++|+++
T Consensus       456 ~v~~~l~~~~~~~~~~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~  533 (1153)
T PLN03210        456 DIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKK  533 (1153)
T ss_pred             HHHHHHHhcCCCchhChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccce
Confidence            99999988888 88899999999999998 7899999999999999999998 789999999999999999999999999


Q ss_pred             EEEEEeecCCceeeecChHhhcCCCCccEEEEecCCccccccceeecCCccccccCCeeEEEEeCCCCCCCCCCCCCCCc
Q 003011          160 IEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENL  239 (857)
Q Consensus       160 i~~i~L~~~~~~~~~l~~~~f~~l~~Lr~L~l~~n~~~~~~~~~~~l~~~l~~l~~~Lr~L~l~~~~l~~lp~~~~l~~L  239 (857)
                      +++|++|++...+..+..++|.+|++|++|.++.+.+.........+|+++..+|.+||+|+|.+|+++.+|..|.+.+|
T Consensus       534 v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L  613 (1153)
T PLN03210        534 VLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENL  613 (1153)
T ss_pred             eeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCC
Confidence            99999999999999999999999999999999877543334456789999999999999999999999999999999999


Q ss_pred             cEEEcCCCCCcccccCcCCCCCccEEEccCCCCCccCCCCCCCCccceeeccCCccCCccCCcccCCCCCcEEeccCCCC
Q 003011          240 IELNLPYSKVEQMWEGKKESFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCES  319 (857)
Q Consensus       240 ~~L~Ls~n~l~~l~~~~~~l~~L~~L~Ls~~~~l~~lp~l~~l~~L~~L~L~~~~~~~~~p~~i~~l~~L~~L~L~~c~~  319 (857)
                      ++|+|++|+++.+|.++..+++|+.|+|++|..+..+|+++.+++|++|+|++|..+..+|.+++++++|+.|++++|+.
T Consensus       614 ~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~  693 (1153)
T PLN03210        614 VKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCEN  693 (1153)
T ss_pred             cEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCC
Confidence            99999999999999999999999999999998899999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCCCCCCCcEEEcCCCCCCCcccccccCcceEEecCccceecCccccCCCcceEEEccCcccccc-------ccc
Q 003011          320 LRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKS-------ISS  392 (857)
Q Consensus       320 l~~lp~~~~l~~L~~L~Ls~~~~l~~~p~~~~~L~~L~L~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~~-------lp~  392 (857)
                      ++.+|..+.+++|+.|++++|..+..+|....+|+.|++++|.+..+|..+ .+++|++|.+.++.....       .+.
T Consensus       694 L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~  772 (1153)
T PLN03210        694 LEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPL  772 (1153)
T ss_pred             cCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccc-cccccccccccccchhhccccccccchh
Confidence            999999889999999999999999999999999999999999999999876 688999999987543211       111


Q ss_pred             cccCCCCCCEeeccCCCCCCccccccCCCCCCCEEeccCC-ccccCCCCcccccCcCCcceeeccccCCcCCCCCCCCCC
Q 003011          393 RICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLAST-TIQEQPSSNEDRILPSSIANWSYGCRGLILPPLPGLSSL  471 (857)
Q Consensus       393 ~l~~l~~L~~L~Ls~~~~~~~~~~~l~~l~~L~~L~L~~n-~i~~lp~~~~~~~lp~~L~~L~l~~~~~~~~~l~~l~~L  471 (857)
                      .....++|+.|++++|.....+|..++++++|+.|++++| .++.+|...                         ++++|
T Consensus       773 ~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-------------------------~L~sL  827 (1153)
T PLN03210        773 MTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-------------------------NLESL  827 (1153)
T ss_pred             hhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-------------------------Ccccc
Confidence            2234578999999999999999999999999999999986 466666532                         46788


