Citrus Sinensis ID: 003031
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 855 | 2.2.26 [Sep-21-2011] | |||||||
| O43918 | 545 | Autoimmune regulator OS=H | yes | no | 0.052 | 0.082 | 0.617 | 5e-12 | |
| Q9Z0E3 | 552 | Autoimmune regulator OS=M | yes | no | 0.054 | 0.085 | 0.612 | 8e-12 | |
| Q6PDQ2 | 1915 | Chromodomain-helicase-DNA | no | no | 0.087 | 0.039 | 0.389 | 1e-11 | |
| Q14839 | 1912 | Chromodomain-helicase-DNA | no | no | 0.087 | 0.039 | 0.389 | 3e-11 | |
| Q64127 | 1051 | Transcription intermediar | no | no | 0.076 | 0.061 | 0.428 | 1e-10 | |
| O15164 | 1050 | Transcription intermediar | no | no | 0.076 | 0.061 | 0.414 | 4e-10 | |
| Q6E2N3 | 1163 | E3 ubiquitin-protein liga | no | no | 0.071 | 0.052 | 0.446 | 9e-10 | |
| Q8TDI0 | 1954 | Chromodomain-helicase-DNA | no | no | 0.049 | 0.021 | 0.522 | 1e-09 | |
| O88491 | 2588 | Histone-lysine N-methyltr | no | no | 0.045 | 0.015 | 0.55 | 3e-09 | |
| O16102 | 892 | Chromodomain-helicase-DNA | yes | no | 0.065 | 0.062 | 0.396 | 3e-09 |
| >sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 73.9 bits (180), Expect = 5e-12, Method: Compositional matrix adjust.
Identities = 29/47 (61%), Positives = 38/47 (80%), Gaps = 2/47 (4%)
Query: 739 KNDDSCGICGDGGELICCDNCPSAFHQACLS--IQDLPTGSWFCSNC 783
KN+D C +C DGGELICCD CP AFH ACLS ++++P+G+W CS+C
Sbjct: 294 KNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSC 340
|
Transcriptional regulator that binds to DNA as a dimer or as a tetramer, but not as a monomer. Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Functions as a transcriptional activator and promotes the expression of otherwise tissue-specific self-antigens in the thymus, which is important for self tolerance and the avoidance of autoimmune reactions. Homo sapiens (taxid: 9606) |
| >sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN=Trim24 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 855 | ||||||
| 356542320 | 1311 | PREDICTED: uncharacterized protein LOC10 | 0.950 | 0.620 | 0.428 | 1e-180 | |
| 356546822 | 1310 | PREDICTED: uncharacterized protein LOC10 | 0.960 | 0.626 | 0.420 | 1e-177 | |
| 8777481 | 1145 | unnamed protein product [Arabidopsis tha | 0.892 | 0.666 | 0.418 | 1e-150 | |
| 15232453 | 1189 | Acyl-CoA N-acyltransferase with RING/FYV | 0.892 | 0.641 | 0.398 | 1e-145 | |
| 297834364 | 1173 | hypothetical protein ARALYDRAFT_478922 [ | 0.899 | 0.655 | 0.401 | 1e-134 | |
| 225461640 | 1444 | PREDICTED: uncharacterized protein LOC10 | 0.623 | 0.369 | 0.429 | 1e-113 | |
| 147783856 | 1380 | hypothetical protein VITISV_026339 [Viti | 0.556 | 0.344 | 0.457 | 1e-112 | |
| 302142909 | 1300 | unnamed protein product [Vitis vinifera] | 0.533 | 0.350 | 0.433 | 1e-105 | |
| 255566581 | 1336 | DNA binding protein, putative [Ricinus c | 0.422 | 0.270 | 0.488 | 4e-99 | |
| 224121588 | 727 | predicted protein [Populus trichocarpa] | 0.315 | 0.371 | 0.571 | 2e-97 |
| >gi|356542320|ref|XP_003539616.1| PREDICTED: uncharacterized protein LOC100777440 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 638 bits (1645), Expect = e-180, Method: Compositional matrix adjust.