Q ss_pred             cEEEeeCCCCcc-CCCcCCCCCCCCeeeCCCCcceeccccccCCCCCcEEecccccccccCCCCC---CCcceeeccccc
Q 003011          472 TGLNLSFRNITE-IPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLPELP---PSLILLEARNCK  547 (857)
Q Consensus       472 ~~L~Ls~n~l~~-lp~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~l~---~sL~~L~i~~C~  547 (857)
                      +.|+|++|.... +|..   .++|+.|+|++|.++.+|.++..+++|+.|+|++|+.++.+|..+   ++|+.+++.+|+
T Consensus       828 ~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~  904 (1153)
T PLN03210        828 ESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCG  904 (1153)
T ss_pred             CEEECCCCCcccccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCc
Confidence            999999875443 5543   468999999999999999999999999999999999999888543   567788999999


Q ss_pred             CCCcccCcchhhhhhhhhhhhhhccccccccCCceEEEecccccccHhhhhhhhhHHHHHHHHhhhhhhhhhccccCCCC
Q 003011          548 QLQSLPELSSYLEELDASKLETLSEYSDVFAQPRITFTFTNCLKLNRKSYNILADSELRMQHMATASLRLFYEKVFDVPP  627 (857)
Q Consensus       548 ~L~~l~~~~~~l~~L~~~~l~~L~~~~~~~~~~~~~l~~~nC~~L~~~~~~~i~~~~~~~~~~~~~~l~~~~~~~~~~~~  627 (857)
                      +|+.++..........+....     ...+ .....+.|.||++|++.+...       .+                 ..
T Consensus       905 ~L~~~~l~~~~~~~~~~~~n~-----~~~~-p~~~~l~f~nC~~L~~~a~l~-------~~-----------------~~  954 (1153)
T PLN03210        905 ALTEASWNGSPSEVAMATDNI-----HSKL-PSTVCINFINCFNLDQEALLQ-------QQ-----------------SI  954 (1153)
T ss_pred             ccccccCCCCchhhhhhcccc-----cccC-CchhccccccccCCCchhhhc-------cc-----------------cc
Confidence            998776432211111111100     0001 122356789999998755211       00                 11


Q ss_pred             ceeEecCCCCCCCCccccCCccEEE-EEcCC--CCCccceEEEEEEEEeeccccCCcceeEEEEEEEecCccccccc---
Q 003011          628 QFSICLPGNGIPDWFSYQSLGTSIT-IQLPQ--CNRRFIGLALSVVIEFEEVFYGGYSFGVRCEYQFETETLSGNQK---  701 (857)
Q Consensus       628 ~~~~~lpg~~iP~Wf~~~~~g~sv~-i~lp~--~~~~~~g~~~c~v~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~---  701 (857)
                      ...+++||.++|+||.||+.|++++ |.+|+  ....|.||++|+|+++.........+++.|.|+|+++.+.....   
T Consensus       955 ~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~ 1034 (1153)
T PLN03210        955 FKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFDSPYQ 1034 (1153)
T ss_pred             ceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCCccccCCC
Confidence            2347899999999999999999998 99988  45679999999999987654444578899999999865432110   


Q ss_pred             -CCceecccccCCccccccccCcceEEEEEEcCCCccC----CCCCCcceEEEEEEEeecCCccccccccEEEEeeeeee
Q 003011          702 -GNWVCYLTSASDYKVEDLLIYSNHVLLGFDPCLNIQL----PDGDLHATATFHFSLLCDDCITENRIGCKVKCIGVCPL  776 (857)
Q Consensus       702 -~~~~~~~~~~~~~~~~~~~~~sdh~~~~~~~~~~~~~----~~~~~~~~~~f~f~~~~~~~~~~~~~~~~vk~cGv~~i  776 (857)
                       +.|.             .....+|+++|... .....    ..+-.+++++|+|+.++ ..     ..++|++|||+++
T Consensus      1035 ~~~~~-------------~~~~~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~f~~~~-~~-----~~~~~~~cg~~~~ 1094 (1153)
T PLN03210       1035 PHVFS-------------VTKKGSHLVIFDCC-FPLNEDNAPLAELNYDHVDIQFRLTN-KN-----SQLKLKGCGIRLS 1094 (1153)
T ss_pred             ceeEe-------------eeccccceEEeccc-ccccccccchhccCCceeeEEEEEec-CC-----CCeEEEeeeEEEe
Confidence             1111             12345566654322 11111    01115888999998872 11     2479999999999