Identities = 393/918 (42%), Positives = 536/918 (58%), Gaps = 105/918 (11%)
Query: 8 EDVCDDDFEGSRDEHQIFSEVFFRNDPGGTSKRCLVTGVINFEHDDSKISDILLCSNSDN 67
ED+CDD+FEGS +E QIFSEVF N ++++CLV I+FEH+ +K + CS+++N
Sbjct: 8 EDLCDDNFEGSNEERQIFSEVFSGNGIFQSNQKCLVPVAISFEHESAKNTFKSFCSSNEN 67
Query: 68 SSITSQASSKNLNVEDS-HNATENSGGACGSRCYPERSSLEGGNDESLNAKRMKFSVDNL 126
S + +SS+ + E+ N ++S A C PE E NDE +N KRMKFS+ L
Sbjct: 68 SVVLHPSSSRLTHPEEEDFNVIQHSKEA-ALGCVPESFICEDQNDEDVNVKRMKFSLHEL 126
Query: 127 TYIKPKSGQVLTSTDILKGTVAGTSCPSTDSVFRTVALHLVESSNQGITSGRYLLKQNVD 186
+ S + L+S+ + K V+ S +T +A HLVESS G+ S YLL N
Sbjct: 127 ACSRSDSEKKLSSSRLSKVVVSNLSRAATSCDSEPIAFHLVESSKHGVISSCYLLNHNKV 186
Query: 187 N--SAVDDMDVIKQSLPRLDGHDGKEAILGKAIASPISQESSATRLTVASPSVTVAEKSG 244
N +A D +DV + DG+ KE + KA ASP+SQES A R V SPS TV +KSG
Sbjct: 187 NKQAAKDKVDVTNFNSTTADGNIAKELCVSKAAASPVSQESFANRRVVTSPSTTVVKKSG 246
Query: 245 FAQCAAETVDRSISVGLDASNISFKLDAKMDPRSLLQNHIFNLLTAAGWAVERRKRPSRK 304
E V+ S +VG+ SN S L+ + DPR++LQ HI LL AGW++E+R+RPSR+
Sbjct: 247 SPLNPEEMVESS-NVGI--SNASSMLEEE-DPRTILQFHILQLLKMAGWSIEKRQRPSRR 302
Query: 305 YMDTIYRSPEGRLFREFPKVWRVCGENLLADGSNVVPADDGKEWTDINHFHTDLFDTLIN 364
Y +++YR+PEG+ REF K WR+CGE L + N + D KEWTDI+ F +DL TLIN
Sbjct: 303 YPESVYRTPEGKTIREFTKAWRLCGELLSVEKCNFM-CRDYKEWTDISQFWSDLSSTLIN 361
Query: 365 MEKVMCKS-NLANELACQWCLLDPFVLVIFIDRKIGSLRKGDVVKAARSFIVDKREKS-D 422
+EK +S + A LA +W LLDPFV+VIF DRKIG L+KG+ VKA S + K +
Sbjct: 362 VEKTKMQSEDPAAVLAYRWWLLDPFVVVIFFDRKIGVLKKGEAVKATWSLVSSKYMVACA 421
Query: 423 PI---------------------LALENVSSFETHCSQRDLPVH-FDDATLGTKTCPQFD 460
PI + N SF+ S+ L + D L + +
Sbjct: 422 PIGSSSGNLNQVPGGSNVGAVHQARIRNSKSFDKQSSENYLETNKIIDGDLPMDMSEENN 481
Query: 461 PSV--HEVVSSGVT---EQSGQSADEGRKCIKASGINAEDDYSAADVRLKKKTRRKSRKI 515
S H +V S + +QS S +EG K S ++ YSA+DV LKKK RRK +++
Sbjct: 482 ASSVSHGLVHSHDSRDMQQSECSEEEGGKISVDSVFGKDNKYSASDVILKKKMRRKCKRV 541
Query: 516 SEMRLTTLSHSDIQSLTLDIKTEVQDADASGVQLEPKEAQKQFLVNAAVQGSQKTPSSLG 575
SE++L+ HSD+ T+ + ++ D +ASG++ E Q + NA + + + SS+G
Sbjct: 542 SEIKLSMFYHSDMLGSTVTDQVQLLDGEASGLE----EVQDYLVDNAGKKRNCRKLSSVG 597
Query: 576 SCHLQIAKRGSKFEKTHHDCDGSKNGQKRPVTCRIKDDDLLGGELIKNGMW--------- 626
+ I K +C + G + C+IKDDDLL + +N +
Sbjct: 598 AIQRNIRKT---------NCPTA--GTDKSNRCQIKDDDLLVSAIFRNKDFSPKAIRGNS 646
Query: 627 ---------------------------------------FMEGTRTVLSWLIIAGIIALN 647
F G RT+LSWLI G+I+LN
Sbjct: 647 SAKSRKSRGQRKLKSQKGRCRLLPRNPCNAGKHNKDCNRFYLGARTILSWLIDNGVISLN 706
Query: 648 DVIQYRNPKDDAVIKDGLVTNNGIICKCCNLVFSVSQFKIHAGFKPNRPCLNLVMESGKP 707
DVIQYRNPKD+ VIKDG +T +GIIC CC+ V ++S+FK HAGF NRPCLN+ MESG+P
Sbjct: 707 DVIQYRNPKDNVVIKDGRITKDGIICTCCDKVLTLSEFKFHAGFTVNRPCLNIFMESGEP 766
Query: 708 FTLCQLQAWSDEYKSRKSATRAGTVETDEDDKNDDSCGICGDGGELICCDNCPSAFHQAC 767
FTLC LQAWS EYK+R+S +A V D++DKNDDSCG+CG+GGELICCDNCPS FH AC
Sbjct: 767 FTLCLLQAWSAEYKARRSQNQA--VHADDNDKNDDSCGLCGEGGELICCDNCPSTFHLAC 824
Query: 768 LSIQDLPTGSWFCSNCTCWICGDLVNDKEASSSFDALKCSQCEHKYHGECLKDMSKG--A 825
LS Q++P G W+C+NCTC ICG+LV DK+ S + D+L+CSQCEHKYH +CL+D K A
Sbjct: 825 LSTQEIPDGDWYCTNCTCRICGNLVIDKDTSDAHDSLQCSQCEHKYHEKCLEDRDKQEVA 884
Query: 826 VSEAWFCNQSCQEVGNKL 843
+S+ WFC QSCQEV + L
Sbjct: 885 ISDTWFCGQSCQEVYSGL 902
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356546822|ref|XP_003541821.1| PREDICTED: uncharacterized protein LOC100795889 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|8777481|dbj|BAA97061.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15232453|ref|NP_188116.1| Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain [Arabidopsis thaliana] gi|332642075|gb|AEE75596.1| Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297834364|ref|XP_002885064.1| hypothetical protein ARALYDRAFT_478922 [Arabidopsis lyrata subsp. lyrata] gi|297330904|gb|EFH61323.1| hypothetical protein ARALYDRAFT_478922 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225461640|ref|XP_002283071.1| PREDICTED: uncharacterized protein LOC100248637 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147783856|emb|CAN65752.1| hypothetical protein VITISV_026339 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142909|emb|CBI20204.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255566581|ref|XP_002524275.1| DNA binding protein, putative [Ricinus communis] gi|223536466|gb|EEF38114.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224121588|ref|XP_002330738.1| predicted protein [Populus trichocarpa] gi|222872514|gb|EEF09645.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 855 | ||||||