Q ss_pred             ccC
Q 003011          777 TAN  779 (857)
Q Consensus       777 ~~~  779 (857)
                      |+.
T Consensus      1095 ~~~ 1097 (1153)
T PLN03210       1095 EDD 1097 (1153)
T ss_pred             ccC
Confidence            964

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		857
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		7e-05

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 19/179 (10%) Query: 159 SIEGIFLDMSKIREIHLSSRAFACMTNLRMLKFYV-PKLSKLSDVKVHL-----HNGLDY 212 +E + L + +R + S A + LR L P+L++L + H GL Sbjct: 128 GLETLTLARNPLRALPAS---IASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVN 184 Query: 213 LSDELRYLHWHGYPLKTLPSNFSP-ENLIELNLPYSKVEQMWEGKKESFKLKWIDLHHCQ 271 L LR L W G +++LP++ + +NL L + S + + KL+ +DL C Sbjct: 185 LQS-LR-LEWTG--IRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCT 240 Query: 272 YLIRFPDPL---ETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNI 327 L +P P+ P L+R+ L DC +L +P I L L L+GC +L R PS I Sbjct: 241 ALRNYP-PIFGGRAP-LKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLI 297

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		857
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-45
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-44
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-38
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-30
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-26
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-26
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-20
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-17
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-27
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-25
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-24
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-21
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-23
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-20
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-22
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-20
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-19
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-19
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-16
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-19
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-17
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-19
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-19
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-15
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-15
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-18
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	9e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-17
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-16
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-16
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-15
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	6e-15
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-14
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-14
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-13
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	9e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-13
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-13
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	7e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-12
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-08
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	5e-12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-11
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-11
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	8e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-11
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-10
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-10
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-08
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	4e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-09
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-05
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	7e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	9e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-07
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	7e-07
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-06
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-06
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	9e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	9e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	1e-05
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	2e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	5e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  163 bits (415), Expect = 9e-45
 Identities = 57/303 (18%), Positives = 99/303 (32%), Gaps = 38/303 (12%)

Query: 284 NLERICLSDCIDLPCIPSSIENFNNLSILCLQGCESLRRFPSNIHFRSPITLDFSDCLNL 343
             E +       L      +  +            S  R  +     +   ++      L
Sbjct: 13  GRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRAL 68

Query: 344 TEFPQFSGNIKQ-----LYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLK 398
                   +  Q     L L    + + P     L+ L  + +     L  +   + +  
Sbjct: 69  KATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQFA 127

Query: 399 SLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCR 458
            L  L+L     L   P    ++  L   S+ +          E   LP  +A+      
Sbjct: 128 GLETLTLA-RNPLRALPASIASLNRLRELSIRAC--------PELTELPEPLASTD---- 174

Query: 459 GLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQME 518
                   GL +L  L L +  I  +P  I  L +L++L +R +   +L  +I    ++E
Sbjct: 175 --ASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLE 232

Query: 519 ELILSNCNLLQSLPE----LPPSLILLEARNCKQLQSLPE----LSSYLEELDAS---KL 567
           EL L  C  L++ P         L  L  ++C  L +LP     L+  LE+LD      L
Sbjct: 233 ELDLRGCTALRNYPPIFGGR-APLKRLILKDCSNLLTLPLDIHRLTQ-LEKLDLRGCVNL 290

Query: 568 ETL 570
             L
Sbjct: 291 SRL 293

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		857
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.98
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.98
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.98
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.98
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.96
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.96
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.96
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.95
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.95
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.94
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.94
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.93
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.92
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.92
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.92
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.91
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.9
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.9
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.9
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.9
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.89
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.88
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.88
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.87
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.87
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.87
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.87
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.86
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.86
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.86
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.86
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.85
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.85
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.84
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.81
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.81
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.8
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.8
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.79
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.79
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.78
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.78
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.77
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.76
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.76
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.76
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.75
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.75
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.74
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.73
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.73
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.72
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.72
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.71
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.71
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.71
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.7
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.69
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.68
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.67
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.66
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.66
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.64
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.6
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.6
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.6
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.59
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.59
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.58
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.57
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.57
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.55
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.55
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.55
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.54
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.53
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.53
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.51
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.51
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.5
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.5
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.48
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.47
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.41
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.39
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.37
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.35
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.31
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.31
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.3
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.28
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.28
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.28
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.27
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.25
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.19
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.19
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.1
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.04
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.02
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.0
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.0
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.98
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.95
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.66
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.65
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.62
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.62
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.61
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.51
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.44
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.35
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.28
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.26
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.25
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.84
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.73
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.54
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.47
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.43
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.38
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.29
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.01
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.8
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.13
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	90.4
2fna_A		357	Conserved hypothetical protein; structural genomic	89.87

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

Probab=100.00  E-value=4.1e-34  Score=340.69  Aligned_cols=339  Identities=14%  Similarity=0.166  Sum_probs=268.8

Q ss_pred             cCCccccccCCeeEEEEeCCCCCC------------------CCCCC---CCCCccEEEcCCCCCc-ccccCcCCCCCcc
Q 003011          206 LHNGLDYLSDELRYLHWHGYPLKT------------------LPSNF---SPENLIELNLPYSKVE-QMWEGKKESFKLK  263 (857)
Q Consensus       206 l~~~l~~l~~~Lr~L~l~~~~l~~------------------lp~~~---~l~~L~~L~Ls~n~l~-~l~~~~~~l~~L~  263 (857)
                      +|..+..+ ++|++|++++|.+..                  +|..+   ++++|++|+|++|.+. .+|..+.++++|+
T Consensus       198 ip~~l~~l-~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  276 (636)
T 4eco_A          198 VSKAVMRL-TKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQ  276 (636)
T ss_dssp             ECGGGGGC-TTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCC
T ss_pred             CCHHHhcc-cCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCC
Confidence            77888888 589999999999888                  88876   4889999999998865 6788889999999


Q ss_pred             EEEccCCC-CCc-cCC-CCCCC------CccceeeccCCccCCccCC--cccCCCCCcEEeccCCCCCcccCCCC-CCCC
Q 003011          264 WIDLHHCQ-YLI-RFP-DPLET------PNLERICLSDCIDLPCIPS--SIENFNNLSILCLQGCESLRRFPSNI-HFRS  331 (857)
Q Consensus       264 ~L~Ls~~~-~l~-~lp-~l~~l------~~L~~L~L~~~~~~~~~p~--~i~~l~~L~~L~L~~c~~l~~lp~~~-~l~~  331 (857)
                      +|+|++|+ +.. .+| .+..+      ++|++|++++|... .+|.  .++++++|++|++++|...+.+| .+ .+++
T Consensus       277 ~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~-~ip~~~~l~~l~~L~~L~L~~N~l~g~ip-~~~~l~~  354 (636)
T 4eco_A          277 LINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLK-TFPVETSLQKMKKLGMLECLYNQLEGKLP-AFGSEIK  354 (636)
T ss_dssp             EEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCS-SCCCHHHHTTCTTCCEEECCSCCCEEECC-CCEEEEE
T ss_pred             EEECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCcCC-ccCchhhhccCCCCCEEeCcCCcCccchh-hhCCCCC
Confidence            99999997 555 566 45554      89999999998776 8888  89999999999998866555888 45 7888


Q ss_pred             CcEEEcCCCCCCCccccccc---C-cceEEecCccceecCccccCCC--cceEEEccCcccccccccccc-------CCC
Q 003011          332 PITLDFSDCLNLTEFPQFSG---N-IKQLYLCGTAIEEVPSSVECLT--ELAELYMRQCTRLKSISSRIC-------KLK  398 (857)
Q Consensus       332 L~~L~Ls~~~~l~~~p~~~~---~-L~~L~L~~~~l~~lp~~l~~l~--~L~~L~L~~~~~l~~lp~~l~-------~l~  398 (857)
                      |+.|++++|... .+|..+.   + |+.|++++|.++.+|..+..++  +|+.|++++|...+..|..+.       .++
T Consensus       355 L~~L~L~~N~l~-~lp~~l~~l~~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~  433 (636)
T 4eco_A          355 LASLNLAYNQIT-EIPANFCGFTEQVENLSFAHNKLKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGI  433 (636)
T ss_dssp             ESEEECCSSEEE-ECCTTSEEECTTCCEEECCSSCCSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCC
T ss_pred             CCEEECCCCccc-cccHhhhhhcccCcEEEccCCcCcccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCC
Confidence            999999988543 6665443   5 8889999999998888877654  899999999988888888777       788