| TAIR|locus:2086395 | 1189 | ROS4 "AT3G14980" [Arabidopsis | 0.338 | 0.243 | 0.491 | 3.4e-146 | |
| TAIR|locus:2201021 | 1138 | AT1G05380 "AT1G05380" [Arabido | 0.251 | 0.188 | 0.441 | 1.4e-50 | |
| TAIR|locus:2147391 | 1179 | AT5G36740 [Arabidopsis thalian | 0.257 | 0.186 | 0.378 | 5.3e-43 | |
| TAIR|locus:2832118 | 1193 | AT5G36670 [Arabidopsis thalian | 0.257 | 0.184 | 0.378 | 5.5e-43 | |
| TAIR|locus:2178828 | 1065 | AT5G58610 "AT5G58610" [Arabido | 0.237 | 0.190 | 0.358 | 2.5e-34 | |
| TAIR|locus:2163961 | 557 | AT5G63900 "AT5G63900" [Arabido | 0.119 | 0.183 | 0.439 | 1.7e-19 | |
| UNIPROTKB|C9JFR1 | 244 | AIRE "Autoimmune regulator" [H | 0.052 | 0.184 | 0.617 | 2e-13 | |
| TAIR|locus:2040550 | 1007 | AT2G36720 "AT2G36720" [Arabido | 0.136 | 0.116 | 0.325 | 4.1e-13 | |
| UNIPROTKB|C9JL37 | 338 | AIRE "Autoimmune regulator" [H | 0.052 | 0.133 | 0.617 | 3.5e-12 | |
| UNIPROTKB|F1PPM4 | 547 | AIRE "Uncharacterized protein" | 0.071 | 0.111 | 0.539 | 5.5e-12 |
| TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 746 (267.7 bits), Expect = 3.4e-146, Sum P(3) = 3.4e-146
Identities = 151/307 (49%), Positives = 196/307 (63%)
Query: 552 KEAQKQFLVNAAVQGSQKTPSSLGSCHLQIAKRGSKFEKTHHDCDGSKNGQKRPVTCRI- 610
K+A+K + + + GS T + G R S+ +KT +K R CR+
Sbjct: 545 KKARKHYTQDDDLMGSTITRNK-GKF-----SRSSQKKKTQKPKARTKKRNNRG-GCRLL 597
Query: 611 -KDDDLLGGELIKNGMWFMEGTRTVLSWLIIAGIIALNDVIQYRNPKDDAVIKDGLVTNN 669
+ + + G W + G RTVLSWLI +I+ ++VIQ R+P DD V+K GLVT +
Sbjct: 598 PRSSSNVENHFFQ-GNWSILGPRTVLSWLIATKVISRDEVIQLRDPDDDTVVKTGLVTKD 656
Query: 670 GIICKCCNLVFSVSQFKIHAGFKPNRPCLNLVMESGKPFTLCQLQAWSDEYKSRKSATRA 729
G++C CCN S+S+FK HAGF N PCLNL M SGKPF CQL+AWS EYK+R++ R
Sbjct: 657 GVVCTCCNKTVSLSEFKNHAGFNQNCPCLNLFMGSGKPFASCQLEAWSAEYKARRNGWRL 716
Query: 730 GTVETDEDDKNDDSCGICGDGGELICCDNCPSAFHQACLSIQDLPTGSWFCSNCTCWICG 789
+ +DD NDDSCG+CGDGGELICCDNCPS FHQACLS+Q LP GSW+CS+CTCWIC
Sbjct: 717 E--KASDDDPNDDSCGVCGDGGELICCDNCPSTFHQACLSMQVLPEGSWYCSSCTCWICS 774
Query: 790 DLVNDKEASSSFDALKCSQCEHKYHGECLKDMSKGA--VSEAWFCNQSCQEVGNKLGQGR 847
+LV+D A S D KCSQC HKYHG CL+ +SK E +FC ++C++V N L R
Sbjct: 775 ELVSDN-AERSQD-FKCSQCAHKYHGTCLQGISKRRKLFPETYFCGKNCEKVYNGLSS-R 831
Query: 848 VSAL-PN 853
V + PN
Sbjct: 832 VGIINPN 838
|
|
| TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178828 AT5G58610 "AT5G58610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163961 AT5G63900 "AT5G63900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JFR1 AIRE "Autoimmune regulator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JL37 AIRE "Autoimmune regulator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPM4 AIRE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 855 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 5e-11 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 3e-09 | |
| cd11726 | 127 | cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha | 4e-07 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 7e-07 | |
| cd11672 | 120 | cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD | 9e-04 | |
| cd00122 | 62 | cd00122, MBD, MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8 | 0.002 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 57.9 bits (140), Expect = 5e-11
Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 7/49 (14%)
Query: 744 CGICG---DGGELICCDNCPSAFHQACLSI----QDLPTGSWFCSNCTC 785
C +CG D GEL+ CD C FH ACL +++P G W+C C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213032 cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD-like zinc finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238069 cd00122, MBD, MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 855 | |||
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.19 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 99.01 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 98.98 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.5 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.48 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 98.3 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.28 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 98.06 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.94 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.9 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.89 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.88 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 97.86 