Q ss_pred             CCCEeeccCCCCCCccccccCCCCCCCEEeccCCccccCCCCcccccCc-----CCcceeeccccCCc-CCC-CC--CCC
Q 003011          399 SLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILP-----SSIANWSYGCRGLI-LPP-LP--GLS  469 (857)
Q Consensus       399 ~L~~L~Ls~~~~~~~~~~~l~~l~~L~~L~L~~n~i~~lp~~~~~~~lp-----~~L~~L~l~~~~~~-~~~-l~--~l~  469 (857)
                      +|+.|++++|.+....+..+..+++|+.|++++|.++.+|...+....+     ++|+.|+++.+.+. +|. +.  .++
T Consensus       434 ~L~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~lp~~~~~~~l~  513 (636)
T 4eco_A          434 NVSSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLTKLSDDFRATTLP  513 (636)
T ss_dssp             CEEEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSSSEETTEECTTGGGCCEEECCSSCCCBCCGGGSTTTCT
T ss_pred             CCCEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHHhccccccccccCCccEEECcCCcCCccChhhhhccCC
Confidence            8999999998887544445667899999999999999888776542110     17888888666544 333 44  888


Q ss_pred             CCcEEEeeCCCCccCCCcCCCCCCCCeeeCC------CCcce-eccccccCCCCCcEEecccccccccCCC-CCCCccee
Q 003011          470 SLTGLNLSFRNITEIPKDIGCLSSLRTLDLR------GNNFV-SLPASIKQFTQMEELILSNCNLLQSLPE-LPPSLILL  541 (857)
Q Consensus       470 ~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~Ls------~n~l~-~lp~~l~~l~~L~~L~L~~c~~l~~lp~-l~~sL~~L  541 (857)
                      +|+.|+|++|.++++|..+..+++|+.|+|+      +|.+. .+|..+..+++|+.|+|++|+. +.+|. +.++|+.|
T Consensus       514 ~L~~L~Ls~N~l~~ip~~~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l-~~ip~~~~~~L~~L  592 (636)
T 4eco_A          514 YLVGIDLSYNSFSKFPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLCPSLTQLQIGSNDI-RKVNEKITPNISVL  592 (636)
T ss_dssp             TCCEEECCSSCCSSCCCGGGGCSSCCEEECCSCBCTTCCBCCCCCCTTGGGCSSCCEEECCSSCC-CBCCSCCCTTCCEE
T ss_pred             CcCEEECCCCCCCCcChhhhcCCCCCEEECCCCcccccCcccccChHHHhcCCCCCEEECCCCcC-CccCHhHhCcCCEE
Confidence            9999999999998888888889999999984      45544 7888888899999999999887 67774 66888889


Q ss_pred             ecccccCC
Q 003011          542 EARNCKQL  549 (857)
Q Consensus       542 ~i~~C~~L  549 (857)
                      ++++|+-.
T Consensus       593 ~Ls~N~l~  600 (636)
T 4eco_A          593 DIKDNPNI  600 (636)
T ss_dssp             ECCSCTTC
T ss_pred             ECcCCCCc
Confidence            98888643

PyMOL of 4eco

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		857
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-11
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	5e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	9e-06
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	1e-10
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-10
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-08
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	8e-05
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	5e-09
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-08
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	5e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	0.004
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	1e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	2e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	7e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	4e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.002
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	9e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	0.001
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.001
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.003
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.003

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 65.0 bits (157), Expect = 1e-11
 Identities = 54/386 (13%), Positives = 123/386 (31%), Gaps = 32/386 (8%)