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.86 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.76 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 97.7 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.68 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.59 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.55 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.52 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.49 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.23 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 96.86 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.81 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 96.67 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 96.34 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.19 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 95.93 | |
| cd00122 | 62 | MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and | 95.19 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.17 | |
| cd01396 | 77 | MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are me | 94.92 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 94.65 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 94.13 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 94.03 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 93.86 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 93.84 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 93.36 | |
| PF01429 | 77 | MBD: Methyl-CpG binding domain; InterPro: IPR00173 | 92.66 | |
| smart00391 | 77 | MBD Methyl-CpG binding domain. Methyl-CpG binding | 90.77 | |
| KOG1081 | 463 | consensus Transcription factor NSD1 and related SE | 88.15 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 86.23 | |
| cd01397 | 73 | HAT_MBD Methyl-CpG binding domains (MBD) present i | 85.68 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 85.34 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 82.39 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 80.88 |
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
Probab=99.19 E-value=3.9e-12 Score=133.83 Aligned_cols=94 Identities=30% Similarity=0.709 Sum_probs=78.6
Q ss_pred cccccccccc----------CCceeecCCCCCccccccccc-----CCCCCCCccccccc-ccccCCCCCCCccCCCcCc
Q 003031 740 NDDSCGICGD----------GGELICCDNCPSAFHQACLSI-----QDLPTGSWFCSNCT-CWICGDLVNDKEASSSFDA 803 (855)
Q Consensus 740 ndD~C~VCgd----------GGeLLcCD~CPraFHlsCLgp-----~~vPeG~W~Cp~C~-C~ICge~~~D~e~~s~~~L 803 (855)
...+|-.|-. +.+|+.|..|+++-|++||.. ..+..+.|+|..|+ |.|||-. .++..+
T Consensus 223 Pn~YCDFclgdsr~nkkt~~peelvscsdcgrsghpsclqft~nm~~avk~yrwqcieck~csicgts------enddql 296 (336)
T KOG1244|consen 223 PNPYCDFCLGDSRENKKTGMPEELVSCSDCGRSGHPSCLQFTANMIAAVKTYRWQCIECKYCSICGTS------ENDDQL 296 (336)
T ss_pred CCcccceeccccccccccCCchhhcchhhcCCCCCcchhhhhHHHHHHHHhheeeeeecceeccccCc------CCCcee
Confidence 3467877742 568999999999999999984 45667899999998 8999976 344679
Q ss_pred ccccccchhchhhhccCCcCCCCCCceeeCCccHHHH
Q 003031 804 LKCSQCEHKYHGECLKDMSKGAVSEAWFCNQSCQEVG 840 (855)
Q Consensus 804 L~CdqCeraYHv~CL~p~~~~~p~G~WFCs~~CkeI~ 840 (855)
++||-|+|+||++||.|+..+.|+|.|-|- -|-+.+
T Consensus 297 lfcddcdrgyhmyclsppm~eppegswsc~-KOG~~~ 332 (336)
T KOG1244|consen 297 LFCDDCDRGYHMYCLSPPMVEPPEGSWSCH-LCLEEL 332 (336)
T ss_pred EeecccCCceeeEecCCCcCCCCCCchhHH-HHHHHH
Confidence 999999999999999999888889999994 665544
|
|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF01429 MBD: Methyl-CpG binding domain; InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer | Back alignment and domain information |
|---|
| >smart00391 MBD Methyl-CpG binding domain | Back alignment and domain information |
|---|
| >KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01397 HAT_MBD Methyl-CpG binding domains (MBD) present in putative chromatin remodelling factor such as BAZ2A; BAZ2A contains a MBD, DDT, PHD-type zinc finger and Bromo domain suggesting that BAZ2A might be associated with histone acetyltransferase (HAT) activity | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 855 | ||||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 5e-12 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 2e-11 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 4e-10 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 2e-09 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 1e-08 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 1e-08 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 3e-07 | ||
| 4gnd_A | 107 | Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains | 9e-07 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 3e-04 |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
|
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
Score = 85.9 bits (213), Expect = 7e-21
Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
Query: 735 DEDDKNDDSCGICGDGGELICCDNCPSAFHQACLS--IQDLPTGSWFCSNCTCWIC 788
D + + C +C DGGEL+CCD CPS++H CL+ + ++P G W C CTC
Sbjct: 3 LGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPAL 58
|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 855 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.77 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.73 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.71 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.67 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.23 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.1 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 99.09 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.08 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.04 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.03 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.02 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.02 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.02 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.0 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.99 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.95 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.94 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.91 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.9 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.85 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.85 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.79 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.78 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.75 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.72 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.58 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.56 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.53 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.53 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.45 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.45 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.45 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.44 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.43 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.4 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.39 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.38 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.33 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.32 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.31 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.3 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.28 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.26 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.26 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.26 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.26 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.25 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.23 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.23 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.17 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.02 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.97 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 97.96 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 97.95 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 97.94 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.93 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 97.88 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 97.88 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.81 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.63 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.56 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.52 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.44 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 97.34 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.33 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.33 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.33 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.26 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.21 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.2 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.15 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.14 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.11 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 96.95 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 96.94 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 96.85 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 96.85 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.8 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 96.8 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.79 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.78 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.76 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 96.76 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.74 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.63 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.61 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 96.61 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.47 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.36 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 96.32 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.17 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.13 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.0 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 95.88 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 95.73 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.72 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 95.67 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 95.6 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 95.56 | |
| 1d9n_A | 75 | Methyl-CPG-binding protein MBD1; PCM1, methylation | 95.48 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 95.13 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 95.11 | |
| 2ky8_A | 72 | Methyl-CPG-binding domain protein 2; DNA binding d | 94.91 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 94.81 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 94.58 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 94.11 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 93.9 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.58 | |
| 3vxv_A | 69 | Methyl-CPG-binding domain protein 4; methyl CPG bi | 93.46 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 93.05 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 93.0 | |
| 3c2i_A | 97 | Methyl-CPG-binding protein 2; water mediated recog | 92.19 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 90.11 | |
| 1ub1_A | 133 | MECP2, attachment region binding protein; chicken | 89.38 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 88.07 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 87.47 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 86.33 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 85.23 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 84.47 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 82.57 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.77 E-value=2.5e-19 Score=163.34 Aligned_cols=95 Identities=28% Similarity=0.813 Sum_probs=81.7
Q ss_pred cccccccccccccCCce---eecCCCCCcccccccccCC--CCCCCccccccc-ccccCCCCCCCccCCCcCcccccccc
Q 003031 737 DDKNDDSCGICGDGGEL---ICCDNCPSAFHQACLSIQD--LPTGSWFCSNCT-CWICGDLVNDKEASSSFDALKCSQCE 810 (855)
Q Consensus 737 ed~ndD~C~VCgdGGeL---LcCD~CPraFHlsCLgp~~--vPeG~W~Cp~C~-C~ICge~~~D~e~~s~~~LL~CdqCe 810 (855)
.+.++++|.+|+++|++ ++|+.|+++||+.|+++.. ++.+.|+|+.|. |.+|++... ...++.|++|+
T Consensus 3 ~~~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~~C~~C~~~~~------~~~ll~Cd~C~ 76 (111)
T 2ysm_A 3 SGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGE------DSKMLVCDTCD 76 (111)
T ss_dssp CCCCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTCCCTTTCCCSC------CTTEEECSSSC
T ss_pred CCCCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCCcccccCccCC------CCCeeECCCCC
Confidence 34688999999998876 9999999999999999844 457899999995 999998632 25689999999
Q ss_pred hhchhhhccCCcCCCCCCceeeCCccHH
Q 003031 811 HKYHGECLKDMSKGAVSEAWFCNQSCQE 838 (855)
Q Consensus 811 raYHv~CL~p~~~~~p~G~WFCs~~Cke 838 (855)
++||..|++++....|.+.|||+ .|..