Query: 145 EDIYHVLKKNKGTDSIEGIFLDMSKIREIHLSSR------AFACMTNLRMLKFYVPKLSK 198
           E +  VL K   TD++     D+ ++  +               + NL  + F   +L+ 
Sbjct: 23  EKMKTVLGKTNVTDTV--SQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTD 80

Query: 199 LSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKE 258
           ++ +K         +++           L  L       N I    P   +  +   +  
Sbjct: 81  ITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELS 140

Query: 259 SFKLKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSSIENFNNLSILCLQGCE 318
           S  +  I        ++           +   +         SS +  +   +  L   E
Sbjct: 141 SNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLE 200

Query: 319 SLRRFPSNIHFRSPITLDFSDCLNLTEFPQFSGNIKQLYLCGTAIEEVPSSVECLTELAE 378
           SL    + I   +P                   N+ +L L G  ++++ + +  LT L +
Sbjct: 201 SLIATNNQISDITP--------------LGILTNLDELSLNGNQLKDIGT-LASLTNLTD 245

Query: 379 LYMRQCTRLKSISSRICKLKSLHLLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQP 438
           L +    ++ +++  +  L  L  L L         P     +  L   +       +  
Sbjct: 246 LDLANN-QISNLAP-LSGLTKLTELKLGANQISNISP-----LAGLTALTNLELNENQLE 298

Query: 439 SSNEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNITEIPKDIGCLSSLRTLD 498
             +    L +      Y      + P+  L+ L  L  +   ++++   +  L+++  L 
Sbjct: 299 DISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLS 357

Query: 499 LRGNNFVSLPASIKQFTQMEELILSN 524
              N    L   +   T++ +L L++
Sbjct: 358 AGHNQISDLTP-LANLTRITQLGLND 382

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		857
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.9
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.89
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.87
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.86
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.85
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.85
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.84
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.81
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.77
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.76
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.75
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.73
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.59
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.56
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.53
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.48
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.48
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.47
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.42
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.37
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.34
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.34
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.3
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.27
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.26
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.25
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.15
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.14
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.09
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.01
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.97
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.93
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.91
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.76
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.7
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.64
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.27
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.9
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.27
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.62
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.02

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.90  E-value=1.4e-22  Score=223.27  Aligned_cols=320  Identities=17%  Similarity=0.208  Sum_probs=177.7

Q ss_pred             CCCCccEEEEecCCccccccceeecCCccccccCCeeEEEEeCCCCCCCCCCCCCCCccEEEcCCCCCcccccCcCCCCC
Q 003011          182 CMTNLRMLKFYVPKLSKLSDVKVHLHNGLDYLSDELRYLHWHGYPLKTLPSNFSPENLIELNLPYSKVEQMWEGKKESFK  261 (857)
Q Consensus       182 ~l~~Lr~L~l~~n~~~~~~~~~~~l~~~l~~l~~~Lr~L~l~~~~l~~lp~~~~l~~L~~L~Ls~n~l~~l~~~~~~l~~  261 (857)
                      .+.+|+.|+++++.+.       .+ +++..+ ++|++|++++|.++.+|..-++++|++|++++|.+..++ .+..+++
T Consensus        42 ~l~~l~~L~l~~~~I~-------~l-~gl~~L-~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~  111 (384)
T d2omza2          42 DLDQVTTLQADRLGIK-------SI-DGVEYL-NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT-PLANLTN  111 (384)
T ss_dssp             HHTTCCEEECCSSCCC-------CC-TTGGGC-TTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG-GGTTCTT
T ss_pred             HhCCCCEEECCCCCCC-------Cc-cccccC-CCCCEEeCcCCcCCCCccccCCccccccccccccccccc-ccccccc
Confidence            4567889999887732       22 467777 589999999999988876338889999999999888875 4788889