T Consensus 77 ~~yH~~Cl~ppl~~~P~g~W~C~-~C~~ 103 (111)
T 2ysm_A 77 KGYHTFCLQPVMKSVPTNGWKCK-NCRI 103 (111)
T ss_dssp CEEEGGGSSSCCSSCCSSCCCCH-HHHC
T ss_pred cHHhHHhcCCccccCCCCCcCCc-CCcC
Confidence 99999999998888889999997 6643
|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1d9n_A Methyl-CPG-binding protein MBD1; PCM1, methylation, DNA binding domain, gene regulation; NMR {Homo sapiens} SCOP: d.10.1.3 PDB: 1ig4_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2ky8_A Methyl-CPG-binding domain protein 2; DNA binding domain, transcription-DNA complex; HET: DNA 5CM TED; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3vxv_A Methyl-CPG-binding domain protein 4; methyl CPG binding domain, protein-DNA complex, versatIle BA recognition, hydrolase-DNA complex; HET: DNA 5CM; 2.00A {Mus musculus} PDB: 3vxx_A* 3vyb_A* 3vyq_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3c2i_A Methyl-CPG-binding protein 2; water mediated recognition; HET: DNA 5CM; 2.50A {Homo sapiens} PDB: 1qk9_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1ub1_A MECP2, attachment region binding protein; chicken methyl-CPG-binding protein 2 (cmecp2), MAR-binding protein (ARBP), spectroscopy; NMR {Gallus gallus} SCOP: d.10.1.3 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 855 | ||||
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 5e-16 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 9e-14 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 2e-10 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 7e-10 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 4e-09 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 6e-09 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-08 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 5e-07 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 8e-06 | |
| d1ig4a_ | 75 | d.10.1.3 (A:) Methylation-dependent transcriptiona | 8e-05 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 2e-04 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 2e-04 | |
| d1qk9a_ | 92 | d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 | 0.001 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.003 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.7 bits (173), Expect = 5e-16
Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 2/52 (3%)
Query: 736 EDDKNDDSCGICGDGGELICCDNCPSAFHQACL--SIQDLPTGSWFCSNCTC 785
D + + C +C DGGEL+CCD CPS++H CL + ++P G W C CTC
Sbjct: 4 GSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTC 55
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1ig4a_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 855 | |||
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.95 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.8 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.41 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.36 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.14 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.08 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.03 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.02 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.94 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 97.65 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.51 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.46 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.45 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.44 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.25 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.16 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.99 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.8 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.62 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.22 | |
| d1ig4a_ | 75 | Methylation-dependent transcriptional repressor MB | 96.12 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 96.12 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.28 | |
| d1qk9a_ | 92 | Methyl-CpG-binding protein 2, MECP2 {Human (Homo s | 93.31 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 91.59 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 86.54 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.95 E-value=1.9e-10 Score=93.53 Aligned_cols=51 Identities=47% Similarity=1.288 Sum_probs=45.3
Q ss_pred cccccccccccccCCceeecCCCCCccccccccc--CCCCCCCcccccccccc
Q 003031 737 DDKNDDSCGICGDGGELICCDNCPSAFHQACLSI--QDLPTGSWFCSNCTCWI 787 (855)
Q Consensus 737 ed~ndD~C~VCgdGGeLLcCD~CPraFHlsCLgp--~~vPeG~W~Cp~C~C~I 787 (855)
++.++++|.+|+++|+|+.||.|+++||..|+++ ..+|.+.|+|+.|++..
T Consensus 5 ~d~~~~~C~~C~~~g~lv~Cd~C~~~~H~~C~~~~~~~~~~~~W~C~~C~~~~ 57 (61)
T d1mm2a_ 5 SDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPA 57 (61)
T ss_dssp SCSSCSSCTTTCCCSSCBCCSSSCCCBCSSSSSSCCSSCCSSCCCCTTTTTTC
T ss_pred ccCCcCCCcCCCCCCeEEEeCCCCccCchhhcCCCcCcCCCCcEECCCCcCcc
Confidence 5677889999999999999999999999999985 66788899999998653
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig4a_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|