Q ss_pred             ccEEEccCCCCCccCCCCCCCCccceeeccCCccCCccCCc-------------------ccCCCCCcEEeccCCCCCcc
Q 003011          262 LKWIDLHHCQYLIRFPDPLETPNLERICLSDCIDLPCIPSS-------------------IENFNNLSILCLQGCESLRR  322 (857)
Q Consensus       262 L~~L~Ls~~~~l~~lp~l~~l~~L~~L~L~~~~~~~~~p~~-------------------i~~l~~L~~L~L~~c~~l~~  322 (857)
                      |+.|+++++... .++.......+..+....+......+..                   +...+.........+ ....
T Consensus       112 L~~L~~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  189 (384)
T d2omza2         112 LTGLTLFNNQIT-DIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSN-KVSD  189 (384)
T ss_dssp             CCEEECCSSCCC-CCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSS-CCCC
T ss_pred             cccccccccccc-ccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccc-cccc
Confidence            999998887643 3333344445555554443322211111                   111111111111111 1111


Q ss_pred             cCCCCCCCCCcEEEcCCCCCCCcccc-cccCcceEEecCccceecCccccCCCcceEEEccCccccccccccccCCCCCC
Q 003011          323 FPSNIHFRSPITLDFSDCLNLTEFPQ-FSGNIKQLYLCGTAIEEVPSSVECLTELAELYMRQCTRLKSISSRICKLKSLH  401 (857)
Q Consensus       323 lp~~~~l~~L~~L~Ls~~~~l~~~p~-~~~~L~~L~L~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~  401 (857)
                      ......+++++.+++++|......|. ...+|++|++++|.++.++ .+..+++|+.|++++|...+..+  +..+++|+
T Consensus       190 ~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~  266 (384)
T d2omza2         190 ISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP--LSGLTKLT  266 (384)
T ss_dssp             CGGGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG--GTTCTTCS
T ss_pred             ccccccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc--ccccccCC
Confidence            11111445555555555432222111 1224555555555555443 34445555555555554332221  44455555


Q ss_pred             EeeccCCCCCCccccccCCCCCCCEEeccCCccccCCCCcccccCcCCcceeeccccCCcCCCCCCCCCCcEEEeeCCCC
Q 003011          402 LLSLDDCCRLERFPEITETMECLEYFSLASTTIQEQPSSNEDRILPSSIANWSYGCRGLILPPLPGLSSLTGLNLSFRNI  481 (857)
Q Consensus       402 ~L~Ls~~~~~~~~~~~l~~l~~L~~L~L~~n~i~~lp~~~~~~~lp~~L~~L~l~~~~~~~~~l~~l~~L~~L~Ls~n~l  481 (857)
                      .|+++++...+..  .+..++.++.+.+..|.++.++.                         +..+++++.|++++|++
T Consensus       267 ~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~~-------------------------~~~~~~l~~L~ls~n~l  319 (384)
T d2omza2         267 ELKLGANQISNIS--PLAGLTALTNLELNENQLEDISP-------------------------ISNLKNLTYLTLYFNNI  319 (384)
T ss_dssp             EEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCGG-------------------------GGGCTTCSEEECCSSCC
T ss_pred             EeeccCcccCCCC--ccccccccccccccccccccccc-------------------------cchhcccCeEECCCCCC
Confidence            5555554443321  24444555555555554443322                         44567777777777777


Q ss_pred             ccCCCcCCCCCCCCeeeCCCCcceeccccccCCCCCcEEecccccccccCC-CCCCCcceeeccc
Q 003011          482 TEIPKDIGCLSSLRTLDLRGNNFVSLPASIKQFTQMEELILSNCNLLQSLP-ELPPSLILLEARN  545 (857)
Q Consensus       482 ~~lp~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp-~l~~sL~~L~i~~  545 (857)
                      ++++. +..+++|++|++++|.++.++ .+..+++|++|++++|+.....| .-.++|+.|++++
T Consensus       320 ~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~l~~l~~L~~L~L~~  382 (384)
T d2omza2         320 SDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTPLANLTRITQLGLND  382 (384)
T ss_dssp             SCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGGGTTCTTCSEEECCC
T ss_pred             CCCcc-cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChhhccCCCCCEeeCCC
Confidence            77643 666777777777777777766 56777777777777776443222 1224666666654

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure